Telit Communications PLC I telit2market international I Issue 06 I May 2011 I www.telit.

com

ISSUE

06 11

telit
Telit World Customer Applications >> 57

2market
The Telit m2m Magazine
Deutsche Telekom International m2m Partner Portal >> 126

Beecham Research Towards Internet Everywhere >> 110

Telits Motorola M2M Acquisition A Further Success Gene > 12 >

Innovation and Passion: The Basis for Success

by Oozi Cats >> 04

Interviews with: Reports by:

Korean Communications Commission >> 38 KT, Korea >> 42 Magneti Marelli, Italy >> 104 China Telecom >> 106 Connected Development, USA >> 112 Robert Madelin, European Commission >> 92 Antonio Calmon, Kaitech Consulting and Flavio Sakai, Continental Brazil >> 95 Prof. Dr. Axel Sikora, DHBW Lrrach, Germany >> 99 Dr. Roman Friedrich, Booz & Company, Europe >> 102

06I11 CONTENT
03 TELITInTro
Chicco Testa, Chairman of the Board Telit Communications PLC Oozi Cats, CEO Telit Communications PLC Alexander Sator, Board of Directors >> Most companies would confidently claim Telit Communications PLC portfolio to have their product control, regardless of whether underYossi Moscovitz, COO Telit Communications PLC they provide products or services. We believe, however, that most companies Dominikus Hierl, dont knowTelit Communicationsall, which CMO their portfolio at PLC probably sounds rather odd, but its true. Gideon Rogovsky, CEO Telit Wireless Solutions Israel First of all, lets think about what a product actually is. People would usually consider a14 TELITcompETEncE product to be something a company manufactures, processes, or refines and then goes R&D Challenge and Chance on to sell for a profit, thereby contributing to Automotive R&D Team increase the corporate value. And in this 2011 Telit Quality indeed respect, companies do Challengeknow their The Telit well. After all, they products quite Technical Forum have sales teams, product and service management, key account organizations, and they under20 TELITproducTs take market research, supply chain analysis, costing and much more. direct Leading Change through The departments New Product Development portfolio involved in the product research and development, purchasing, pro Re-evolution in Remote Control duction, sales make up a companys core via GSM functions. These departments also have the Cellular Product Range Cellular Product Range MOT by Telit The New Telit ISM-Band Product Family The Telit Combined Wireless Offer for the Internet of Things GPRS to Wireless M-Bus and Universal ISM Gateway Short Range Products

TELITLIvIng

TELIT2MArKET 06|11

44 TELITgLobaL
Telit EMEA: Telit Communications Year in a Nutshell Telit North America Update Telit Latin America: Blossom the Seeds of Success Telit APAC Update most members sitting on the board. So, yes, companies do take their product portfolio seriously; in fact, theres nothing a company 48 TELITgrEEn takes more seriously than its product port Tracking Imperial Eagles in the Balkans folio. That is, if youre looking at a product from this traditional point of view.

116 TELITsaLEs
Telits Sales Force Two is Better than One when Talking about Customer Focus

118 TELITcompETEncE cEnTEr

emissions Competence Centers Telit or when we reward them for contributing to apprenticeship programs. Technology Evolution and the And, of course, when communication crises Challenges of LTE Module Integration develop into company crises and pose real threat to corporate value.

50 TELITworLd
But you can also take another perspective m2m Connectivity for Elevators and consider all that a company generates as Going Wireless The Future of GSM output to be its product. From this perspecTechnology in the Metering Market tive, a mechanical engineering companys Customer include machines, the waste portfolio would Applications water generated during the production process and even the apprentices under training. 92 TELITExpErT TaLk And, of course, communication. Particularly Interview Its Robert Madelin, communication.withan output that no comInformation Society and Media pany can avoid. (European Commission) Interview with Antonio Calmon, Fromproducttooutput Kaitech Consulting sociopolitical perFrom an economic and and Flavio Sakai, Continental Brazil spective, this does indeed make sense and is reflected in processes and structures for Interview with Prof. Dr. Axel Sikora, instance, when we talkBaden-WrttemDuale Hochschule about companies financial responsibilities for their CO 2 berg, Germany Interview with Dr. Roman Friedrich, Booz & Co. GmbH

122 TELITprEss
Nowadays, it is essential that companies Global Communication for a focus on their output. Long gone are the days Global Brand when customers, employees, partners, NGOs, Successful Communication governments, the financial community and through all Channels the media were only interested in a companys products in the traditional sense. When it comes to evaluating a company, even in 126 TELITparTnErshIps economic terms, greater importance is now Deutsche Telekom launches being attached to its entire output, especially International m2m Partner Portal to its communication. m2m Solution Factory Successful Networking with Deutsche companies It is therefore high time that Telekom Sprint is the One Trusted Partner move from product management to output for m2m management. Essentially, this means that they need to manage all elements of their output portfolio proactively and profession130 TELITLIvIng ally and view them as core functions that Treat Communication as a Core drive corporate value. Product

104 TELITmarkET
Holistic Vision for Sustainable Mobility Facilitating Low-carbon Economy through The Internet of Things Towards Internet Everywhere Whats driving Growth in m2m for 2011 and beyond?

IMPrINT telit2market: The global magazine for clients and partners of Telit Wireless Solutions Published by: Oozi Cats, CEO Telit Communications PLC Chief Editor: Alexander Bufalino, VP Global Marketing Concept and Design: Pantos Werbeagentur GmbH, www.pantos.de Copyright: by Telit Communications S.p.A. Circulation: 67,000 annual reader Service: TelitToMarket@telit.com

38 TELITsTory
Gearing Up Towards a Smart Environment Service Enablement Services: Catalyst for Change in m2m An Outline of the m2m Business and Strategy at KT

115 TELITdIsTrIbuTIon
Telit Around The World

EMEA Telit Communications S.p.A. Via Stazione di Prosecco, 5/B, 34010 Sgonico (Trieste), Italy Ph: + 39 040 4192 200, Fax: +39 040 4192 289 TelitToMarket@telit.com, www.telit.com

North America Telit Wireless Solutions Inc. 3131 RDU Center Drive, Suite 135, Morrisville, NC 27560, USA Ph: +1 888 846 9773, Fax: +1 888 846 9774 northamerica@telit.com, www.telit.com

Latin America Telit Wireless Solutions Inc. Rua Cunha Gago, 700 cj 81, Pinheiros, So Paulo SP, 05421001, Brazil Ph: +55 11 2679 4654, Fax: +55 11 2679 4654 latinamerica@telit.com, www.telit.com

APAC Telit Wireless Solutions Co. Ltd., APAC 12th floor, Shinyoung Securities Building, 34-12, Yeouido-dong, Yeongdeungpo-gu Seoul, 150-884, Korea Ph: +82 2 368 4600, Fax: +82 2 368 4606 TelitAPAC@telit.com, www.telit.com

TELIT2MARKET 06|11

TELITINTRO

+++News+++
Telit introduces worldwide smallest 3.75G penta-band module for industrial and consumer applications +++ RedtailTelematicstapsTelitforautomotiveassettracking+++PomdevicesmHealthsolutionSonambaconnects seniorstocaregiversusingTelitmodule+++JanusRemoteCommunicationsannouncesPTCRBcertificationfor theirnewGSM/GPRSPlug-InTerminus +++ TelitcompletesacquisitionofMotorolaSolutionsm2mmodules businessunit +++ Telitsfuture-proofHEmoduleseriesoffersextensivefunctionality +++ Telitdevelopstesting platformforeCALLapplications +++ WorldssmallestGSM/GPRSmoduleTelitsGE865-QUADinNAVIGON's70 PremiumLiveembedded +++ TelitlaunchesworldsfirstOnlineTechnicalSupportForumform2m +++ Telitm2m modulepowersnewCDMAterminalfromJanusremotecommunications +++ CoyoteSystemexpandsitsuseofthe worldssmallestGSM/GPRSmodule +++ Telitsupportssmartmeteringinitiativeswithenergy-efficient,wireless M-Busmodule +++ TelitexpandsitsportfoliowithmodulesfirsttimeusingLCCcastellationpackaging +++ New Walsh Wireless usage-based car insurance device fueled by Telit cellular module +++ Telit starts to distribute directlyinGauteng,SouthAfrica +++ Telitsgloballycompatible3GCellularModuleearnscertificationonAT&Ts NationwideWirelessNetwork +++ TelittechnologycertifiedtoconnectsmartdevicesovertheVerizonwireless network +++ TelitandTobehavestruckadealontheproductionofthesmallesttrackingdeviceintheworld +++

Dear Reader, 2010 has been a year of recovery for the global economy, and the m2m market was no exception. Within this context, we have maintained focus on continued organic revenue growth which we have increased by 48.2% over the 2009 mark with significant improvement in operating and net profitability levels, resulting in net profit of $7.6 million. The transfer of manufacturing to China was substantially concluded by the beginning of 2010 and provided us with the competitiveness and flexibility needed to support continued revenue growth and increase in market share. The m2m market is growing fast and continuously. New segments are regularly emerging and existing ones expanding; new application areas surface requiring innovative technologies, and new technical possibilities are bringing additional applications in their wake. Telit can and will continue to rise to the demands from this permanent cycle. Our investments in research and development, production and quality assurance will continue in the future to secure the innovative power and strong performance that are distinguishing features of a successful global player. We expect to maintain organic growth in addition to growth expected from the acquisition of Motorolas m2m business unit, completed in Q1 2011 and which should enable us to improve our operating and net profit margins beyond the 2010 levels. These factors are all underpinned by a further fundamental aspect of our company: a highly motivated, extremely committed team characterized by outstanding loyalty and reliability. Telit has from the outset been built on the pillar that its human capital represents one of its most decisive competitive factors. We look to 2011 and beyond with great excitement as we continue to gain market share in our bid to achieve our strategic goal becoming the number 1 supplier to the m2m market.

Enrico Testa Chairman of the Board Telit Communications PLC

flexibility

e ormancerforcom tronovaterf owstrong p mance s inng p ive p e r ower innovative p

growth
ss competitivene
ted team

ted team highly motiva

venes i y

growth

TELITINTRO

TELIT2MARKET 06|11

INNOVATIONANDPASSION:
THEBASISFORSUCCESS.

Oozi Cats, CEO Telit Communications PLC

>> Welcometothe6thissueoftelit2market. I am happy to report about an important strategic milestone that depicts the impressive development of Telit during thepastfewyearsandatthesametime representstheimportantbasisforTelit's successfulfuture:thetake-overofm2m modules from Motorola Solutions and theircompleteintegrationintotheTelit productandperformancerange.

Marketshare2009

Marketshare2010

Sagem 2,9% Enfora 5,0% SIM 4,2%

Others 16,4 Motorola m2m 4,8% Telit 12,4%

Rest of market 78%

Telit 22%

17,2%
Sierra Wireless 26,3 Cinterion 28%

Source: Beecham Research, August 2010

Source: Own Research, August 2010

With the acquisition of the m2m division of Motorola, Telit now owns a market share of approximately 22% according to the latest market studies conducted by Beecham Research, determined based on values as of December 31, 2010. Consequently, Telit is part of the three global leaders on the m2m market, jointly accounting for an estimated market share of 70%. This impressively increased market significance is an important prerequisite for the successful implementation of our plans to boost growth on the m2m market in the future. We not only achieve noticeable synergy effects with respect to our cost structure, but also possess extensive research and development capacities, allowing us to offer our customers a broader product portfolio and more comprehensive support for the long-term. In other words, the role of Telit on the m2m market is expected to gain further significance during the next few years. First, however, I would like to address a number of other important developments and events that took place at Telit during the past few months.

TELIT2MARKET 06|11

TELITINTRO

Revenues($mil)
199.5(*) 200 180 160 140 120 100 80 60 40 22.8 20 0 2005 2006 2007 2008 2009 2010 2011 37.8 88.8 86.9 71.5 131.7

(*) Market expectation based on analysts' forecast (April 2011)

ModulesRevenue

li Te

4 t+

8%

Strong past. Even stronger future. Contrary to the global decline in the m2m industry, we ended 2008-9 on a positive note with 24% growth, creating a solid base for 2010 with sales of $132 million representing organic growth of 48%. And a continuing organic growth is what we strive for the next years, additional to growth that will come from acquisitions. Offering services is another important strategic step for Telit. The continuous corporate growth throughout the past years helped Telit achieve the critical size that allows us to assume a significant role also in this segment. The quantity of sold modules and as a result the number of cellular devices respectively of subscribers is now large enough to make the cooperation very lucrative for mobile network operators. Telit will become a very interesting player in this sector, being able to offer connectivity as well as backend services and value added services such as remote network management and FOTA in the future.

Setting standards with successful products.

January 2010

M ellular m2mC

Mar ke odules

% t+20,2

Our products are the main pillar of our sustainable success. Virtually no other than Source: Beecham Research, August 2010 the m2m market is growing at an equal pace, developing new fields of With respect to the year 2011, we are already application and demanding new product so- able to demonstrate our innovative power lutions. Telit has been effective in facing these with two new modules. The HE863 family new challenges making use of the resulting provides 3.75G wireless data connectivity, opportunities with equal success, driven combining access to HSPA networks, GSM, amongst other things by American and GPRS and EDGE services with a standalone European laws within the scope of climate A-GPS receiver in a compact ball-grid-array protection treaties. With the new ME50 module form factor. One of the great advantages the smallest and most powerful product on is the feature scalability: Many product the wireless M-bus market Telit is setting variants are available, all featuring the same clear standards. Together with the GE865 form factor, available with or without voice module launched in the spring of 2009 still and/or without GPS and in addition with the smallest GSM/GPRS quadband module in different pairs of HSPA band support. With the world Telit is the only company offering the HE910 module, Telit is launching the a perfect product combination for automatic smallest m2m module in the world with meter reading applications, effectively de- 5-band HSPA+ on the market. Full global fending its position as one of the technological coverage is provided in a single package, leaders on the m2m market. eliminating the need to swap the device for

December 2010

TELITINTRO
channels in 2010. Almost nothing is more valuable for a company than feedback both positive and negative from customers and decision makers to recognize trends and needs, optimize product developments and obtain an adequate feel for changes on the market. Therefore, Telit will continue the intensive use of Twitter, Facebook, LinkedIn etc. extensively, continuously and globally. Successfully global. Globally successful.
HE910

TELIT2MARKET 06|11

mandatory in all new cars were already felt in the previous year. This boom continued in 2010 and is expected to persist this year too. Please read page 95 onward for an interesting extensive interview with a specialist about this topic. An additional thrust for the m2m market is expected to emerge in connection with the "fiscal printer law". According to this law, any cash registers issuing receipts to customers must be connected to the government's tax collections agencies. The first devices equipped with Telit modules will be officially commissioned this year. The operating profit of Telit for 2010 was also extremely positive in our fourth region, APAC. In Korea, Telit has been the market leader since 2006. In 2010, it achieved an additional upswing thanks to an initiative from the Korean government. The Korean Communications Commission established the program "m2m Roadmap" aimed at making Korea a leading information and communications technology location. This allowed Telit to intensify its collaboration with the government. Amongst other things, Telit secured the supply of the Korean Meteorological Administration. They are working to provide accurate weather forecasts by means of widely used measuring stations, equipped with the BCM-865 module. The business development in China was extremely positive again in the past year. The sales have doubled compared to 2009. The launch of our GE865-DUAL module on the market, presented to more than 100 engineers within the scope of an event in Shenzhen at the end of the year generated a buzz. With this product, the smallest GSM/GPRS surfacemounted module on the market, Telit offers

GE864-GPS ME50-868

different frequencies and countries, and the LGA package provides an ultra-low profile for your integrated solution and reduces costs, especially for high-volume applications. Added value performances. It is one thing to develop innovative and powerful products. We believe that providing customers with additional support and comprehensive service is also part of a company that strives to be successful in the future and to maintain its leading role on the market. Therefore, Telit has established the Telit Technical Forum last year. It connects system integrators, developers and partner companies around the world on an online platform where everybody can ask questions, discuss them and obtain assistance from Telit global technical support teams. Already more than 700 members in more than 55 countries benefit from this Telit support channel. For us, this demonstrates that the demand for powerful offers exceeding the actual module is very high and constantly rising. Success factor customer focus. The dialog with our customers continues to be and has always been a key aspect of our actions. We are convinced that the dialog with customers, users, prospective clients and any other target groups is one of the essential competitive factors for sustainable success of a company. For this reason, special attention was paid to the expansion of the communication across all important social media

The year promised to be successful for EMEA as early as in the spring of 2010. The commitment of our sales team along with the constant support from our technical and engineering teams helped us make big strides forward. For example, in April we announced the delivery of the two millionth GE864 module. Shortly afterward, the decision was made to equip the new Audi A8 with the Telit module UC864-E-AUTO. These outstanding achievements motivated the entire organization to forge ahead with the development and realization of new, innovative and successful products during the remainder of the year, together with expanding the R&D units in Trieste, Cagliari, Sophia Antipolis, Tel-Aviv and Seoul. This has created an ideal basis for future growth. Furthermore, 2010 was an extremely successful year for our organization in North America. Major growth was achieved mainly in the commercial vehicle telematics, buy-here, paythere and pay-as-you-drive auto insurance markets. Please read the chapter "Telit World" for detailed information about applications our customers Consumer Safety Technology, Danlaw, iMetrik and Redtail developed and successfully launched on the market in this segment. The successful business development of the past years continued in Latin America in 2010. On the one hand, the m2m market continues to grow across all segments and on the other hand, this development was strongly supported especially in Brazil with legal regulations. Positive effects of the automotive law that makes theft prevention

www.telit.com/twitter www.telit.com/facebook www.telit.com/linkedin www.telit.com/xing

www.telit.com/techforum

TELIT2MARKET 06|11

TELITINTRO
ful enhancement of our product portfolio. The continuation of the Motorola products will therefore be guaranteed for as long as their manufacture is feasible from a technical point of view. On the other hand, Telit now boasts a significantly improved R&D qualification. With the integration of the newly added, highly skilled R&D team in Tel Aviv, Telit now has a total of five R&D locations worldwide. This once again emphasizes our focus on the further development of trendsetting cellular and short-range modules. Aiming at the future. We are very well aware of the significance of the acquisition of the Motorola m2m division for Telit as well as the entire m2m market. Our responsibility for the new colleagues is our priority in this context and the rapid integration of the entire team into the Telit family is very important to us. Within this context, the further optimization of our organizational structure therefore plays an essential role. Yossi Moscovitz takes over as the President of Telit Wireless Solutions. In strategic issues he will primarily be supported by Golan Haver, VP m2m Strategy. The responsibility for the areas of Global Quality, Global IT and SAP Integration lies with COO Mathi Gurusamy, who is an experienced and skilled specialist in these fields. The key field of Research and Development will be led by Sandro Spanghero, Global VP R&D. This includes, among other things, the new R&D Center, the company's fifth, located in Tel Aviv and the contribution of Danny Israeli as well as the newly established organizational area "Automotive R&D, headed by Massimiliano Lonzar. As CMO, Dominikus Hierl heads the areas of Sales, Marketing, Global Product Management as well with Telit RF the Short Range division, and as Global VP Mike Ueland in addition to North America is also responsible for the area of Value Added Services. The previous VP Telit APAC, Gideon Rogovsky, now takes over as CEO Telit Wireless Solutions Israel and thus has overall responsibility for the integration of the Motorola m2m division in the Telit organization. All other management positions remain unchanged. So we can guarantee the perfect combination of new spirit and solid continuance. The positive effects on the company's performance are just one aspect. Also in light of our new customers, the smooth transition is our ultimate goal. We want to guarantee the continuing availability of Motorola products, but also convince and inspire them about Telit's innovative capability and efficiency.

the perfect module for mobile applications and high-volume manufacturing across all industries in the low unit price segment. To be able to meet the large demand in China in the future and to ensure optimal customer focus, Telit has now established offices in Shenzhen and Shanghai with a total of ten employees. The solidification of our relationship with our manufacturer BYD in China is certainly one of the most strategically relevant aspects. By awarding BYD the "Telit Strategic Supplier 2010 award, the outstanding achievements associated with the development of the production were honored as much as the reliable and mutually successful cooperation. This appreciation was reasonably expressed with a visit from a Telit delegation at the BYD headquarters in early December and the festive conferral of the award during a celebration. Focusing on strengths. The past year has especially shown how much a dynamic market such as the m2m market can change and with which new developments whether technical or of a structural nature it can suddenly generate new situations. This may tempt some enterprises to advance into new sectors and to develop completely new business fields. In contrast, Telit has always been pursuing the clear strategy of focusing on the development and production of modules and offering services that represent a meaningful and especially value adding supplement to these modules. As a result, Telit is the only global player on the m2m market fully focusing on its core competencies, continuing to expand its strengths and as a result standing on a strategically and technically efficient foundation. Our achievements prove that we are on the right track and we will continue to pursue this track consistently and confidently in the future. The recent acquisition of the Motorola m2m division has therefore been a logical step for Telit. On the one hand, it results in a meaning-

Additional noticeable changes are expected on the m2m market in the near future. They are due to technical and demand-related reasons as well as economic, political or even environmental circumstances. We may sense or at least realize early what the future holds, but we cannot predict it accurately. Telit has been very well prepared for new situations in the past. With our new size, our innovative spirit, our passion for new things and not lastly our extensive know-how, we will have the required power to remain one of the most successful m2m enterprises in the future. << We wish you all the best. Oozi Cats Chief Executive Officer Telit Communications PLC

TELITINTRO

TELIT2MARKET 06|11

CREATINGINCREASEDAWARENESS

FORM2M

InterviewwithAlexanderSator, TelitBoardofDirectors

telit2market: Mr. Sator, you joined the Telit board as a Non-Executive Director in the second half of 2010. You bring with you a somewhat unconventional history: at the age of just 13 you were co-founder of a software company at a time when most people had not even heard of the word software. A few years later, you founded an industrial laser systems company and made it market leader. You then worked as a consultant in the telecommunications industry. What were the reasons for this early fascination with high-tech and entrepreneurship? Sator: Well, it was the easiest way to do whatever I wanted. Who is going to interfere with someone whos doing something that almost

nobody, especially your parents, understands? I came up with a lot of ideas back then, which I was later able to use in key patents. The telecommunications industry has fascinated me for some time, because the potential for innovation in it is seemingly endless. t2m: You have experience in all kinds of technologies and industries, and you have demonstrated that you can spot technology trends early on. Why are you getting involved with the m2m market now? Sator: The m2m space is largely mature in terms of its basic technology, certainly, but it still has a long way to go in terms of penetrat-

TELIT2MARKET 06|11

TELITINTRO

Sator: Unfortunately, m2m is still not a word that is familiar to everyone, but it has long since been the interdisciplinary technology you are talking about. Just name me one industry that doesnt use m2m technology, whatever specific communication technology it might be. m2m, however, is less visible than software. It works in the background. One major task for all m2m market players must be to generate more awareness of their roles. Otherwise which freight forwarder will know that hes played a pioneering role in the dissemination of m2m technology? t2m: Over the last few years, you have focused intently on the issue of mobility, including as a strategic consultant for Deutsche Telekom AGs mobile business. How will our understanding of mobility change over the next few years, and what role will m2m module providers play in this? Sator: Cars will still be cars, but I believe that in the foreseeable future, well be able to completely network our vehicles and for various reasons: for safety, for communication and entertainment, for maintenance and servicing, for traffic management and toll collection, and perhaps even at some point for largely autonomous, driverless driving. Module suppliers will therefore need to use several modules in one vehicle for a while in order to provide all these services. In the long term, however, all services will need to be handled transparently and reliably via a single module. In this case, it will be essential to cooperate at a high technical level with the automotive industry to understand what really is feasible and what really is needed. Audi and Telit have already demonstrated the first, impressive steps towards this in the new A8 and all new high- and mid-tier carlines launched from 2011 on. t2m: Where do you see Telit at the moment, in the context of the international competition? What are the companys specific strengths? Sator: Based on my experience, I can say with complete conviction that Telit is the most innovative and fastest-growing company in the competitive arena. Whats particularly impressive is how Telit has converted this growth into momentum without neglecting sustainability and structure. It is for these reasons, after all, that big names have now chosen Telit as their primary supplier. I think that Telit has the opportunity to be the market leader very soon.

t2m: How are you looking to support Telit with your very unique experiences? Sator: Probably the best thing will be for me not to contribute too many ideas no, but seriously, my strengths lie in technological, strategic and cross-industry innovation. Telit is now of a size where this type of input can be useful, and can set long-term new trends in the company that otherwise might be missed. My many years of commitment to the m2m sector will certainly help me in this, but so, too, will my unique perspective on things that go beyond merely the module manufacturers view. t2m: Were at the start of a new decade. Lets risk a look into the future: what technologies will be shaping our lives in 2021? Sator: The Internet, and the knowledge of the Internet, will be omnipresent. <<

vita

ing all layers and markets. In the medium to long term, the m2m market will become one of the biggest growth drivers for network operators and service providers in this environment. On the other hand, as part of this process, there will undoubtedly be another innovation boost that will bring us new, even unexpected, services and products. t2m: What parallels do you see between the development of the software industry, which you have been observing for almost 30 years, and the m2m industry? Do you believe that m2m will achieve comparable coverage and become an interdisciplinary technology that will be used universally?

Alexander Sator, now member of the Board of Directors of Telit Communications PLC, previously Chairman of theBoardatCinterionfrom2008until 2010, was a co-founder of one of the first software companies in Germany in1983,whilestillinhisteens.Aftera short career in the scientific industry hefoundedsatorLaserin1996,which focusedonthedevelopmentoflasers andlasersystemsforindustrialapplications,soonbecomingmarketleader in its specific field. In 2001 Domino Printing services took a stake in this businessandin2005Mr.satorsoldhis remaining shares. Over the last two years Mr. sator has been, along with otheradvisoryengagements,strategy Advisor to the Deutsche Telekom AG formobilebusiness.

10

TELITINTRO

TELIT2MARKET 06|11

ThE TEChnOlOgICal aDvanTagE, DElIvERED ByPEOPLE

2010 was an excellent year for Telit and for the m2m industry. In my past articles for the Telit magazine I have focused on the technological leadership and innovation embodied in Telit products and services. This factor has been the main driver in Telits remarkable growth and top-tier standing in the m2m market. Looking back now, our incursion into m2m started nine years ago with a handful of employees and Telit has since grown to a Global and Multinational complex with 426 employees worldwide. None of Telits achievements would be possible without the hard work, commitment and devotion of each individual in our team.

yossiMoscovitz,President TelitWirelessSolutions
As a customer, you are exposed mainly to our sales, marketing and support teams. Behind these teams is the entire Telit organization aligned to ensure the timely delivery and quality of the products and services you need. When doing business with Telit you are dealing with people. And people make the difference.

I am proud and honored to introduce you to the Telit team:

adi adrian alberto C. alberto l. alejandro alessandra alessandro Be. alessandro Bo. alessandro D. alessandro O. alessandro P. alessandro R. alessia alex B. alex S. alexander B. alexander P. alexandra alfredo allan allen alpay amalia amanda ami B. ami l. amine anderson andrea a. andrea B. andrea F. andrea g. andrea M. andrea P. andrea T. andrea Z. annamaria antonino antonio Pa. antonio Pe. antonio Pil. antonio Pin. antonio Pir. antonio R. ariel artur C. artur W. ashish avi aya Barbara Benzi Boyeon Brian Bruno T. Bruno v. Byungcheol Carlo a. Carlo C. Carlo M. Carlo S. Carlos Cesare Charlie Chen Chicco Chisung Choonseung Choungsuk Cinzia Claudio D. Claudio g. Corrado Cristian M. Cristian v. Cristiana C. Cristiana D. Cristina Fa. Cristina Fo. Cristina M. Cristina P. Crystal Daehwan Dalibor Daniel C. Daniel Z. Daniela C. Daniela v. Daniele l. Daniele Pa. Daniele Po. Daniele S. Danilo Danny Daria Dario Darius David B. David h. David P. Davide Denis Dietmar Dino Dohyung Domenico Domenico Fabio Dominikus Dongwon Dongwoo Dukjun Eduardo Efrat Elena E. Elena K. Elena Pel. Elena Pet. Elhanan Elisabetta Emilia Emmanuel Enrico Eran E. Eran F. Eran l. Eric l. Eric O. Eva Fabio B. Fabio De. Fabio F. Fabio l. Fabio O. Fabio P. Fabio S. Fabrizio D. Fabrizio v. Falco Federico D. Federico v. Felix Filippo Francesca Francesco B. Francesco C. Francesco E. Francesco F. Francesco l. Francesco Pa. Francesco Pe. Frederic gabriele gaetano giamPaolo gianluca ar. gianluca at. gianluca P. gianmarco gianni gianpiero gideon gil gila giorgio C. giorgio D. giuliano giuseppe M. giuseppe P. giuseppe S. golan graziano grety guido haggay hahngwon haim heeseob hogyun hohwan hosang hun hyojung hyungsuk hyunmin hyunseok Igor Ilan Ilaria Ilkwon Irina Itzik Ivan Jack Jacki Jacob Jaehyun Jaekwang Jaeyoung James Jason Jeansang Jeff Jeya Jihoon Jihye Jihyun Jinkyu Jinwoo John g. John S. Jongkap Juhyuk Junghoon Jungil Jungpyo Juri Ken Kenya Keonho Khaled Kyungbok Kyungjun Kyungpo Kyuyong laura lauren leone leonid leslie livio liza luca C. luca M. luca S. luca T. lucia Mads Manuel Manuele Mara Marc-henri Marco a. Marco Cl. Marco Co. Marco Ra. Marco Ru. Marcos Maria Marianna Marie Marina D. Marina Tom. Marina Tor. Mark Martino Massimiliano Massimo B. Massimo D. Massimo F. Massimo M. Mathi Matthew Matthieu Maurizia Maurizio C. Maurizio M. Mauro B. Mauro C. Mauro F. Mauro O. Mauro P. Mauro S. Mayrav Meilu Michael Michal Michela F. Michela R. Michele Mike U. Mike W. Mikyu Milena Minsun Miran Mirko Moshe Motty nadia namjoong natascia neomi neta nicola nicolas nieves nikola nir a. nir B. nisim Ofir Ofra Oozi Paola Paolo F. Paolo g. Paolo l. Paolomaria Pascal Patricia Philip Pierluigi Pierpaolo Pa. Pierpaolo Po. Pieter Pietro Pyeongjin Renata Renato Ricardo B. Ricardo S. Riccardo Rinaldo River Roberta g. Roberta S. Roberto C. Roberto Mili. Roberto Mill. Roberto S. Roberto Z. Roger Roi Romano Ronen Roy Ruth Sabina Saga Sagi Sandro M. Sandro S. Sanghoon Sanghun Sangwoo Sara Se. Sara St. Sason Sehoon Seongjin Seongwhan Seounghwan Seoungok Serge Sergio B. Sergio S. Shachar Sharon B. Sharon E. Shmoel Shmulik Shuki Siegfried Silvana Silvia Simona Siro Slim Soona Sooyong Sophia Stefano D. Stefano R. Stefano Sa. Stefano Se. Stefano Z. Steve C. Steve g. Steven a. Steven J. Sungbong Sunhwa Sunman Taehyoung Taehyun Taeyoun Tal Tatiane Thierry Timoteo Tiran Tomer Tony vadim valentina D. valentina S. valerio vicki vikas vitaly Walter g. Walter S. Werther Willie Wonbok Wongu Wooram Xavier Yafit Yamit Yariv B. Yariv D. Yavuz Yinon Yochanan Yonghwan Yongkeun Yoochang Yoonmi Yossi h. Yossi l. Yossi M. Yuri Ziv Zvi Zvika

TELIT2MARKET 06|11

TELITINTRO

11

CLOSINGTHEGAPTOWARDS GLOBALMARkETLEADERSHIP
DominikusHierl,CMOTelitCommunicationsPLC
>> AtTelitweareveryproudoftheachieteam of seasoned m2m experts, adding their expertise and resources an all operational levels to Telit. Staying true to our product strategy of consistency and long-term product availability, the newly acquired Motorola m2m product portfolio will be continued; product support will be even improved. Telit will invest the necessary resources to make customers using Motorola products in their solution successful in the market for existing and new designs. Telits leverage from the substantially larger business size assists us with regard to managing suppliers and EMS partners, while product certifications are all to be finalized as planned. As the market continues to grow, Telits market share continues to rise. According to market research, in 2010 the total m2m market was about 900 million dollars in size. The combined market share from Telit and Motorola m2m represented approximately 20% of that total. This marks a huge jump from the 12% the year before and gets us very close to our two main competitors presenting strong evidence that we are indeed heading for global leadership in the market. Telit is currently offering the broadest product portfolio in the m2m space, supporting different cellular and short-range wireless technologies for the global markets. In order to create additional growth opportunities for the company, we identified the enhanced value of bundling our first-tier products with relevant services around m2m, enabling customers to implement m2m systems in a much quicker and more efficient way. We are confident that this strategy will give us the push to become the absolute market leader in the global m2m space within a very short time. This new stature in strength translates into additional benefits for all our customers, as we continue to pledge our ever-growing expertise and support capabilities to make them successful in the global market. <<

vementswhichresultedarecordyearfor us in 2010, showing growth way beyond any of our competitors and the market. Our success can clearly be attributed to ourconsistentlong-termstrategyonall relevant key aspects of our business, whichismostimportantforourclientsin the m2m and automotive industries. Customers can count on our very stable productportfolio,continuousinnovation, and best-in-class customer support stemmingfromourvastexperienceinthe fieldofwirelesscommunications.
Over the years, Telit has continuously invested in solutions for the demanding m2m market and focused efforts on building a truly global company both from product and local presence perspectives, while most of our competitors have suffered from being subjects of takeovers, insolvencies and other major structural changes. This rise in power has most recently allowed Telit to acquire the m2m business from Motorola, a strong, long-term competitor in the global market. Today we warmly welcome the Motorola

12

TELITINTRO

TELIT2MARKET 06|11

TELITANDTHEMOTOROLA M2MACQUISITION
GideonRogovsky,CEOTelitWirelessSolutionsIsrael,Tel-Aviv
>> I am pleased to announce that Motorolas m2m Solutions division and Telit have united and are now officially operating as one entity. This new structure unites two market leaders in the m2m Wireless Industry serving various vertical markets such as automotive, AMR, security, and others. Together, we are uniquely positioned to provide the m2m market with a full portfolio of modules supporting all cellular wireless technologies: GSM/GPRS, EDGE, CDMA and HSPA. The combined company will operate as Telit Israel with offices in Tel Aviv. Acquiring the Motorola m2m division has brought about a unique opportunity for Telit to open an R&D center in Israel. The Motorola m2m team brings extensive knowledge, experience and professionalism needed to elevate this journey into a success story. As always, our goal is to continue delivering innovative, high-quality products to our current combined markets. To accomplish this, we will adhere to the established product roadmaps for our existing vertical market solutions while simultaneously exploring opportunities to provide customers with additional value for existing and new market segments. We are confident we have done the utmost to ensure our business relations with our partners continue as before. In the event that there are any unforeseen issues after the conclusion of the transition, contingency plans have been put in place which provide for quick matter resolution. We would like to thank you very much for your trust as we look forward to continuing cooperation. About Motorola Motorola, Inc. has been at the forefront of communication inventions for over 80 years and is leading a wave of innovations that enables people, government

and enterprises to be more connected. Motorolas wide-ranging portfolio of technologies and solutions span a range from consumer wireless handsets and in-home digital entertainment devices to government and public safety mission-critical systems and enterprise mobility products worldwide. In 2009, Motorola (NYSE: MOT) generated revenues of US $22 billion. About Motorola m2m Solutions Motorola m2m Solutions, part of the greater Motorola, specializes in the design, development, integration, evaluation, and deployment of m2m applications worldwide, serving largescale customers such as: Continental, BMW, Harman-Becker Automotive, Tyco Safety Products, Essence Security and SmartSync Smart Grid Intelligence. Motorolas m2m division has been considered industry leader with over 12 years experience in m2m product development and a reputation of long standing partnerships with carriers worldwide, enabling quicker expedition of approvals by AT&T, Verizon, T-Mobile, Telefonica, Vodafone, Orange, and many others. In addition, the organization brings over 9 years of experience in the automotive arena working with 12 automotive manufacturers including Continental, BMW, and Volvo. Telit will continue working hard to earn its customers business, and I want to personally thank you for your loyalty and support. I would like also to use this opportunity to welcome all the new employees that joined Telit Israel and to wish them a long, rewarding, and fruitful career at Telit. <<

TELIT2MARKET 06|11

TELITINTRO

13

AbouttheMotorolam2mwirelessmoduleportfolio:

G24 GSM/GPRS/EDGE Module The G24-GSM/GPRS/EDGE class-10 connectivity module is a robust, RoHS-compliant cellular wireless module that enables virtually seamless connectivity for todays fastestgrowing m2m applications. It is one of the most compact modules and is ideally suited for a wide range of m2m verticals, including: security, tracking, telemetry, automated meter reading (AMR), automotive, telematics control units (TCU) and electronic point-of-sale (EPOS). The G24 supports an optional and powerful JAVA controllable CPU and is certified by all major GSM carriers including AT&T, T-Mobile, Orange, Vodafone and Vivo, and all major international regulatory bodies and approvals.

G30 GSM/GPRS Module The G30-GSM/GPRS series features small dimensions and a cost-effective design, making it an ideal choice for AMR, telematics, security, and ePOS. The G30 Series is offered in three tiers, each supporting a Land Grid Array (LGA) form factor or optional 70-pin B2B Connector, for virtually unlimited m2m design possibilities and compatible with existing G24 designs. G30 Basic: Includes a rich set of features with quad band GSM/GPRS, an extended temperature range, jamming detection, FOTA and embedded data protocols G30 Advanced: Aggregates fullduplex audio and embedded SIM technology to the already featurerich G30 Basic. G30 Premium: Features an embedded application space for easy m2m development, eliminating the need for an external CPU

H24 HSPA Module The H24s blazing fast HSPA connectivity (HSUPA 5.76 Mbps / HSDPA 7.2Mbps) enables true mobile broadband for next generation m2m solutions such as automotive infotainment, fixed-wireless terminals, telemetry, and advanced security systems. The H24 also features enhanced robustness and on-board GPS, making it the ideal solution for location-based applications. The H24 includes receiver diversity for optimal performance under harsh network conditions as well as FOTA for maximum reliability. Its series includes four individual versions, offering the following HSPA-band combinations: H24-Global 850/1900/2100 MHz H24-NA 850/1900/1700-2100(AWS MHz H24-Single 2100 MHz H24 Dual 900/2100 MHz The H24 is certified by AT&T and T-Mobile and all major international regulatory bodies and approvals.

C24 CDMA 1X Module The C24-CDMA 1X module (800/1900 MHz) shares the same form factor as the rest of the Motorola wireless module family, offering easy interchangeability between GSM and CDMA with the G24, for flexibility with a single design solution. The C24 features an internal TCP/IP stack for easy data transfer, FOTA support and SSL for secure connectivity. The C24 also features on-board GPS, including Autonomous GPS, A-GPS, and MS-Based GPS, making it the ideal choice for location-based wireless applications. It is certified by Verizon, Sprint Nextel, Aeris and Kore Telematics and all major international regulatory bodies and approvals.

14

TELITCOMPETENCE

TELIT2MARKET 06|11

R&D

ChAllenge AnD ChAnCe

>> Talking about technology is always

Sandro Spanghero, global VP R&D Telit Communications PlC

challenging and sometimes dangerous but for an IT company it is a mandatory and obvious requirement. At Telit we are accustomed to analyzing mature and new technologies using a particular magnifying glass: the requirements of m2m.
Looking at communication technologies from this point of view it is possible to perceive some differentiation factors that are not present in consumer products. An example of this peculiarity pertains to the GSM/GPRS technology. It is very well known that this communication standard specified in the 1980s is so fully mature that it begs the question: why continue investing in it? This rationale whereas quite legitimate for consumer products with the exception of some emerging countries is not applicable to our market segment. Even now in 2011, more than 20 years after the market introduction of GSM technology, the m2m world finds itself focusing substantial effort in 2/2.5G devices and applications, with carriers pledging to continue maintaining their existing infrastructure for this generation of cellular technology for years and years to come. And this

is the reason why Telit started the development of the so called V2 platform in 2008, launching the first product in that platform in 2009, later completing the migration of the roadmap and also adding new products based on the GL865 form factor. This platform will now extend the life of GPRS products in the Telit portfolio to GE864-QUAD 2016 and beyond. Automotive V2 But the implementation of a new platform is not only motivated by new component introduction, it is much more than that. As per our strategy, V2 products have maintained all features present in our previous platforms while several new features and optimizations that were not possible to be offered in the previous Lite platform have been added in V2. One such new feature that immediately comes to mind is idle current consumption, which is a very relevant parameter for several m2m applications: this value has been reduced by about 40%. Another is the implementation of Release 4 of the 3GPP protocol

layer which imposes much more severe control over the emitted power from the mobile station. Relevant developments, specific for the automotive grade products based on the V2 platform include the implementation of an in-band modem feature subject of a specific white paper available in the Telit web site, and VDA certification, level 2A. The pie diagram in Figure 1 shows the results of the different audio parameters measured in a controlled test environment using standard components for the audio path and using only the echo cancellation parameters embedded into the GE864 Quad Automotive V2. These two features will allow customers to develop low cost e-call applications without using sophisticated external components providing the required flexibility for tuning the application to successfully pass stringent automotive industry requirements. However, these very important activities in GPRS technology are not in any way compromising development work related to 3G platforms. It is clear that whereas GPRS is still the main technology used by the m2m market, the trend is that in the next five years this will

Figure 1: VDA -2A Audio test results

Figure 2: Module shipment by technology

(Source: ABI Research)

TELIT2MARKET 06|11

TELITCOMPETENCE

15

HE863

HE910 world's smallest 5-band HSPA+ module.

market introduction of the new HE863 variants, a new HSPA Automotive platform that will be introduced in 2013 an updated EVDO product mainly for US market and a new low-cost CDMA platform for global markets. In parallel the R&D team in Trieste, Italy has from the beginning of 2010 been involved in the alignment of the Telit AT interface and features across the different cellular platforms 2G and 3G, and in the development of the new HE910, that will once again, become the markets smallest module in its category. In 2011 Telit will definitely confirm its leadership not only in 2.5G product offerings but also in 3G and 3G+ as a result of its long term investments and commitment. A different R&D approach is required for short range communications devices. Telit has two groups working with this technology area. The first is located in Sophia Antipolis, France. This team because of its platform expertise has responsibility over short range products using ZigBee, M-Bus, IEEE802.15.2, and our proprietary protocol. The other team, located in Cagliari, Italy, is in charge of the work to integrate short range and cellular technologies into applications and gateways which bridge local short range to cellular. These two teams will be integrated into sharing responsibility for offering complete solutions from sensor to internet. change. As can be gleaned from the ABI Research graph on shipments by technology in Figure 2, GPRS volumes remain almost flat in the next five years, while market growth comes from different technologies, mainly WCDMA but also EVDO and then LTE. It is clear that 3Gs real market introduction will be propelled by specific segments such as automotive where Telit is already supplying the UC864 E Auto and the UC864 AWS Auto for European and North America markets respectively but many others will follow. For this reason Telit R&D investments into 3G platforms are growing, already representing more than 50% of the total departmental budget. The R&D team located in Seoul, Korea, that focused from the beginning on WCDMA and CDMA products is in charge of maintaining the UC864 and CC864 platforms, but also the Because there are many aspects in the deployment and implementation of communication systems which make them much more complex than the simple cellular, requiring deep understanding of different technologies from the device as well as the network point of view and also in this case the investments that Telit continues its commitment, reaffirming its willingness to continue playing as the leader in m2m. <<

16

TELITCOMPETENCE

TELIT2MARKET 06|11

AuTomoTIVe R&D TeAm

massimiliano lonzar, R&D Automotive manager

>> A new team focused on the automotive market has been created in the Telit organization with the purpose of enhancing support and services targeted at this strategic segment. This new team will report to the global R&D organization and will be focused on the various aspects of compliance with the stringent automotive market requirements.

Different groups inside this new department will provide their support to the different phases of development. One group will be focused on field testing and software validation with particular attention to those features demanded by automotive integrators in addition to a much deeper analysis of interoperability of the modules with the different network operators. Another group will be focused on the so called Reliability Validation which include PPAP testing and verification, HALT testing and so on. A third group will offer first and second level of technical support and will respond directly to our automotive customers developers to support integrators

in the design phase. Finally, a fourth group will be focused on all issues related to the interactions among different functions inside the company including R&D, purchasing, quality, test engineering, and others. The aim of this group will be to schedule and harmonize activities of these different departments managing toward total satisfaction in response to the demands coming from these customers. This is just the beginning. Most probably, in the 2012 issue of the magazine, we will be reporting back to you the results and experiences in a much more detailed article. <<

TELIT2MARKET 06|11

TELITCOMPETENCE

17

2011 TelIT QuAlITy ChAllenge

guido Walcher, Director Quality and Intellectual Property

>> Telits quality challenge for 2011 is to prepare and implement an adequate approach to support the companys business growth scenario. By the middle of 2010 it was clear that Telit was looking at a growth trend to result in a definite increase in the complexity of operations. To support this, the quality department is implementing new procedures and rules based on simplicity and clarity with the objective of establishing relationships among the various company processes and to proactively align each resource involved in business processes. This means that in the near future, changes will take place on how functions approach their activities so as to establish new workflows characterized by open-mindedness and creative attitudes.
The Telit quality department currently implements an interdisciplinary self-improving program to make all corporate processes more adaptive, optimizing all efforts, and keeping them synchronized towards the global mission of our m2m business. A definition that encapsulates this concept well states that quality is the on-going process of building and sustaining relationships by assessing, anticipating, and fulfilling stated and implied needs, where such needs belong to five different players. The most important one is the market and customer who expects products and services delivered with all needed requirements, on time and well supported. For such mission, the following Telit functional areas are involved: Top management creating a vision for the company, providing guidance to the busi-

ness, addressing the mission statements with sustainability and profitability requirements; Research and Development continuously evolving the companys technology portfolio, designing products and services to be more competitive; Operations manufacturing m2m devices free of defects, in compliance with requirements from different market segments particularly smart-metering and automotive; Sales providing Telit customers with high quality technology offerings and solutions customized to fit specific and different requirements.

Intellectual Property, and standardization, which are very close to top managements vision statement definition, and have the ability to inject innovation in all company processes; Long-term project planning, also used for allowing participation in public bid calls. Long term projects are developed according to the companys business vision and are designed to support Research and Development strengthen its know-how assets; Quality audit modeling, as applied with customers and markets, is also used in support of the execution started after the above mentioned public bid calls applications. Project planning in the framework of public bid calls is quite a relevant asset of to the quality mission, which goes a long way to ensure competitiveness for the companys business. Over the past five years, there have been many success stories with different projects developed also with the European Community. These include the Emily and Euridice projects, with MiSE the Italian Ministero dello Sviluppo Economico that was fundamental in the establishment of the Telit R&D Center in Cagliari; the effort with the local Friuli Venezia Giulia Region administration which strengthened the knowledge assets of Telits most important R&D Center in Trieste. In order to address our expected growth, an important new R&D project is ready to be implemented, with activities set for the next

Figure 1: Telit macro-areas

An efficient relationship among these functions requires a dynamic approach both fluid and forthright. In such a multi-articulated scenario, quality has to balance the different roles with assignments of procedures and rules to allow them to cope with the increased complexity. In this scope quality manages through different methods:

18

TELITCOMPETENCE

TELIT2MARKET 06|11

Top management Business Vision and Company mission Creativity Intellectual Assets

Design FMEA, 8D; International Material Data System (IMDS); Reliability and Failure analysis; and lot traceability. Telit quality is not just about inspection, process control, material selection. It covers the all elements involved in delivering products and services and in order to achieve the 2011 challenge, quality intends to strengthen the implementation of design for manufacturing (DFM) to simplify the manufacturing process, minimizing risk.

growth Know-how
Procedure and Proces Control Sales and Customers market
Figure 2: Quality growth driven a challenge for Telit

Standard and Qualification Compliance R&D and operation

four years. So from qualitys responsibility and perspective the function will continue to observe and provide measurements and feedback to better steer the fantastic growing business of m2m implementing procedures for employees, customers, and external resources, with the main objective of changing the work culture accordingly. Telits quality philosophy is to facilitate the adoption of a responsible and active approach, based on the premise that whoever is directly involved with an issue holds the most in-depth knowledge of said issue and is in the best position to produce the best resolution to it. In support to its mission, Telit quality has consolidated quality assets that have been in effect for a long time, and that are continuously improved: ISO 9001 certification extended to the corporate level. In particular with respect to R&D laboratories ensuring that R&D labs, located in different areas and devoted to different technology segments, apply the same rules and methods in their activities; ISO 14001 certification in effect at the Trieste facility covering compliance with environmental and Green practices for eco-friendly design and manufacturing; Quality uniformity which aims to maintain production from all contract manufacturers at equivalent quality levels. This is assured by continuous and constant control on production processes, with resident quality teams,

and by quality procedures and methods that ensure that components, manufacturing processes, testing and programming phases are the same in all manufacturing plants located in the different geographical areas. Most of Telits contract manufacturers are compliant with automotive grade manufacturing requirements as established by the ISO TS 16949 certification process. That dovetails with Telit R&Ds design processes for automotive segment, with implementation of the Production Part Approval Process (PPAP); Process and

Telit has also recently added another achievement to its competitiveness arsenal: accreditation according to the Annex V R&TTE Directive of R&D testing laboratories with respect to measurement instruments and methods. Such accreditation allows Telit quality to autonomously issue CE declaration of conformity resulting from our own R&D lab measurement reports. This achievement is absolutely important to qualify the company, and its ability to deploy to market innovative and competitive m2m technologies to be used by the Telit customers in their successful business. <<

TELIT2MARKET 06|11

TELITCOMPETENCE

19

The TelIT TeChnICAl FoRum

Alexander Bufalino, VP global marketing
It has always been Telits aim to understand its customers business models and to protect their investments by delivering superior support. With the Technical Support Forum we have further enhanced our already strong set of ways and means to provide assistance. The forum is not only intended for Telit customers which are granted read and write permissions but, as the first forum of this kind, it allows the entire m2m community to access it in read mode. Of course, beside the online Technical Forum we offer the traditional Telit Technical Support from out regional teams around the world where System integrators, developers and partners receive valuable assistance, at any time, in their daily integration work. But the idea of the forum is something that goes beyond the drive for excellence in support that has always been a rule for Telit. The forum is a platform where everybody can share ideas, doubts and solutions, and find an unparalleled number of answers in a growing FAQ database which grows daily. Today this is exactly what our customers need. They need to have prompt feedback, they need to get in touch with other developers and discuss their successes and their failures, and they need reliable solutions to keep working on the development of their applications. We are just at the beginning a few months since launch but the results we are experiencing are great. After five months we had over 700 users, about 300 threads and the numbers grow daily. We believe that the key success factor here is that our forum is an open one; not only Telit customers have the right to access it but the entire m2m community can join in. This is our vision, our goal and certainty: to share ideas, increase knowledge, and facilitate communication in the m2m technical community. This is the only way to handle the complexity of the new challenges we face every day. The Forum is moderated daily by administrators located in several different geographical regions. We can proudly say that our forum provides 24/7 service to our registered users. Administrators are constantly in touch with the technical support teams in the different regions through a service system that allows management of all the request types in the best possible way. The forum management system gives everybody real time status on threads; who is answering each thread; or who has been assigned with a specific request and asked for a feedback. So if you have not already done so, go online to www.telit.com >> Services >> Technical Forum and register. Attend to the discussions and contribute your valuable experience to the growth of the m2m community. <<

>> The idea to create a Technical Forum

and to publish it on the Telit web site had been in our minds for a long time. The outcome we were looking for was to put in contact individuals who live daily in the m2m world to share experiences, to discuss open or already closed issues to enrich the development process, to gather ideas and needs for integration of new applications based on the technologies that Telit provides, to drive new integrators and developers toward simpler integration processes, and why not to celebrate the successes of our customers.
This dream finally became a reality in 2010. Telit launched the Technical Support Forum in October and it has been a great success from the very start. The open forum format offers an invaluable technical knowledge database on everything concerning m2m. The most viewed articles range from general discussions like Transmission of DTMF tones to specific challenges such as Sending SMS while keeping an active socket connection.

www.telit.com/techforum

20

TELITPrOduCTs

TELIT2MARKET 06|11

ThRough neW PRoDuCT DeVeloPmenT

leADIng ChAnge

marco Contento, manager, Product management emeA

>> Always on the forefront of technology,

Telit expands its portfolio with the introduction of new 3.5g modules in BgA packages, and 2.5g modules in lCC castellation.
The development of new modules, with different mounting technologies and featuring a new cellular technology, is a dynamic response to market demand and to the availability of new chipsets. Applications not feasible only a few years ago have become common place thanks in part to advances in size reduction and package design. From car telematics and fleet management to intelligent metering and consumer applications, each segment imposes its own set of individual demands on the modules electronic package. However, despite the fact that the silicon vendors continue increasing the level of integration of silicon chip technologies, it will be some time before the latest 3.5G and LTE wireless technologies can be integrated in size and packaging comparable to those of the current 2.5G products. In this context, Telit has developed three new products the HE863, the HE910 and the GL865-DUAL. The HE863 The HE863 module enables highvolume m2m applications with advanced capabilities leveraging the 3G HSPA technology while minimizing development time. With dimensions of only 31.4 x 41.4 x 2.9 millimeters, the HE863 is the first Telit 3G module to be offered in the BGA form factor, suitable for medium to high volume applications. The HE863 features a 3GPP Release 6 stack, with HSPA connectivity in two bands, and with throughput of 7.2Mbps in

downlink and 5.7Mbps in uplink. It also supports quad-band GSM / GPRS and EDGE class 33, in 850, 900, 1800, and 1900MHz. The HE863 will be offered in three regional variants, with different combinations of 3G bands and regulatory approvals depending on the region. The product, which features a 6Mbps high-speed serial port, as well as a high speed USB 2.0 port, will be available in data-only and /or data, voice, standalone and assisted GPS. The HE910 The HE910, the world's smallest LGA m2m module featuring 5-band HSPA+, is the perfect 28,2mm solution for consumer applications requiring wireless connectivity on the move. Thanks to support for all five 3G network bands (i.e. 850, 900, 1700, 1900, and 2100 MHz) the HE910 provides mobility virtually without borders. Furthermore, the HE910 includes features such as HSDPA 14.4 Mbps (Cat 10), HSUPA 5.7 Mbps (Cat 6) and Quad-band EGPRS Class 33 (i.e. 850, 900, 1800, and 1900 MHz). Due to its low profile LGA package and advanced connectivity features, the HE910 is ideally suited for mobile computing devices such as PDAs, smart-phones, tablet PCs, and consumer electronics in general, both for business and personal use. The HE910 can also optionally be provided with integrated high-sensitivity AGPS for indoor fixes and simultaneous GPS with voice and data. The GL865 The GL865-DUAL, which is the first Telit 2.5 module in LCC (Leadless Chip Carrier) castellation packaging,

has been introduced to expand the offering of 2.5G products in surface-mount technology but in different packaging. Its ultra-small form factor makes this module perfect for mobile applications scaling from low to high volumes across all industries. Key application areas include battery powered devices for medical monitoring equipment, for tracking of people, animals and assets. The GL865-DUAL module (LCC castellation package technology) is a surface-mount component, having metalized pads on all sides of the package. This kind of packaging is ideally suited for simple and low-cost applications based on four-Layer PCBs. Moreover, with the option for manual soldering and removal, it can also serve niche applications with low production volumes. For customers with highly integrated and complex applications, Telit offers this new product as part of its broad family of Ball Grid Array (BGA) m2m modules. The pins of the BGA package are arranged in a grid pattern on the entire lower surface of the module, thus providing a greater number of pins making the BGA package highly efficient in terms of size to number of inputs and outputs. The introduction of this product is an important step for Telits portfolio development which now includes LCC castellation packaging alongside our successful and well-known BGA packaging. LCC and BGA packaging complement each other as they serve different market segments. <<

TELIT2MARKET 06|11

TELITPrOduCTs

21

CellulAR TeChnology
2.5g GPRS C2K 1xRTT
gl865-DuAl GSM/GPRS Dual Band GPRS class 10

3g UMTS

3.5g HSDPA EVDO REV. A

3.5g HSPA

3.75g HSPA+

lTe

lCC

ge865-QuAD GSM/GPRS Quad Band GPRS class 10

mounTIng TeChnology

BgA

ge864-QuAD / Automotive / ATeX / SIm / gPS GSM/GPRS Quad Band GPRS class 10

ge863-QuAD / Py / SIm / gPS GSM/GPRS Quad Band GPRS class 10

he863-eu / nA / Au HSPA 900/2100 (EU) HSPA 850/1900 (NA) HSPA 850/2100 (AU) 7.2Mbps DL / 5.7 UL EDGE class 33 A-GPS optional

lgA

De910-DuAl 800/1900 EVDO Rev. A, 3.1 Mbps DL / 1.8Mbps IS-95A/B, 1xRTT gpsOne, Rx diversity

he910 HSPA+ 850/900/1800/1900/2100 14Mbps DL / 5.7 UL EDGE Quad Band class 33 A-GPS, Rx diversity

le910 LTE cat. 3, 850/900/1800/ 1900/2100 100 Mbps DL, 50 Mbps EDGE Quad Band class 33 Rx diversity

80 pin B2B Connector

gC864-QuAD GSM/GPRS Quad Band GPRS class 10

uC864-WD UMTS 384k Dual Band EDGE Dual Band class 12

CC864-DuAl 800/1900, IS-95A/B, CDMA-1xRTT, gpsOne

uC864-e / e-DuAl / g Dual / Quad band EDGE class 12 HSDPA 900/2100 (E-DUAL) HSDPA 850/1900/2100 (G) HSDPA 2100 (E) 7.2Mbps DL

hC864-eu / nA / Au Quad Band EDGE class 33 HSPA 900/2100 (EU) HSPA 850/1900 (NA) HSPA 850/2100 (AU) 7.2Mbps DL / 5.7 UL

lC864 LTE cat. 3, 100 Mbps DL, 50 Mbps 850/900/1800/ 1900/2100 EDGE Quad Band class 33 Rx diversity

22

TELITPrOduCTs

TELIT2MARKET 06|11

Re-eVoluTIon

In RemoTe ConTRol VIA gSm

Cristian Vacchiano, Senior Software engineer and Carlo Antonini, Senior RF-hW engineer

Figure 3

>> In the last few years one of the most successful applications in the m2m market has been the remote control of devices over gSm and this kind of application will likely continue its strong growth in the years ahead. Remote control is usually accomplished by sending commands to a remote module through DTmF tones or SmS. These commands allow remote driving of actuators and the reading of sensors status.

The newly released DTMF decoder in Telit modules allows developers to change their traditional approach when working with GSM remote control systems. Although a TCP connection mode is also available this article will focus on the DTMF solution. Traditional approach The traditional way to implement remote control via GSM using DTMF tones typically involves the use of a microcontroller (MCU), a GSM module and a hardware DTMF decoder. (Figure 1) When DTMF tones are employed to send remote commands, the audio output

from the GSM module is connected to the DTMF receiver which provides decoded tones to the MCU. The MCU in receipt of this information recognizes the command and takes the appropriate action or sequence of actions. The Achilles heel of this approach is the need for several components to execute even the simplest command. Telits approach The aim of the Telit approach is to simplify the system by more fully utilizing the powerful embedded features of the GSM module while at the same time giving new degrees of freedom to the developer. (Figure 2) With this smart use of the Telit module the DTMF receiver and the external microprocessor can be removed leading to a smaller and cheaper implementation. In fact DTMF tones are recognized by the internal decoder embedded in the module without the need of any external device. (Figure 3) Embedded DTMF decoder To access this feature, developers can select between python script or event monitor for the software

gSm/gPRS module Power Supply

SIm

AT#eVmonI="DTmFo",0,1,0 AT#eVmonI="DTmFo",0,0,"AT#gPIo=3,1,1" AT#eVmonI="DTmFo",1 AT#enAeVmonI=1

Figure 4

DTmF Receiver

I/o

mCu
Figure 1

AT#eVmonI="gPIo1",0,1,1 AT#eVmonI="gPIo1",0,2,1 AT#eVmonI="gPIo1",0,3,5 AT#eVmonI="gPIo1",0,0,"AT+CmgF=1;#C

Power Supply

Telit gSm/gPRS module

SIm

mgS=+393468686XyZ,\22gPIo1 on\22" AT#eVmonI="gPIo1",1 AT#enAeVmonI=1

Figure 5

I/o

Figure 2

TELIT2MARKET 06|11

TELITPrOduCTs

23

DTmF, S mS

or T
CP

implementation. Access to the embedded Python Easy Script gives the developer the ability to program complex control sequences. Using the virtual internal AT serial port, a Python script can be written to receive the asynchronous messages generated by the embedded DTMF decoder, interpret them, make decisions or execute commands. If avoiding software programming is preferred, the user can take advantage of the event monitor. This feature allows a DTMF tone detection to be automatically associated with a specific action at the module by simply sending it an AT configuration command. SMS at run Telit modules also makes available, with no change in hardware configuration, one additional solution: the use of the Embedded SMS AT Run. This feature allows users to run AT commands remotely just by sending an SMS to the module. Responses and errors are sent back by the module via SMS. Two types of messages are available: simple and protected. Protected messages are encrypted with an MD5 hash algorithm. It is important to note that the SMS AT Run feature is also available via TCP where AT commands are sent to the module via TCP/IP. Responses and IP protocol related traffic are redirected via TCP/IP to the device acting as the TCP terminal. Event monitor example Based on a Telit GL865 module a simple 2 IN/2 OUT remote control can be implemented using event monitor for action control. In this sample application the objective is to read the status of the 2 opto-isolated inputs or set the status of the 2 relays. If the user wants to link

the activation of Relay 1 (connected to GPIO3) to the receiving of a DTMF tone equal to 0, the following custom command must be sent to configure the module: AT#EVMONI. Upon detection of a DTMF tone 0, an event will be generated and AT#GPIO command will be executed automatically activating Relay 1. (Figure 4) Contextually the module can be triggered by a HIGH level on GPIO1 and send an SMS to alert the remote application. (Figure 5) <<

GSM remote controller with GL865

24

TELITPrOduCTs

TELIT2MARKET 06|11

CellulAR PRoDuCT RAnge FORM FACTOR AND FAMILy CONCEPT

TeChnology FoRm FACToR Terminal modem gSm I gPRS embedded PRoDuCT

gT863-Py Cellular Technology

2 G (GSM/GPRS) 3 G (UMTS) 3.5 G (HSDPA) 3.5 G (HSPA) 3.75 G (HSPA+) 4G (LTE) CDMA (1xRTT) CDMA (EVDO) x

gT864-QuAD
x

gT864-Py
x

gm862-gPS
x

ge863-SIm
x

ge863-gPS
x

ge863-PRo
x

ge864-QuAD
x

gPRS Class

10

10

10

10

10

10

10

10

eDge Class

N/A

N/A

N/A

N/A

N/A

N/A

N/A

N/A

2 G (GSM/GPRS) Kbps

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

Data Speed [ul/Dl]

2.75G (EDGE) Kbps 3 G (UMTS) Kbps 3.5 G (HSDPA) Mbps 3.5 G (HSPA) Mbps 3.75 G (HSPA+) Mbps 4G (LTE) Mbps CDMA (1xRTT) Mbps CDMA (EVDO) Mbps USB type AAI (analog audio interface) x x x x x x x x 107 x 64 x 33mm x x 77 x 67 x 26mm x 77 x 67 x 26mm x x 50 SMA -30C to +75C x x x FME -30C to +75C x x x FME -30C to +75C x x x MMCx -40C to +85C 20 x x x x x x 120 RF PAD -40C to +85C 120 RF PAD -30C to +80C 20 x x x x x x x x 189 RF PAD -30C to +85C 120 RF PAD -40C to +85C x x 43.9 x 43.9 x 6.9mm x x 41.4 x 31.4 x 3.6mm BGA x x x x x 41.4 x 31.4 x 3.6mm BGA 2.0-FS x x x x x 41.4 x 31.4 x 3.6mm BGA x x x x x 30 x 30 x 3mm BGA

Interfaces Features Additional Features

DVI (digital voice interface) DAC (digital to analog converter) ADC (analog to digital converter) GPIO (general purpose input/output) Size Surface mounting Terminal Board-to-board connector # Pin, Balls, Pads Antenna connector Temperature Range GPS channels Embedded TCP/IP Stack FAx support (Class 1 G3) SIM Access Profile Designed for Automotive Applications Run AT Commands Remotely Jamming Detection ATEx R&TTE CE

x x x x

x x x x x x x

x x x x x x x x

x x x x x

x x x x x x x x

x x x x

x x x x x x

main Approvals

GCF PTCRB FCC IC KCC CDG1 & 2 MIC SK IOT SRRC

x x

x x

TELIT2MARKET 06|11

TELITPrOduCTs

25

gSm I gPRS embedded

NEW

TeChnology Compact FoRm FACToR

PRoDuCT ge864-QuAD Automotive V2

x

ge864-QuAD V2
x

ge864-QuAD Atex
x

ge864-gPS
x

ge865-QuAD
x

gl865-DuAl gl865-QuAD
x

gC864-QuAD
x

gC864-QuAD V2
x 2 G (GSM/GPRS) 3 G (UMTS) 3.5 G (HSDPA) 3.5 G (HSPA) 3.75 G (HSPA+) 4G (LTE) CDMA (1xRTT) CDMA (EVDO)

Cellular Technology gPRS Class

10

10

10

10

10

10

10

10

eDge Class

N/A

N/A

N/A

N/A

N/A

N/A

N/A

N/A

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

85.6/42.8

2 G (GSM/GPRS) Kbps 2.75G (EDGE) Kbps 3 G (UMTS) Kbps 3.5 G (HSDPA) Mbps 3.5 G (HSPA) Mbps 3.75 G (HSPA+) Mbps 4G (LTE) Mbps CDMA (1xRTT) Mbps CDMA (EVDO) Mbps USB type

Data Speed [ul/Dl]

x x x x x 30 x 30 x 3mm BGA

x x x x x 30 x 30 x 3mm BGA

x x x x x 30 x 30 x 3mm BGA

x x x x x 30 x 30 x 3mm BGA

x x x x x 22 x 22 x 3mm BGA

x x x x x 24.4 x 24.4 x 2.7mm LCC

x x x x x 30 x 36.2 x 3.2mm

x x x x x 30 x 36.2 x 3.2mm

AAI (analog audio interface) DVI (digital voice interface) DAC (digital to analog converter) ADC (analog to digital converter) GPIO (general purpose input/output) Size Surface mounting Terminal

Interfaces Features

x 120 RF PAD -40C to +85C x x x 120 RF PAD -40C to +85C x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 120 RF PAD -40C to +85C x x x 120 RF PAD -40C to +85C 48 x x x x x x x x x x x x 63 RF PAD -40C to +85C 48 RF PAD -40C to +85C 80 GSC -40C to +85C

x 80 GSC -40C to +85C x x x

Board-to-board connector # Pin, Balls, Pads Antenna connector Temperature Range GPS channels Embedded TCP/IP Stack FAx support (Class 1 G3) SIM Access Profile Designed for Automotive Applications

Additional Features

x x x x x x x x

Run AT Commands Remotely Jamming Detection ATEx R&TTE CE GCF PTCRB FCC IC KCC CDG1 & 2 MIC SK IOT SRRC

main Approvals

26

TELITPrOduCTs

TELIT2MARKET 06|11

TeChnology FoRm FACToR

umTS I WeDge Compact Terminal

umTS I hSDPA Compact

PRoDuCT

uC864-WD Cellular Technology

2 G (GSM/GPRS) 3 G (UMTS) 3.5 G (HSDPA) 3.5 G (HSPA) 3.75 G (HSPA+) 4G (LTE) CDMA (1xRTT) CDMA (EVDO) x x

gT864-3g
x x x

gT863-3gg
x x x

uC864-e
x x x

uC864-e-AuTo
x x x

uC864-e-DuAl
x x x

uC864-K

uC864-g
x x

gPRS Class

12

12

12

12

12

12

12

eDge Class

12

12

12

12

12

12

12

2 G (GSM/GPRS) Kbps

85.6/85.6 236.8/118.4 384/384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384 7.2/0.384

85.6/85.6 236.8/118.4 384/384 7.2/0.384

Data Speed [ul/Dl]

2.75G (EDGE) Kbps 3 G (UMTS) Kbps 3.5 G (HSDPA) Mbps 3.5 G (HSPA) Mbps 3.75 G (HSPA+) Mbps 4G (LTE) Mbps CDMA (1xRTT) Mbps CDMA (EVDO) Mbps USB type AAI (analog audio interface)

2.0-FS

2.0

2.0

2.0-FS x x

2.0-FS x x x x x 30 x 36.2 x 4.8mm

2.0-FS x x x x x 30 x 45 x 4.8mm

2.0-FS x x

2.0-FS x x x

Interfaces

DVI (digital voice interface) DAC (digital to analog converter) ADC (analog to digital converter) GPIO (general purpose input/output) Size Surface mounting Terminal Board-to-board connector # Pin, Balls, Pads Antenna connector Temperature Range GPS channels Embedded TCP/IP Stack FAx support (Class 1 G3) SIM Access Profile Designed for Automotive Applications Run AT Commands Remotely Jamming Detection ATEx R&TTE CE x x x x x x x x x 80 MM7329 -30C to +80C x x x FME -30C to +75C x x x SMA -20C to +65C 12 x x x x x x 30 x 45 x 4.8mm 77 x 67 x 26mm x x x x 83 x 64 x 33mm x

x x x 30 x 36.2 x 4.8mm

x x 30 x 36.2 x 4.8mm

x x 30 x 45 x 4.8mm

Features

x 80 GSC -30C to +80C x x x

x 80 RF PAD -30C to +85C x x x

x 80 GSC -30C to +80C x x

x 80 GSC -30C to +80C x

x 80 GSC -30C to +80C 12 x x x

Additional Features

x x x

x x x

x x x

x x x x x

main Approvals

GCF PTCRB FCC IC KCC CDG1 & 2 MIC SK IOT SRRC

TELIT2MARKET 06|11

TELITPrOduCTs

27

umTS | hSPA embedded

NEW NEW NEW NEW NEW NEW NEW NEW

TeChnology FoRm FACToR

PRoDuCT

he863-euR
x x x x

he863-euD
x x x x

he863-eug
x x x x

he863-nAR
x x x x

he863-nAD
x x x x

he863-nAg
x x x x

he863-AuR
x x x x

he863-AuD
x x x x 2 G (GSM/GPRS) 3 G (UMTS) 3.5 G (HSDPA) 3.5 G (HSPA) 3.75 G (HSPA+) 4G (LTE) CDMA (1xRTT) CDMA (EVDO)

Cellular Technology gPRS Class

33

33

33

33

33

33

33

33

eDge Class

33

33

33

33

33

33

33

33

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384 7.2/5.76

2 G (GSM/GPRS) Kbps 2.75G (EDGE) Kbps 3 G (UMTS) Kbps 3.5 G (HSDPA) Mbps 3.5 G (HSPA) Mbps 3.75 G (HSPA+) Mbps 4G (LTE) Mbps CDMA (1xRTT) Mbps CDMA (EVDO) Mbps

Data Speed [ul/Dl]

2.0-HI x x x x 31.4x41.4x3.0mm BGA

2.0-HI

2.0-HI x

2.0-HI x x x x 31.4x41.4x3.0mm BGA

2.0-HI

2.0-HI x

2.0-HI x x x x 31.4x41.4x3.0mm BGA

2.0-HI

USB type AAI (analog audio interface) DVI (digital voice interface)

Interfaces

x x x 31.4x41.4x3.0mm BGA

x x x 31.4x41.4x3.0mm BGA

x x x 31.4x41.4x3.0mm BGA

x x x 31.4x41.4x3.0mm BGA

x x x 31.4x41.4x3.0mm BGA

DAC (digital to analog converter) ADC (analog to digital converter) GPIO (general purpose input/output) Size Surface mounting Terminal Board-to-board connector

Features

189 RF PAD -30C to +85C x x (x)

189 RF PAD -30C to +85C x x

189 RF PAD -30C to +85C 20 x x

189 RF PAD -30C to +85C x x (x)

189 RF PAD -30C to +85C x x

189 RF PAD -30C to +85C 20 x x

189 RF PAD -30C to +85C x x

189 RF PAD -30C to +85C x x

# Pin, Balls, Pads Antenna connector Temperature Range GPS channels Embedded TCP/IP Stack FAx support (Class 1 G3) SIM Access Profile Designed for Automotive Applications Run AT Commands Remotely Jamming Detection ATEx

Additional Features

x x x

x x x

x x x x x x x x x

R&TTE CE GCF PTCRB FCC IC KCC CDG1 & 2 MIC SK IOT SRRC

main Approvals

28

TELITPrOduCTs

TELIT2MARKET 06|11

TeChnology FoRm FACToR

umTS | hSPA
NEW

umTS | hSPA+
NEW

CDmA |1xRTT Compact

CDmA Terminal

SAT embedded

embedded

PRoDuCT

he863-Aug Cellular Technology

2 G (GSM/GPRS) 3 G (UMTS) 3.5 G (HSDPA) 3.5 G (HSPA) 3.75 G (HSPA+) 4G (LTE) CDMA (1xRTT) CDMA (EVDO) x x x x

he910
x x x x x

CC864-DuAl

CC864-SIngle

CC864-K

CC864-SR

mDT-800

Se867-AgPS

gPRS Class

33

33

N/A

N/A

N/A

N/A

eDge Class

33

33

N/A

N/A

N/A

N/A

2 G (GSM/GPRS) Kbps

107/85.6 296/236.8 384/384 7.2/5.76

107/85.6 296/236.8 384/384

Data Speed [ul/Dl]

2.75G (EDGE) Kbps 3 G (UMTS) Kbps 3.5 G (HSDPA) Mbps 3.5 G (HSPA) Mbps 3.75 G (HSPA+) Mbps 4G (LTE) Mbps CDMA (1xRTT) Mbps CDMA (EVDO) Mbps USB type AAI (analog audio interface)

14.4/5.7

2.0-HI x

2.0-HI x

1.1 x x x x

1.1 x x x x 30 x 36.2 x 4.8mm x x x x 30 x 36.2 x 4.8mm

1.1 x x x x 30 x 36.2 x 4.8mm x x 75 x 55 x 20mm x x x 18 x 18 x 3.5mm BGA

Interfaces

DVI (digital voice interface) DAC (digital to analog converter) ADC (analog to digital converter) GPIO (general purpose input/output) Size Surface mounting Terminal Board-to-board connector # Pin, Balls, Pads Antenna connector Temperature Range GPS channels Embedded TCP/IP Stack FAx support (Class 1 G3) SIM Access Profile Designed for Automotive Applications Run AT Commands Remotely Jamming Detection ATEx R&TTE CE 189 RF PAD -30C to +85C 20 x x x x x 31.4x41.4x3.0mm BGA

x 28.2 x 28.2 x 2.6mm LGA

x 30 x 36.2 x 4.7mm

Features

x 144 RF PAD -25C to +85C 28 x x x 80 GSC -30C to +80C

x 80 GSC -20C to +60C x

x 80 GSC -30C to +80C x

x 80 GSC -30C to +80C x SMA -30C to +85C 20 x 35 RF PAD -30C to +85C 44

Additional Features

x x x x x x x x x x x x x x

main Approvals

GCF PTCRB FCC IC KCC CDG1 & 2 MIC SK IOT SRRC

30

TELITPrOduCTs

TELIT2MARKET 06|11

CellulAR PRoDuCT RAnge MOT by Telit

Air Interface embedded gSm | gPRS Compact gSm | gPRS | eDge

G30 basic

G30 advanced

G30 premium

G24-LITE

G24 GSM

G24-EDGE

Bands (MHz)

850/900/1800/1900 (GSM)

850/900/1800/1900 (GSM)

850/900/1800/1900 (GSM)

850/900/1800/1900 (GSM)

850/900/1800/1900 (GSM)

850/900/1800/1900 (GSM)

Size (LxWxH mm) Weight Operating Temp Range Programming Platform Embedded SIM Embedded GPS Receiver Diversity Interfaces Mounting Connector Main Antenna Connector USB UART SIM Card UART MUx Power Specifications Current Consumption Operating Voltage Wireless Technology HSPA EDGE GPRS CDMA Data Features CSD SMS Fax TCP/IP & UDP/IP FTP Control/Status Indicators GPIO A2D Antenna Detect Voltage & Temp Sensor Network Converage Jamming Detection Voice Features Digital & Analog Audio DTMF Echo & Noise Supression Full Duplex Audio Gain Control Regulatory & Approvals PTCRB FCC, IC R&TTE & EMC GCF RoHS CE

24.4 x 40.0 x 3.5 < 6 grams -30C to +85C

24.4 x 40.0 x 3.5 < 6 grams -30C to +85C

24.4 x 40.0 x 3.5 < 6 grams -30C to +85C C Language

24.4 x 45.2 x 6.0 < 10 grams -20C to +75C

24.4 x 45.2 x 6.0 < 10 grams -30C to +85C

24.4 x 45.2 x 6.0 < 10 grams -30C to +85C

LGA pads (optional 70-pin B2B) LGA pad / U.FL

LGA pads (optional 70-pin B2B) LGA pad / U.FL

LGA pads (optional 70-pin B2B) LGA pad / U.FL

70-pin B2B RF MMCx USB 1.1 Full Speed

70-pin B2B RF MMCx USB 2.0 Full Speed 2 UART 3.0V

70-pin B2B RF MMCx USB 2.0 Full Speed 2 UART 3.0V

1 UART 1.8/3.0V

1 UART 1.8/3.0V

1 UART 1.8/3.0V

2 UART 1.8/3.0V

< 1.6mA 3.3 - 4.2V

< 1.6mA 3.3 - 4.2V

< 1.6mA 3.3 - 4.2V

< 2.5mA 3.3 - 4.2V

< 2.5mA 3.3 - 4.2V

< 2.5mA 3.3 - 4.2V

class 10 class 10 class 10 class 10 class 10 class 10 class 10

9 (8 when using B2B Connection) 2

9 (8 when using B2B Connection) 2 (Hands-free)

9 (8 when using B2B Connection) 2 (Hands-free)

8 3

8 3

8 3

TELIT2MARKET 06|11

TELITPrOduCTs

31

gSm | gPRS | eDge

umTS | hSPA

CDmA | 1xRTT

Air Interface

G24-JAVA

H24 basic

H24 advanced H24-Single: 2100 H24-Dual: 900/2100 H24-Global: 850/1900/2100 H24-NA: 850/1900/17002100 AWS + 850/900/1800/1900 (GSM) 24.4 x 45.2 x 5.4 < 10 grams -30C to +65C -30C to +85C (Restricted)

H24 premium H24-Single: 2100 H24-Dual: 900/2100 H24-Global: 850/1900/2100 H24-NA: 850/1900/17002100 AWS + 850/900/1800/1900 (GSM) 24.4 x 45.2 x 5.4 < 10 grams -30C to +65C -30C to +85C (Restricted)

C24

850/900/1800/1900 (GSM)

H24-Single: 2100 + 850/900/1800/1900 (GSM)

800/1900 (CDMA 1x)

Bands (MHz)

24.4 x 45.2 x 6.0 < 10 grams -30C to +85C Java

24.4 x 45.2 x 5.4 < 10 grams -30C to +65C -30C to +85C (Restricted)

24.4 x 45.2 x 5.6 < 10 grams -30C to +85C

Size (LxWxH mm) Weight Operating Temp Range Programming Platform Embedded SIM

Embedded GPS Receiver Diversity

70-pin B2B RF MMCx USB 2.0 Full Speed 2 UART 3.0V

70-pin B2B RF MMCx USB 2.0 High Speed 2 UART 4Mb USIM/SIM 1.8/3.0V

70-pin B2B RF MMCx USB 2.0 High Speed 2 UART 4Mb USIM/SIM 1.8/3.0V

70-pin B2B RF MMCx USB 2.0 High Speed 2 UART 4Mb USIM/SIM 1.8/3.0V

70-pin B2B RF MMCx USB 2.0 Full Speed 2 UART R-UIM 1.8V/3.0V

Mounting Connector Main Antenna Connector USB UART SIM Card UART MUx Current Consumption Operating Voltage

< 3.5mA 3.3 - 4.2V

< 1.5mA 3.3 - 4.2V HSUPA (5.76Mbps) HSDPA (7.2Mbps)

< 1.5mA 3.3 - 4.2V HSUPA (5.76Mbps) HSDPA (7.2Mbps) class 12 class 12

< 1.5mA 3.3 - 4.2V HSUPA (5.76Mbps) HSDPA (7.2Mbps) class 12 class 12

< 2.5mA 3.3 - 4.2V

HSPA EDGE GPRS CDMA 1x CDMA CSD SMS Fax TCP/IP & UDP/IP FTP

class 10 class 10

class 12 class 12

8 3

8 3

GPIO A2D Antenna Detect Voltage & Temp Sensor Network Converage Jamming Detection

(Hands-free)

(Hands-free) (H24 Global & NA) (H24 Global & NA)

(Hands-free) (H24 Global & NA) (H24 Global & NA) (H24 Global, Single, Dual) (H24 Global, Single, Dual) (All models) (H24 Global, Single, Dual)

Digital & Analog Audio DTMF Echo & Noise Supression Full Duplex Audio Gain Control PTCRB

FCC, IC R&TTE & EMC GCF

(H24 Global, Single, Dual) (H24 Global, Single, Dual) (All models) (H24 Global, Single, Dual)

RoHS CE

32

TELITPrOduCTs

TELIT2MARKET 06|11

ISm-BAnD PRoDuCT FAmIly

milena milosevic, Technical Sales manager Short Range Devices

The neW TelIT

>> new m2m markets are advancing into intelligent automation systems, innovative solutions, and above all energy efficiency. Interoperability will be a key requirement for certain segments like metering while another target will be to continue increasing network flexibility. In order to build an advanced wireless system it is mandatory that a comprehensive review of priorities be completed to determine the most suitable combination of performance and cost.

With advantages such as longer range, reduced power consumption, lower deployment and operating costs, sub-GHz ISM wireless systems can step in to address important need areas of m2m like metering (water, gas, electricity), lightning control, building automation, irrigation, and tracking or access control. The Telit portfolio in sub-GHz ISM band includes 3 different product families: the LE, ME, and NE. They are based on the same form factor of 26 x 15 x 3 mm with weight of only 1.7 grams, LGA mounting technology (suitable for manual soldering in small volume applications), and full pin-to-pin cross-compatibility guaranteeing flexibility and making possible the re-use of the wireless design in different market segments. All modules include serial RS232 interface, digital and analog

I/O ports allowing easy integration into any application reducing development time and costs. Long battery life is ensured with a standby mode that consumes 1A for wake up on external interrupt (hardware over DTR or software via AT command). When used for remote control applications the best design choice is cyclic wake-up where the module is set to listen periodically to the radio link (with the use of its internal timer) using current of only 3A. Some key characteristics include budget link of up to 123dB (LE50), configurable output power of up to 14dBm, sensitivity in the order of -109dBm (LE50), and extended operating temperature range. Telit started by launching products in the 868MHz frequency and this will be followed by 433MHz and 915MHz variants.

TELIT2MARKET 06|11

TELITPrOduCTs
NE50-868

33

For all Telit short-range (SR) module families there is a complementary gateway solution, the GG863-SR which provides the short range wireless network the ability to extend on the IP network. Dedicated demo cases and kits are also available for each family which include all the necessary resources to enable outof-the-box testing of RF performances and others so that the designer can quickly start taking steps towards building a network. Moreover these three product families (ME, LE, and NE) were designed to be pin-to-pin compatible with the Telit ZigBee products, the ZE51-2.4, and the ZE61-2.4 (compliant with ZigBee PRO stack). The LE Module Family is the ideal solution for ultra-low-power and low-latency-time applications requiring point-to-point or multipoint (broadcast) network communication and a simple plug-and-play protocol for RF communications, being a great fit for applications replacing communication over cable. Because of the very low latency time, incoming characters are transmitted to the radio link as they are received on the serial port and collision is avoided with the application of the LBT (listen before talk) feature, while for more advanced network planning, RSSI level measurements can be used as a simple indicator of signal strength. The Star network protocol stack running on the LE module family is a Telit proprietary protocol that can be applied in transparent mode (plug-and-play, minimum latency), in address secured mode (nodes have ID numbers, data can be addressed to a specific node), in telemetry mode, or in download over-the-air mode (remote re-flashing of the modules). This family also

LE50-868

Demo Kit & Development Tools ME50-868

includes a 2.4GHz variant which can be a valuable alternative to ZigBee in applications where a simple communication protocol can be used. The NE module family is based on the Telit proprietary low power mesh protocol, implemented on a cluster-tree network structure. Power management can be achieved on both routers and end nodes with extreme flexibility by setting different synchronous network times, data rates, or message formats. These same parameters also influence network latency providing a high degree of freedom for OEMs to program them according to system requirements. Lowest overall power consumption can be achieved in networks running a regimen of small data volumes transmitted periodically while high data throughput demanding high network data exchange rates cause an increase in power consumption. Auto-repair, auto-association, up to 10-hop routing, and 10,000 device capacity make it easy to integrate complex and stable network solutions. The ME module family is based on the wireless M-bus European standard EN 13757-4 covering data exchange for remote meters (modes S, T, and R) and the EN 13757-5:2008

extension of part 4 which specifies additional routing providing the possibility to extend the range in 868MHz band (modes R2 and Q). At the application level Telit supports AES encryption and is compliant with the Dutch profile NTA8130 and OMS. This module family can integrate any network of devices compliant to the Wireless M-bus standard (parts 4 or 5) including the Telit TinyOne Lite 868MHz module. SR Tools Manager The SR Tools Manager is a unique powerful development environment covering all Telit Short range module families (ME, LE, NE and ZE). It is Windows based and easy to use internally handling most of the complexities of Short Range technology and therefore dramatically reducing time-to-market and TCO. Its purpose is to allow performance of preliminary testing, help during the design phase, assist in deploying the network, and to guarantee network operation and maintenance. Starting with basic features like firmware upgrading, sniffer and packet analyzer, commissioning and configuration of the short range module; and moving up to the more advanced features which include graphic network topology view together with its most important parameters this single tool adds substantial value to the Telit Short Range module offering. The starting version of the tool allows selection of the SR technology and which part of the tool to access, e.g. flashing, management, or analyzer. While using the analyzer it is possible to select the ZigBee channel or Wireless M-bus operating mode and all the captured data packets from the selected source can be saved to a file. The management section is used for sending the modules hexadecimal or ASCII commands and its extremely easy-to-use, while configuration wizard provides quick access to configuration or reading of the SR module registers. <<

SR Tool Manager: Analyser and Configuration Wizard

34

TELITPrOduCTs

TELIT2MARKET 06|11

The TelIT ComBIneD WIReleSS oFFeR FoR The InTeRneT oF ThIngS

Tony Spizzichino, Ceo TelIT RF Technologies
>> Predicting now the impact that the internet of things (IoT) will have in our lives is not a trivial exercise (who could have predicted the impact of Internet in the early 90s?), but it is safe to state that Smart City will be among the most important applications of the IoT. Following its long term vision and strategy, Telit has been preparing for this new challenge and has put in place a valuable offering to provide its partners with unique competitive advantages.
New m2m Wireless Communication Technologies In addition to well established m2m cellular communications where Telit is already playing a leadership role worldwide, short range (SRD) communication technologies much better suited for LAN/HAN application are required to enable the IoT. Among the forerunner technologies, different flavors of the IEEE802.15.4 (e.g. ZigBee, 6LowPAN, etc.) and Wireless M-BUS are establishing themselves with WiFi becoming more adept to providing connectivity to the consumer market through Smart Tabs and dedicated applications (Apps). A common question some in the IoT space are posing pertains to the strength of the make vs.
ZigBee Wireless MBus

buy approach for the Short Range communication component of their application. Considering the required level of investments in the design of wireless connectivity for the application the module approach always provides solid advantages whenever the silicon used in the design has a lifecycle time in the range of 3 to 4 years. That is usually the case because of the increased ROI and reduced and predictable total cost of ownership (TCO) due to the full liability of the wireless solution (hardware and software) resting on the module. Moreover, in the case of Telit and the pin2pin multi-technology family approach, a remarkable additional investment reduction can be achieved. Consider as an example, a smart gas meter designed with the Telit ME50-868 (Wireless MBus) and how it can also easily use the pin2pin compatible ZE51 ZigBee variant or the ZE61 ZigBee PRO solution, or yet the new LE50 or NE50 for star or low power mesh architectures available in 433, 868 and 915 MHz. New Tools to deploy and manage complex multi-technology networks

ME50-868 DIP Version

considering the cost of a minimal subscription plus the cellular hardware with required battery provides the immediate answer that an SRD technology LAN/HAN is the cheaper option; however dedicated new software tools able to minimize cost and risk in large scale and efficient SRD network deployment for the full lifecycle of the project (usually 15 to 20 years) are definitive requirements. To this end, Telit has designed a dedicated SRD network tool, adding dramatic value to its offering. The Telit Advantage The Telit competitive advantage is based on the focused strategy to reduce the m2m application TCO by dramatically reducing the required investment and time-to-market. In fact Telit is unique in the wireless solution and module supplier space for providing: 1 Fully owned IPR m2m solutions from cellular to Short Range technologies, all based on the Pin2Pin compatible family approach; 2 Fully-customizable, highly-integrated, cellular and SRD Gateways and Concentrators; 3 A unique SRD network tool for the deployment, operation, and maintenance of large mixed cellular and SRD networks devoted to m2m applications. <<

Deploying, operating and maintaining a multimillion-node SRD network is a very complex exercise which is usually underestimated. The cost of deployment can be comparable to the full inMulti-band vestment in communication Multi-channel hardware while O&M costs can be remarkably high. Such considerations and the complexities in system design are posing another interesting question: is it better to use an existing cellular network instead of designing, deploying, operating, and maintaining a complementary SRD network? A simple cost analysis

TELIT2MARKET 06|11

TELITPrOduCTs

35

gPRS To WIReleSS m-BuS AnD unIVeRSAl ISm gATeWAy

olaf Schfer, Technical Director
>> The Aarlogic m09/5 is ideal for industrial applications requiring environmental robustness to withstand cold, heat, vibrations, etc. As a gateway, on the WAn side it communicates via gSm and on the short range side it utilizes license-free ISm standards including wireless m-Bus, Zigbee, and RF868/915 mhz covering distances of up to 4000 meters.
Round Solutions, a specialist manufacturer in m2m communications, has developed a new industrial printed circuit-board (PCB) especially designed for use under extreme environmental conditions. The AarLogic M09/5 is equipped with this technology and boasts an operational temperature range from -40 to +85 degrees Celsius and because it is populated with SMT components, it is highly vibration resistant. Measuring only 5.64 x 8.45 cm, the board can be used directly in smart metering and smart grid applications with Telit's ME50-868 Wireless M-Bus module. Since the Telit ME50 series is pin-compatible with the ZE family, also ZigBee and Meshbased RF technologies can be addressed with the same hardware design. Alternatively, with the use of the Telit TinyOne family the M09/5 can be made to operate in the license-free radio bands of 868 MHz and 915 MHz (US market). The board's voltage converters were designed for the higher energy consumption of the TinyOne-Pro series. Thus when this product family is used, the board can cover ranges of up to 4km without any hard-ware changes. STK-S4 The AarLogic's GE865 GSM module from Telit works almost regardless of range. An Atmel microcontroller is applied to control the board, supporting the option of Python scripting. The Atmel AtMEGA162 controller, programmable in C and BASIC, allows the development of special applications which is a desirable feature in the fields of remote monitoring and smart metering (e.g. to create a central hub for bulk data transfer). The modules for Wireless M-Bus metering also comply with EN13757 standard and the Open Metering System (OMS). As required for OEM board-level products, this new radio board is equipped with all important inputs and outputs, including serial CMOS interface, power inputs (6 to 32V), and antenna connections. According to Olaf Schfer, Technical Director at Round Solutions, the AarLogic M09/5 allows specific hardware and working prototypes to be developed in a very short time. A complete Round Solutions STK-S4 development environment guarantees a quick and easy development effort. <<

AarLogic M09/5

The market for Smart Grid and license-free Mesh networks is currently one of the major drivers in industrial communication and to address this demand Round Solutions offers a wide range of OEM solutions in GSM/GPRS and short-range communications. The AarLogic M09/5 is a universal starting point from which to develop short-range gateways successfully.

ADVERTORIAL

36

TELITPrOduCTs

TELIT2MARKET 06|11

ShoRT RAnge PRODUCT RANGE

Short Range to gSm|gPRS gateways Tinyone Form Factor Terminal license-Free System for Frequencies 1 ghz Powerone Compact Tinyone embedded

GG863-SR Gateway
Range Frequency Radio Data Output Power up to 4000 m 433, 868,915 or 2400 MHz up to 250 Kbps up to 500 mW ARM9 200 MHz 128 MB flash /64 MB RAM mit Linux OS

TinyOne Plus 868 MHz

1500 m 868 MHz 4.8 to 38.4 Kbps 5, 10 or 25 mW

TinyOne Pro 868 MHz

4000 m 868 MHz 4.8 to 38.4 Kbps 500 mW

PowerOne 868 MHz

16000 m 868 MHz 4.8 and 9.6 Kbps 25 to 500 mW

PowerOne 868 MHz RF modules

16000 m 868 MHz 4.8 and 9.6 Kbps 25 to 500 mW

TinyOne Lite 868 MHz RF modules

700 m 868 MHz up to 100 Kcps up to 10 mW

TinyOne Plus 868 MHz RF modules

1500 m 868 MHz 4.8 to 38.4 Kbps 5, 10 or 25 mW

Core

Sensitivity (BER<10 -3) Quad band GSM /GPRS class 10

-105

-105

-105

-105

Cellular

Standby Embedded Stack Option Antenna Option Mesh, ZigBee or Wireless M-Bus Removable

70A Mesh & Star

4A Mesh & Star Star Removable Star

2A Mesh, Star & M-Bus Integrated

4A Mesh & Star

TELIT2MARKET 06|11

TELITPrOduCTs

37

license-Free System for Frequencies 1 ghz Wireless m-Bus en13757

Ieee 802.15.4 | ZigBee ne Family

Tinyone

le Family embedded

Form Factor

TinyOne Pro 868 MHz RF modules

4000 m 868 MHz 4.8 to 38.4 Kbps 500 mW

TinyOne Pro 915 MHz RF modules

4000 m 915 MHz 38.4 Kbps 500 mW

LE50-433 RF modules
2000 m 433 MHz Up to 115.2 Kbps 25 mW

LE50-868 RF modules
2000 m 868 MHz Up to 115.2 Kbps 25 mW

NE50-868 RF modules
1500 m 868 MHz Up to 115.2 Kbps 25 mW

ME50 868 RF modules

2000 m 868 MHz Up to 100 Kcps 25 mW

ZE51-2.4 RF modules ZE61-2.4 RF modules

1km/4km 2400 MHz 250 Kbps 2.5 mW /100 mW Range Frequency Radio Data Output Power

Core

-105

-100

-109

-109

-103

-108

-97/-100

Sensitivity (BER<10 -3)

Cellular

70A Mesh & Star

4A Star

1A (*) Star

1A (*) Star

1A (*) Mesh

1A (*) Wireless M-Bus

1A (*) ZigBee PRO

Standby Embedded Stack Option Antenna Option

38

TELITSTory

TELIT2MarkET 06|11

GearinG up towards a smart environment by creatinG new future services beyond the networks and it infrastructure of the past
hwang chulJeung, ph.d, director General network policy bureau, korean communications commission

>> koreas it reputation is drawing the world's attention yet again as the itpowerhouse begins pursuing futuristic services such as intelligent networkbased smart work, m2m communication, cloud computing, and augmented reality.
Koreas network policy has focused on improving performance through high-speed and BcN networks and on creating new services based on these networks. Such policy is indeed a global trend however, a need for changes in the agenda for future networks has been suggested as the information and communication technology (ICT) paradigm continues enduring shifts due to the glass ceiling of network-based profit models. Soaring wireless and wired traffic and the spread of open technologies is driving the development of future technologies such as n-screen, m2m, cloud, and rule changes in

PvP games. This soaring demand is anticipated to bring about significant regulatory changes coupled with telecom companies' rush to opt out of the telecom industry. The evolution of networks in Korea, as is the case overseas, is headed in a direction that can accommodate the rising traffic volumes while offering time and location-independent network access. With that in mind, the driving of futuristic intelligent networks such as the Giga-internet, WiFi, Wibro, 4G, Cloud, and m2m is a critical task and a focal point going forward. The Korean Communications Commission is planning to propose a vision based on which Korea positions itself as a global landmark in the future through the implementation of intelligent infrastructure that surpasses the notion of network speed and quality with

hwang chulJeung, ph.d director General network policy bureau, korean communications commission

TELIT2MarkET 06|11

TELITSTory

39

agile response to any abrupt shifts in the global IT environment. The Korean Communications Commission is also putting together a Development Strategy for Smart IT Networks that enables the network infrastructure to dynamically respond to prospective intelligence and sophistication. This strategy comprises the promotion of areas such as wireless and wired networks, m2m communication, cloud, and other intelligent networks as well as new business models. The centerpiece of this intelligent network infrastructure is m2m (Machine to Machine). m2m, as the term itself implies, automatically inspects and reports any problems arising in systems and is widely utilized in our everyday lives. In its infancy in the early 1990's, the technology was merely perceived as the notion of remote control or telematics and its application was very limited. But that has changed and it has now become one of the most scrutinized markets globally, after many streaks of high growth.

and validate u-Service technologies. The Commission has also hosted m2m conferences and forums in which experts from all industries participate to discuss partnership models between government and private organizations. Further, the Commission is looking to drive human resources development for small and mid-sized m2m enterprises under the banner of "m2m device platform development". In December 2009, the Korean Communications Commission together with the Ministry of Safety and Administration and the Ministry of Knowledge and Economy established within the governments cloud computing agenda, the vision of "becoming the world's top cloud computing nation". Specific items in the plan include "cloud computingbased platforms, integrated IP-TV trial service business" and other business models. Here, a matching fund-type "cloud service test bed" is up and running for small and mid-sized enterprises to develop, test, and verify cloud-related technologies. The government has also revised the rules and regulations and has set up a security and certification system targeted at involving those who trust the cloud to take part in shaping the environment. The smart work era is right ahead of us as smarter IT technologies such as smart phones and smart TVs become more fully integrated into corporate environments. Smart work has been proposed as a solution to general industrial issues including low birth rates, aging society, diminishing labor productivity, and environmental pollution. The key idea here is removing the cap on the space and time where and when work happens by using ICT technologies such as video conferencing. The government is looking to leverage the advantages of smart work considering its benefits towards low-carbon and green growth. Starting in 2012, in preparation for the rise in demand by these new services the Korean Communications Commission is planning to increase the general accessibility to broadband networks by expanding WiBro to 5 metropolitan areas and 84 municipalities as well as pursuing the commercialization of LTE services. A nationwide launch of 4G is also expected to happen in 2013. The plan also includes provisions to establish a sound mobile user information protection and violation prevention system and to enhance the security of new services such as mobile office and cloud computing looking to minimize the number of invasion of privacy cases. Accompanying this plan will be the development of a user-friendly user interface (UI) that anyone can easily manipulate. An intelligent network is anticipated to play a pivotal role in fostering the creation of new services in the future smart environment, helping businesses and people beyond the limited scope of a functional network. It becomes a crucial asset contributing to enrich the value of not only IT but also Korean society. Further, it creates a realm that fosters sharing and collaboration with Europe when it comes to the global effort of developing the future network infrastructure and the stimulation of the global markets. <<

In October 2009, the Korean Communications Commission set up the "m2m Roadmap" and is taking steps to drive Korea into becoming the most influential ICT powerhouse in the future. Starting in 2009 the Commission has fomented services models such as the u-Weather by the Korea Meteorological Administration and u-Shelter in the city of Seoul, by creating mock businesses in order to elevate the countrys global market competence. It is also currently operating a trial m2m environment in which small and mid-sized m2m enterprises can develop, test,

40

TELITSTory

TELIT2MarkET 06|11

service enabLement services: cataLyst for chanGe in m2m

robin duke-woolley, founder and ceo, beecham research Ltd

What are SES and why are they important now? The Service Enablement Services (SES) layer for m2m is defined as the layer above network connectivity such as mobile airtime and the layer below end user services such as fleet/freight management and security alarm services. They are horizontal services that help bring to market and provide ongoing support for virtually all end user applications in all sectors, whether they use a form of fixed line or wireless connectivity, or both. One example of these is simply the ability to remotely enable and disable a connected device. Another is the ability to update a remote device with the latest application software. These may

>> a constant fascination of m2m is the sheer variety of new applications appearing every day, covering anything from an innovative new way of measuring air pollution (by monitoring the heartbeat of snails) to a pill bottle that reminds you to take your medicine. this variety is both a key strength of m2m it can be applied to almost anything and a key weakness it is a hugely fragmented market.

Traditionally, this fragmentation has slowed up getting new applications to market because each one had to be built from the ground up. Hardware suppliers in particular, module suppliers have worked hard to help overcome these difficulties by making their application libraries available so that new applications can use some of the building blocks from those that went before. In other words, helping to minimize the extent of re-engineering of m2m solutions for every new application. Recently, a different direction of support has come to prominence in the market. This is often referred to as Service Delivery Platforms. Beecham Research uses the alternative term Service Enablement, as in m2m Service Enablement Services or SES, as we believe the scope of SES transcends the ability of any one service delivery platform to provide.

Value Added Services (application software) Service Enablement (SE) Services Network Connectivity (e.g. SIMs and air time) Embedded Device (hardware)

TELIT2MarkET 06|11

TELITSTory

41

seem like trivial activities for a few devices. Not so trivial when the population is in the tens of thousands, or even millions as projections show will be the case within a few years. So one of the reasons for the growing importance of SES now is that the projected population of devices being used out in the field will soon be so large that the only way to manage them effectively will be through much greater use of automation. This is only one reason though. Another has to do with the wide variety and fragmentation of the m2m market. Traditionally, m2m solutions and services have evolved through activities within their own sectors. For example, a fleet management application has nothing in common with a smart metering application. Neither of them has anything in common with a CCTV security application either, and so on. Such applications have evolved entirely as a result of developments in their own markets as so-called vertical silos, unable to interact with each other even if they wanted to. Yet now we find they may need to be able interact in order to develop further. A great example of this is the rapid emergence of electric vehicles. This is where car telematics meets the smart grid. Suddenly, the transport sector and the energy sector are colliding. It does not end there. The future competitiveness of many m2m services moving forward will depend on creating innovative ways of merging with others in what might seem to be unrelated markets.

This might, for example, mean very different applications sharing similar data for entirely different purposes a natural extension of the "Internet of Things" concept. With this in mind, something that can improve the interoperability between applications making them more open will add a new dimension of opportunities for growth in the m2m market. In this way, SE services should provide a means for breaking down this traditional, highly vertical structure into a considerably more open environment. Are there more than just a few of these services? The short answer to this is "yes". Beecham Research has been researching the need for SES for nearly three years and has already completed one major study in mid 2010. A second, more ambitious follow-up study is now in progress and one remarkable finding so far is that it is now possible to identify well over 100 different service enablement services that are likely to be required over the next few years. This raises another key point who should provide them? Without doubt, part of the answer to this lies with network operators, who are ideally placed to provide some of these from their natural position "in the cloud". Whether they are best placed to provide all of them, and whether they should build them or buy them are different questions. All of this indicates that m2m Service Enablement Services delivered from within the cloud represent a key catalyst for m2m market development of the next few years. <<

42

TELITSTory

TELIT2MarkET 06|11

an outLine of the m2m business and strateGy at

Jang Gyusang, director, m2m business team, kt

Jang Gyusang, director, m2m business team, kt

>> m2m refers to communication among machines, and communication between machines and devices operated by humans. in a broader sense, it refers to the fusion between communication and information technologies making possible tracking the location and condition of objects, vehicles, and people in remote places.

It is expected that the development of wireless technologies, enlargement of the m2m market, and reduction in wireless connection expenses will lead to drastic growth in the m2m market. Consequently, one leading driver behind the activation of the m2m market is the expansion of wireless network coverage throughout the world achieved in a manner that secures stable quality. In addition, the advancement of wireless broadband technologies such as WIBRO and WCDMA also contributes to invigorating the m2m market. With the growth in major markets such as Telematics, Telemetry, and etc. various industries look to m2m-based monitoring and control systems to cut back on their costs. With the price decline in communication modules and terminals and decrease in wireless communication costs, deployment of wireless applications is becoming more and more widespread. The Korean domestic m2m market is expected to experience a large

growth to 1.6 trillion won (640 billion won in communication services) in 2012 (source: Yankee Group, 2008, McKinsey service results) especially because of policies such as Green IT and green growth being pursued at a government level. Sectors including transportation, healthcare, environment, education, and energy will be bolstered by the governments Smart SOC program to strengthen Koreas competitiveness as a Smart IT country; again leading to further expansion of the market. The m2m business has a very complex value chain all the way through to the point where the service reaches the ultimate end user. Another characteristic of this market is that it is composed of numerous small-scale sub markets, making it a long tail industry. Cooperation among players and improvements to overall business inadequacies are needed for vitalization of the m2m market, considering the high initial costs, complex development of systems and services, and small scale

TELIT2MarkET 06|11

TELITSTory

43

volumes. Therefore it is necessary that efforts be made to ease the penetration of the m2m wall with the creation of an environment where the domestic m2m market can thrive in a collaborative Eco System created by a combination of telecommunication-manufacturer-terminal. KT m2m business directions To the above end, KT will build up and provide additional m2m infrastructure, create business alliances, push ahead with global m2m to lead the vitalization of the m2m market, and will continue participating actively in the various IT policy making efforts being carried out by the government. KT plans to organize its fare structure for the different services and provide low-price all-purpose modules in order to accelerate the expansion of the m2m market. KT already provides an m2m services platform that can accommodate demands from its customers. But further to that KT is pushing to make the m2m market grow by forming business alliances working hand-in-hand with module manufacturers, solution businesses, terminal businesses, and many others. Along with this collaboration, KT is searching and reviewing new m2m business projects where an alliance

with telematics can bring enhancements to customers in general such as e-book and other businesses. m2m foundation establishment case Our company is developing MOS (Maintenance, Monitoring and Management Operating System), a management solution for buildings, factories, business and infrastructure facilities. In it, we are implementing a facility control architecture based on a ubiquitous foundation where the internet is used to allow supervision and control from the MOS control center, to mobilize services as needed on emergencies and to carry out routine inspections. Other important cases An automated meter-reading service that reads electricity, waterworks, and gas utility meters using 3G or WIBRO networks, allowing meters to be read from remote control centers. A tachograph to be installed in vehicles to save information about the vehicles services, the drivers operations, collisions, images,

and etc. which are then used in analyzing the cause of accidents when they occur. A monitor to control Diesel Particulate Filter (DPF) for real time transmission of information regarding operation data collection, abnormal data occurrences in vehicles from remote locations. An alarm response system supporting the dispatch process for KT Telecop, CAPS, and other security companies which sends information on event occurrences from their security equipment through the WCDMA network. The BMS (Bus Management System) requires buses to be continuously connected to the network to deliver data on the bus location making WIBRO the best connection technology since it can be provided at a lower price than other networks. Mobile surveillance cameras can send images using WIBRO and be monitored remotely in real time without requiring construction to expand the broadband infrastructure in contrast with cable which does. The city of Seoul is currently in the process of developing a business effort entitled Building an m2m service using a commercial-use network foundation. The effort includes U-Shelter which displays traffic reports, weather reports, and environment reports; U-Green which collects information on the environment for areas and routes from moving vehicles that have environment sensors installed in them; and U-Road which collects information on weather and road conditions. <<

korean m2m market potentiality

million 4,000 300 250 200 150 100 50 0 wireless automatic mobilePOS security meteringreading information display intercom vending machine automotive 100 52 30 60 100 50 36 46 6 300 4,000
Source:KoreaCommunicationsCommision

1,568

18

30

egionalwholeindustryrelatedsubscriber:61,34million r G,3Gbasedregionalm2mmarketrelatedsubscriber:2.62million 2

44

TELITGLobaL

TELIT2MarkET 06|11

teLit's GLobaL presence

TELIT WIrELESS SOLUTIONS EMEa Corporate Global HQ in rome Coordination of all disciplines TrIESTE Product Development, GSM/GPRS Product Development, Short Range Product Management Technical Support Sales & Marketing for EMEA

TELIT WIrELESS SOLUTIONS North america Regional Headquarters Regional Product Certification Regional Product Management Regional Technical Support Sales & Marketing for North America

teLit communications year in a nutsheLL

Giuseppe surace, president telit wireless solutions emea, trieste (italy)
loyalty from our employees to help drive the organization forward. By executing on these ideas we have been able to create new strategic products both in cellular and short range (SR) which helped drive growth. >> If 2009 was the bottom and 2010 was the turnaround year, what will 2011 be? There are indications that the business climate is changing. But first of all let me start from where I left you in my last note, at a time when many businesses were seeing steep declines in revenues due to the economic downturn. I am pleased to report that Telit has remained focused, executed well on its core business, made several strategic investments and experienced growth during the last twelve months. To sum it all up in a few concise paragraphs is a not easy effort but last year I let you know about a commitment that was foremost in our minds: to use innovation in order to drive the growth. And just as I noted last year, we have and continue counting on ideas and Our sales force, always supported by the technical and engineering teams propelled us ahead creating momentum in sales despite the downturn period. Going back to April this momentum allowed us to announce a major sales milestone: the delivery of our two-millionth GE864 module. All GE864 models are highly suited for use in large-volume applications in the telemetry and telematics in- GE 864 - QUaD dustries, whilst the extra- automotive V2 rugged GE864-Auto allows integration into vehicles and other applications. Just one month later we announced to the public and industry that our UC864-E-AUTO would be

equipping the new Audi A8 as its UMTS/ HSDPA broadband communications module providing Audi customers with broadband mobile Internet access inside the car as a standard feature. This internet connection will operate in two distinct ways: first with the Audi online services integrated into the car allowing for such conveniences as point of interest searches, destination uploads into the car from home, retrieval of weather forecast information, travel information and news headlines, and Google Earth online satellite maps; and second as a rolling hotspot through which passengers can use the cars internet access facility with mobile wireless LAN devices such as PDAs Laptop computers, etc. So, while we announced H1 results exceeding expectations, we continued firmly pushing the organization to keep the momentum going. With the companys comprehensive technical coverage we pressed on to create products and manage technologies covering the entire RF spectrum, with our engineers remaining always committed to creating complete and easy solution for our customers. Our R&D force has been increased in all our regional R&D centers Trieste, Cagliari, and Sophia Antipolis. The integration among these sites is one of the main assets of our company allowing us to remain confident as we trek the path to future development. For 2011 our engineers are working hard to reduce even further the time to market and production despite our already superior performance in these timing dimensions. We will continue working closely with all our customers and as we remain bullish and very confident on the bright outlook for Telit. <<

UC864-E-DUaL

TELIT2MarkET 06|11

TELITGLobaL
more than 3,000 CUSTOMErS in 77 countries around the world a global network of 50 DISTrIbUTOrS headquarters in rOME (italy), regional headquarters in raLEIGH (nc, usa), SO PaULO (brazil ), SEOUL (korea )
TELIT WIrELESS SOLUTIONS aPaC Regional Headquarters Product Develpoment, CDMA & UMTS Product Management Manufactoring, Logistics Regional Technical Support Sales & Marketing for APAC

45

TELIT WIrELESS SOLUTIONS Latin america Regional Headquarters Regional Product Certification & Regulatory Compliance Regional Technical Support Manufacturing, Logistics Quality Compliance Sales & Marketing for Latin America

r&d centers in TrIESTE aND CaGLIarI (italy), SOPHIa aNTIPOLIS (france), TEL aVIV (israel), SEOUL (korea), 25 regional sales offices

teLit north america update

michael a. ueland, vice president & General manager, telit wireless solutions north america, raleigh, north carolina (usa)
affecting local governments due to the economic slowdown. For many municipalities facing the effects of lower tax revenues, installing or retrofitting existing parking meters with devices that accept electronic payment such as smart cards or credit cards has become a convenient way to increase revenue without lengthy legislative approval processes. For consumers, electronic payment can add extra convenience, meaning they do not need to look for change to feed the meter. From an m2m technology perspective, electronic payment systems are a rich area of future innovation. Today, the popularity of DVD rental machines, vending machines that sell everything from soda to iPods, and etc. are an effective way for retailers to reduce costs by eliminating human interaction. But, they also benefit consumers who want the convenience provided by not having to get cash from the ATM to pay for routine purchases. In the future, expect to see more point of sale systems that will incorporate cellular or other wireless technologies, such as near field communications (NFC). Another product that I am excited about is Garmins new personal tracker unit, the GTU 10. Incorporating Telits GE865-QUAD, this compact, lightweight, battery powered locator can be attached to a childs backpack, a to 1 inch dog collar, or a hikers belt to provide location information and an audit trail for families concerned about the safety and security of their love ones (pets too!). With a retail price of less than $200 which includes: the device, the ability to set alerts through the Garmin website, and the first year of service; the device can be used for numerous applications. What I really like about the Garmin solution is that it embodies many of trends that have been driving m2m growth over the past several years: low cellular data rates, requiring the user to do nothing to start service but turn the device on; compact size; long battery life; and lower device cost. Looking forward into 2011, the world continues to look bright for Telit in North America as we continue to see many great opportunities to continuously help our customers to innovate around m2m. <<

>> What a difference a year makes! As I prepared my previous update in late 2009 there was still much concern regarding the status of the economic recovery. In January of 2010, we saw a noticeable uptake in activity among customers and prospects which was reflected in their intentions and development efforts lasting throughout the year. For Telit North America, it was a breakout year as we continued our rapid rise to prominence in the m2m market with revenue growth accelerating to above 120% year over year. Looking back now, our success in 2010 was made possible by strong growth in core markets for us such as commercial vehicle telematics, buy-here, pay-here (BHPH), and pay as you drive (PAYD) auto insurance. But we also saw significant growth in point-of-sale (POS) and an early success in medical devices. A good example of our growth was the work we did with the IPS Group. IPS is a provider of payment systems for parking meters. Much of their recent growth can be attributed to two recent trends first, the growth in cashless payment systems and second, the increasing debt loads coupled with budget deficits

46

TELITGLobaL

TELIT2MarkET 06|11

bLossom the seeds of success

marcos kinzkowski, vice president sales & General manager telit wireless solutions Latin america, so paulo (brazil)
>> During this past New Years eve, we celebrated some fantastic set of results for Telit Brazil. In 2010, the m2m market grew to over 1.3 million units and in our 2nd year of operation, we are proud to have participated in nearly all new projects that got under way in Brazil, positioning Telit as the 2nd largest player in Latin America. This level of success was achieved so quickly due to several factors, notably the strategy to attend to the market locally, partnering with our customers, and the robust set of product made in Brazil including those with automotive ISO TS certification. Today the Telit brand is synonymous to quality and reliability in products as a result of one great team working with total focus on success. We have sown the seeds and now we reap fruits of success. Market at a glance In addition to the expected organic growth for the m2m market, the automotive law which mandates line-fitted installation of an anti-theft device in every vehicle leaving the factory will most certainly cause the market to boom. The current track and trace (T&T) segment represents 50% of the entire market and the enactment of the automotive law should add approximately 1 million new devices in 2011, from the 5 million vehicles expected to be produced in the year, raising the segments share even more. And this is just the beginning of the run expected in the entire m2m market and its new solutions (see more details on page 95). Another boost is likely to come from the fiscal printer law, which mandates that all new point of sale (POS) devices that can issue receipts to consumers, be equipped with an m2m device for bi-directional communications with the governments tax collection agencies to reduce tax evasion. This law covers an installed base of about 1 million printers, translating in another million m2m devices. The first official equipment trials will occur in 2011, with Telit, of course, inside. The wireless POS market has grown steadily since 2008 due to the rising demand for consumer convenience and increased transaction security and even though the POS market is largely dominated by global players, many local companies like Perto and Gertec are currently planning to introduce customized solutions to address specific markets opportunities. The security market is surfing the m2m wave. Driven mostly by demand in residential monitored alarm systems, and wire-line to wireless conversion products, annual growth is expected to rise and hover at the 30% mark for the next few years. New products entering the market like systems integrated with on-site patrol, the wireless patrol stick, and 3G solutions with image transmission are fostering an increase in confidence in the consumer. We cannot overlook another booming market: prisoner tracking which is based on a device and service designed to track prisoners during parole periods, has vast potential with the various penal authorities planning to deploy around 400,000 units posthaste. New surprise growth pockets are also appearing in the metering segment, with a number of recent RFPs adding to the already robust m2m market growth estimates for the country. But the market is also demanding solutions from other technologies like ZigBee to address connections in the last mile, to increase management quality, reduce loss and theft at the utilities, and build the foundation for the countrys Smart Grid. Trends As technology progresses, creative solutions are being designed to serve new market needs. For more reliable solution, the SIM CARD will have an SMD format or might be integrated into m2m module, as in some Telit m2m modules already available. Remote

healthcare solutions providers are demonstrating substantial attraction to this market. Devices like breathers and electrocardiographs with m2m communication capabilities are entering the market with one of Telits partners already introducing an innovative GPRS cardio monitor. The deployment of 3G in the m2m market is also growing with application to connect remote ATMs, medical monitors with image transmission. Better than Ever In Brazil the expectations are better than ever for the m2m market and for Telit. We are right on track to meet our objective of becoming the best provider of m2m technology in the country, offering robust and local manufactured products with a pinch of our own way of doing business. The market has understood our value proposition and our genuine partnership and quality in satisfying our customers. We are on our way to the top. <<

TELIT2MarkET 06|11

TELITGLobaL

47

teLit apac update

Gideon rogovsky, vice president sales, telit wireless solutions apac, seoul (korea)
>> Telits APAC operation had outstanding results in 2010 reinforcing the companys strong position in APAC and the global m2m market. In Korea Telit has maintained market dominance since 2006 while in China and other Asian countries Telit experienced an impressive growth of over 48% year-over-year. Regional demand for m2m solutions have dramatically increased in telematics and POS sectors as well as the new smart-grid, healthcare, and public wireless communication sectors. As the growth trend in m2m remains unwavering and the market expands its utility out to various industrial fields, client demands are also shifting from specific sectors to practical technical fields applicable to our everyday lives. Responding to this steady demand, Telit prolifically releases new products, one of the leading examples is the successful GE865 the worlds smallest GSM/GPRS cellular module. Telit now supports not only cellular technologies like GMS/GPRS, UMTS/WEDGE/HSDPA and CDMA but also short-range communication technologies such as ZigBee, short-range RF, Wireless M-Bus; offering 15 other new short range products in the past year, becoming the worlds only m2m provider to offer module products in all mainstream wireless data communication technologies. To help boost the market, Telit Korea has worked with a number of CDMA/WCDMA companies while reinforcing its partnership with government and key communication providers. Owing to industry leading technology, Telit Korea has secured the supply of the BCM-865 to the Korean Meteorological Administration (KMA) which is engaged in efforts to arrive at accurate real time weather forecasting through the Ubiquitous-Automatic Weather Station (u-AWS) enhancement Project. The BCM-865 module is the communication core that goes into SK Telecoms MPT-800 terminal. It is capable of automatically connecting machines positioned remotely from their central offices allowing for their real time monitoring and control. Noteworthy for Telit China was the selection of Chinese company BYD as the recipient of the coveted Telit Strategic Supplier 2010 award. BYD is a major manufacturer of electric cars in China which has recently earned global recognition after United States Warren Buffet decided to make investments in the company. Telit and BYD have signed a manufacturing partnership agreement calling for Telit modules to be manufactured through BYDs production lines for several years. Module products manufactured by BYD are being shipped to all of Telits global market regions. BYD was selected the 2010 strategic supplier thanks in part to its efficient production line management and thorough testing procedures all of which have contributed to sensible upgrade in product quality. Additionally the company adopted strict measures to abide by the 3J 5S rule of manufacturing which eventually led to increased reliability in process management. The December 6th award ceremony was held at the BYD headquarters counting with attendance by General Manager Stanley Liu and AD Huang from BYD and Oozi Cats (CEO), Yossi Moscovitz (COO) and Alexander Bufalino (Global Marketing VP) from Telit. Also in 2010, Telit China launched the GL868DUAL the smallest GSM/GPRS surface mounted module in the market. Its ultra-small form factor, easy to assemble, excellent energy efficiency and low unit price make this module perfect for mobile applications and high-volume manufacturing across all industries. Keeping pace with requirements from the increasing addressable market, Telit launched the new low-cost product to help maintain its leading position in the AMR segment in China. In addition, Telit plans to bolster its efforts to explore more opportunities in 3G and CDMA both of which are expected to grow significantly in 2011, enhancing focus on emerging segments such as connected PND or Mobile Computing devices. In 2010, Telit Taiwan participated in the largest m2m seminar in the APAC region. This well known event represents a valuable opportunity to glean the latest m2m trends and engage discussions focused on telematics and smartgrid while key companies in the space presented their newest technologies in data communication modules that can be used for smart-grid and real-time data transfer management. There, Telit proudly showcased the GE865-QUAD micro GSM/GPRS module (20 x 20 mm in size) with QUAD-band technology which allows global use; the GL865-DUAL low-price GSM/GPRS module; and the HE863 Telit's new HSPA module recently that launched service worldwide. In February 2011 Telit opened its new sales office in India appointing Ashish Gulati as Country Sales Manager. Telit sees a great opportunity in the growing market in India and especially in the bursting AMR market. When starting new operations such as this one, Telit looks to provide its experiences and specialty skills in m2m to the local domestic market so that regional corporations can count on a broader range of choices for their application development efforts. I would like to use this opportunity to thank the whole APAC team and especially the sales team that I had the honor of managing over the last couple of years. I believe that Telit has excellent teams in APAC led by HoSang Kin and Dukjun Koh who present Telit in the most respectable professional manner. <<

Oozi Cats, CEO Telit Communications PLC and Stanley Liu, General Manager bYD

48

TELITGrEEn

TELIT2MarkET 06|11

trackinG imperiaL eaGLes in the baLkans

paolomaria schiratti emea application engineering manager

>> now more than ever, protecting wildlife and the environment are top priorities globally. this is particularly true for endangered species on the brink of extinction. real-time surveillance and protection of these species is fundamental in saving them. with the recent years extraordinary technological advances in m2m, mobile cellular networks, and the internet we can now continuously monitor and record the behavior of animals on the other side of the earth right from our desks.
Recently, the Bulgarian, non-government organization Green Balkans (www.greenbalkans.org), addressed a request to Electroninvest Ltd. (www.electroninvest.com), based in Sofia (Bulgaria), to help solve the problem of monitoring populations of endangered birds, like the Imperial Eagle (Aquila Heliaca), in the Balkans region. Traditionally, the most popular method for this kind of tracking involves the use of an RF transmitter which is secured to the bird. The transmitter emits a radio beacon which is manually detected by monitoring teams in the field using at least two receivers with directional antennas. This style of tracking and locating demands a lot of time and teams of highly experienced people. To track several birds it is necessary to adjust the receiver frequency several times and bad weather condition can make the

tracking effort very difficult. Additionally since it is impossible to continuously track the animals the result is a lack of statistical data on the birds habitats. Another problem area is the tracker weight considering that in general, animal trackers must weigh less than 5% of the animals weight. For small animals the tracker weight could be limited to as little as tens of grams. Global Positioning System (GPS) makes it possible to find exact bird location as well as flight speed and direction. But whereas GPS receivers with RF transmitters solve some of the problems, remote tracking from a single national monitoring center is still impossible due to RF power requirements and power consumption issues. Enter the BT-70: an m2m application that includes a GPS receiver to find the exact location of a bird, and a Telit GE865 module, to communicate with the national monitoring center solving all the above problems. It allows monitoring from a single national center and does not require experienced field teams thereby significantly reducing monitoring costs. Tracking is available around the clock,

TELIT2MarkET 06|11

TELIT TELIT

GREEN

TELITGrEEn

49

all year round, irrespective of weather conditions while weight and power consumption are very low. The BT-70 operation is quite simple but very efficient. Most of the time the tracker is in a power saving state where the GE865 and internal accelerometer are powered-off and the GPS module is disabled. The units microcontroller is also in sleep mode waking up every 10 minutes to check solar panel and battery voltages. Depending on solar panel voltage, the location data gathering interval

FTP server folder. If one is available, it is then downloaded. When fast track mode is enabled the BT-70 starts sending location data every 5 minutes. When a home network is unavailable and the BT-70 is not registered for roaming, the location collection interval is increased to prevent memory overflow. If the battery voltage accidentally drops below 3.6V the BT-70 enters an emergency mode wherein only battery voltage is checked periodically and nothing else is done until that voltage rises to 3.8V when it again enters normal mode. By using this very aggressive power conservation algorithm the units operating time is extended to at least 3 years. The first experimental unit of the BT-70, GPRS/GPS bird tracker, has been undergoing field testing on a Griffon Vulture (Gyps Fulvus) marked K02 since October 27th 2010. The tracker used on the Griffon Vulture is a heavy version weighing 70 grams. Electroninvest Ltd. is continuing its research in the design of the BT-25, a lightweight version of approximately 25 grams for smaller birds. Electroninvest Ltd. is also developing trackers for bears (Ursus Arctos), chamois (Rupicapra Rupicapra) and even turtles (Testudinidae), applying m2m to help maintain the integrity of our planet. <<

bird EEN specifications GRtracker

GSM module: Telit GE865-QUAD (3.2 gr) PS module: Locosys LS20027 G (SiRF Star III) icrocontroller: Microchip TechnolM ogy PIC24FJ ccelerometer: Freescale MMA7455L A (2G range) attery: 2 x 500 mAh, 3.7V Li-Polymer B olar panel: Synonar SC4160Y S verall dimensions: 90 x 46 x 15 mm O eight: 70 gr. W emperature range: -25C to +65C T

TELIT

GREEN

bird tracker features

ata collected (UTC time, latitude and D longitude, bird speed and direction, motion status moving or flying, battery voltage) are sent to the FTP server via GPRS in a .kml file format which can be opened directly by Google Earth. File upload intervals can be configured from 1 to 24 hours; he uploaded file name includes inT dividual identification with the bird name plus date and time thus enabling monitoring by data or period; T-70 settings can be changed by upB loading to the desired birds folder the appropriated settings file; the BT70 automatically downloads new settings from FTP server; T-70 settings include GPRS and FTP B server settings, birds name, data folder name on FTP server, location collection interval, file upload interval, fast track interval and fast track on/off; ocation collection interval is ambient L light intensity dependent: in sunny conditions the interval is 30 min (increasing if light intensity decreases), and 5 hours during the night. Switching to fast track mode, data from the bird is received every 5 minutes to help field teams locate the bird; f no GSM network is available or signal I is too poor in strength for GPRS transmission, data is stored in memory.

is reduced taking advantage of the birds day time activity period. When it is time for data collection, the BT-70 powers-on the GPS module and accelerometer. It then performs a reading of both location and motion status, storing the data in memory. Every 10 hours, the microcontroller also powers-on the Telit GE865 sending collected data to an FTP server. At the end of the data upload, the BT-70 checks for a new configuration file in the appropriate

50

TELITworLd

TELIT2MARKET 06|11

M2M ConneCtivity for elevators.

Jordi Bayona tavernier - sales Manager, Microkey M2Mlift
>>Elevators (or lifts) are complex machines with a high technological value which have evolved constantly since the origins of basic engineeringtothepointwheretheycannow moveatblazingspeedsofupto37 milesper hour (60 Km/h). Initially, elevators were machinescomposedtotallyofelectromechanical systems (Figure 1). But market demands put upon manufacturers took electromechanical performance to its limit. Breakthroughs in electronics allowed for gradual replacement of electromechanical elements, improving the efficiency of some of these systems and incorporatingnewones.Thisprocesscauseda technologyrevolutionthatleftbehindmany companiesthateithercouldnotorchosenot toevolve.Incontrast,thosethatwereableto dosobegantopavethewaytowardspositions ofleadership. Occupant safety and greater user comfort were incorporated subsequently as new capabilitieswereplacedinthehandsofengineers by the evolution of electronics and also becauseofdemandsfromnewlyimposedregulationsandothersystemsfocusedongreater machine control. One area to highlight in this race of innovations was the emergency telephone which forced technicians and companiestodelveinanewdiscipline.And to complicate matters even further there wastheserviceaspectwiththeaccompanying

TELIT2MARKET 06|11

TELITworLd

51

MK-775, the cutting-edge technology that the Microkey M2MLIFT division has specifically developed for elevators, provides a solution offering the best connectivity between elevator control electronics and the different leading telephone operator platforms.

Figure 1-1

Figure 1-2

need to contract telephone lines, the call centertoreceivetheemergencycalls,anda controlprocedureforprocessingtestcalls. Today,mostelevatorcontrollermanufacturers include communication ports which enable the companys technical teams to increase the level of control of the elevator, improve its performance and maintenance qualities, depending on the level of sophistication of the customized functions. To achieve this, the use of information technology became essentialand,onceagain,theelevatorindustry was required to expand its knowledge into yet another technical discipline. This particularevolutionhasbeencrucialdueto new market demands requiring greener andmuchmoreenergy-efficientelevators. The revolution in which we are currently immersedstemsfromthelatestconvergent advances in information technology, telecommunications,andtheinternet,andrepresentsthesupportingbasisfortheM2MLIFT technology.Ithasalsoservedtoaffirmcommunicationstechnologyasanindispensable elementintheelevatorsector.(seefigure1-1 and1-2) As is well known, an elevator is a complex machineontowhichmanyoperatingrequirementsareplacedandwhicharenotalways trivialtofulfilloperatinginaveryharshand aggressive installation environment. In view of that, solid experience is essential in the designandcapabilityadaptationofeachsolutionsothatitmeetstheneedsdictatedbythe infinite variations of this machinery. But
Figure 3-1 Figure 3-2

Figure 2, ARchITEcTuRE of the solution for DATA transmission and processing.

foremostthisexperienceisessentialbecause inextremecases,thesesystemsmustbeable to prevent faults such as emergency phone failure,whichmayendangerthelivesofthe car occupants or prevent a rescue operation.

m2m technology and M2MLIFT (as a hardware-firmware unit and communications provider) are viewed as solutions that will increase the quality of the elevator while raisingprofitabilitylevelsfortheafter-sales

52

TELITworLd
organizationsresponsiblefortheseelevators. Thiscanalsoleadtoagiantleapincustomer satisfactionformaintenancecompaniesand/ orelevatormanufacturers. ThesuccessofanM2MLIFTsolutionrequires the integration of several players: the manufacturer of the elevator controller who is utmostexpertinitsperformanceandoperating requirements; the manufacturer of the m2m communications device, who must be abletointegrateitsdevicesintotheelevator systems (in terms of protocols and specifications)whileconsideringthedemandsofthe operating environment of an elevator (car shaft,humidityandtemperatureconditions, dust,environmentalnoise,andetc.);andthe communications provider responsible for servicingthespecificm2mconnectivityplatforms, for supplying suitable SIM cards for performance (service) and their hardware. (seefigure 2) This layout in architectural integration reflects changes brought about by market evolutioninthecommercialandrolechainsof differentplayers.Previously,therelationship chain was limited to the purchaser of an elevator and the manufacturer, who also installedandperformedmaintenanceforthe purchaserorenduser.Thissimpletwo-point relationship has evolved into an extremely complex commercial chain which includes the manufacturer and end user but also incorporates certification agencies, maintenance companies, companies providing othercommunicationsandsafetyservicessuch ascalltests,andetc.(seefigure3-1and3-2) M2MLIFT has devised a solution for this complexity by combining the hardwarefirmwareandcommunicationsinacomplete, comprehensiveoffering,asseeninfigure 4.

TELIT2MARKET 06|11

Figure 4

Looking forward,requirements forelevators arelikelytocontinueincreasingintheyears ahead.Theagingpoolofelevatorswillcontinuebeingrenewed,adaptinglegacytothenew technologies.Bywayofreference,inEurope alone there are almost 4,100,000 registered elevators, 70%ofwhicharelocatedin4 countries:Spain,Italy,FranceandGermany.Spain accounts for over 22% of the total with over 910,000 elevators making the experience of local companies there highly recognized. Lawsandregulationswilldemandincreasingly more complex systems to improve safety and decrease energy consumption, which in turn will lead to the need for wider-ranging andmoreefficientmaintenance. Only the adaptation of m2m solutions and, morespecifically,thesetofsolutionsprovidedbyM2MLIFT,willmakeitpossibletomeet this challenge. One aspect that sets m2m apartintheelevatorsectorisitsmanagement of the voice element. The law establishes thatanyonetrappedinanelevatormustbe

assistedbyacallcenteransweredbypeople. Thisleadstoanaddedcomplicationandmay potentially become a problem if not consideredtogetherwiththedataelement. ThankstotechnologydevelopedbyMicrokey, its MK-775 device and M2MLIFT platform represent the only solution in the market allowingforallpossiblecarrierstobeusedin the communication effort. An intelligent sequence establishes available channels to select from according to a dynamic set of optimizationcriteriaofavailabilityandcost at the time the communication session is started.CoveredtechnologiesincludeDTMF, TMDT (another exclusive development by Microkey that improves the reliability of DTMFtransmissionsby50%),SMS,CSDover GSM, UDP, TCP/HTTP, and USSD (this last carrierisnotavailablewithalltelephoneoperators).Figure 5showsthecarrierselection diagram.<<

Figure 5

TELIT2MARKET 06|11

TELITworLd

53

the future of GsM teChnoloGy in the MeterinG Market.

iain warner, General/Business Development Manager, asl holdings ltd

GoinG wireless

>>In the late 1990s the half-hourly market had been de-regulated, the switch over to solid state metering was in full swing, and theneedtoremotelyreadmetersonadaily basisgaverisetotheneedforcosteffective alternatives to Public Switched Telephone Network (PSTN). There were a significant numberofsiteswherethecostofinstallinga hardwiredsolutioncouldrunintothethousands of pounds and some where it was not an option at any cost. Of the various options that were available, Global Systems

and as part of trials in the small- number of specific issues that relate to the medium-enterprise (SME) and resi- question above. At a high level, those issues dentialmarkets.Inthesemarketsbilling fall into one of two categories; firstly, how canbeimprovedthroughtheeliminationof doesasupplierstartearlyandsecondly,what estimated readings while locally, the back communications technology will dominate office can reap value from the half-hourly themassmarket? consumption data for energy management activities. Therefore the question is raised, In the competitive market, energy suppliers does GSM technology have a future in the willbelookingatwaystowinandretainmore customers based on the benefits that smart meteringmarket? metering can deliver. A central communicaTheUKGovernmenthasnowsetthewheels tions solution is not likely to be up and in motion for a nationwide smart metering running for at least two years. If suppliers roll out, based on a centralized communica- waitforthat,theywillmisstheopportunity tionsmodel,withtheoptimisticaimofcom- to differentiate themselves and capitalize pletionbytheyear2020.Thecentralizedcom- onthemomentumbehindalowercarbonsomunications option will, according to the ciety.Itwillalsoaddpressuretothealready Governments analysis, deliver the greatest tighttimescaleofcompletingthemajorityof netbenefittothemarket;howeveritraisesa theprogramby2020.

Mobile(GSM)becamethemostpopularand eventually ended up as the first choice, ahead of PSTN, as the technology evolved andthecost-modelimproved. SubsequentlyGSMhasbeenusedtodeliver thesamedataretrievalbenefitstothelarger consumerbaseinthenon-half-hourlymarket

54

TELITworLd
GSMcommunicationssolutionsuseexisting networksandofferadirectlinkwiththeindividualmeteringpoints.Dataretrievalsystems that exist today can be scaled up by using GPRSconnectivity,allowingthemtodealwith theincreasedvolumeandstillretainseamless links into supplier billing systems via the industryaccrediteddatacollectionanddata aggregationcompanies. There is however, room for improvement. Most GPRS devices are not optimized for secure,efficientdatatransferatanytime.They mostlyuse TCP/IPconnectionsoverapublic Access Point Name (APN) and require some sortofpromptingtoestablishtheconnection. However,solutionsdoexistthatdecreasethe cost of data transfer, decrease latency and manage dynamic IP addressing on a private, secureAPN,suchastheASLTelemetryProtocol(ATP)fromASLHoldingsLtd. IftheprovisionoftheSIMcardandassociatedcontractremainsunderthecontrolofthe meterassetprovideroranindependentthird party,ratherthanbeingwithwhoeverthe energysupplierwasatthetimeitisfirst installed, there is no reason why the physicalassetsandtheAMRservices cannotendurethechangeofsupplierprocess. The concept of the central communications modeldoestendtoimplythatasinglechoice oftechnologywillfollow.Inreality,nosingle technologywillbesuitabletocovertheentire population. In the case of radio based solutions,therewillbeareasthatcannotcontact thebasestationsduetodistanceortheenvironmental conditions surrounding them. Withanytechnologytherewillalsobethose moreremote,sparselypopulatedareaswhere thecostofadditionalbasestationsorconcentratorsamortizedacrossthemeteringpoints inrangewillmakeitprohibitivelyexpensive. Estimatesputthisat10%to 20%percentof thepopulation,whichisstillasizablerequirement for a fill-in solution. It is more likely thatthecentralcommunicationsbodywillin factbesplitintotwofunctions,acentralized data management function, unifying data intoindustrystandardexchangesandacentralized communications system interface, supportingmultipletechnologies. DevelopmentsinSIMcardtechnologyin2010 arealsosettostrengthenthepositionofGSM inthismarketsector.Theintroductionofsolid state SIMs, also known as industrial form factorSIMs,movesGSMmodemsawayfrom the need to have a mobile phone style SIM cardinsertedintoacarrierbyimplementing the same functionality on an integrated circuit,soldereddirectlytothemodemPCB.Reliability of the whole product is then improved since there is no plug and socket arrangementthatcansufferovertimefrom the effects of vibration, moisture or contamination. Security is increasedsincethe

TELIT2MARKET 06|11

SIM card cannot be removed preventing a breakdownincommunicationsandpotential fraudulent use of the SIM. The technology will also facilitate switching between differentmobilenetworkserviceproviderssothat inanygivenUKinstallation,themodemhas thechoiceofthreealternatenetworks,should itspreferredonenotbeavailable.Allofthis adds up to fewer failures at time of installation, fewer failures throughout operational lifeandfewersitevisits. GSMtechnologyisaprovensolution,which will continue to be supported for the foreseeablefuture.Itenablesmarketleadersto movequicklywhileprovidingaviablefillinoptiononcethecentralcommunications model has been established, without an increasedriskofstrandingorthecreationofa messylegacy. Butasmartmeteringsolutionwillalsoneeda secondary communication network in order torealizeitsfullpotential.Thecollectionand disseminationofinformationandcontrolsignalsmust reach further into the home to engagetheconsumerandinteractwithotherdevices.Thereforeahomeareanetwork(HAN)is required to facilitate secure, resilient, standardized local communications. It is logical, fromadesignperspective;togrouptheco-ordinationofthisfunctionwiththeWANfunctionwherethereisapermanentsourceofpowerwithprocessinganddatastoragecapability. There are a number of different standards emergingintheHANmarket,suchasZigBee, ZWave and Homeplug, but it is ZigBee which has gained traction in the UK energy market. From the communications product

TELIT2MARKET 06|11

TELITworLd

55

suppliers point of view, therewillalwaysbedebates over the pros and cons of differing technologies, but the demand in the market willgoverntheimmediate priority. As GSM based WANmodulesevolveasdescribed above, we will also seetheinclusionofZigBee HAN capabilities that will enable communications with in-home displays (IHDs) and gas meters as a baseline smart metering solution. As time goes on, intelligent appliances will become more widely available along with other control and monitoringdevices.

TofindoutmoreaboutASLHoldingsLtd,

whichexiststoprovidecommunicationstoa thirdpartyserviceprovider,suchasanenergysupplier,needstobeaccessibletothemat alltimes.Theonlylogicalwaytodeal withthisisforthepowertobederived fromtheelectricitymeter.Ifnot,wherWAN Metering ever there is pre-payment and a conLink sumer self-disconnects as their credit expires, the modem would be turned offalongwithalltheotherloadsinthe property. Then, when the consumer purchases more credit, a reconnect command cannot be automatically senttothemeterandthecustomerhas Appliance In Home no manual entry method. Even when Control Display pre-pay isnt involved, what is to stop the consumer from deliberately or accidentallyswitchingoffthemodem home Area Network andinterruptingtheflowofdata? Whenthemodemisbuiltintothemeter enclosure or terminal cover, it can deriveitspowerfromthereanditcan have a direct serial data interface whichwillsavethecostofanadditional HANnodeinthesystem.Themodular nature of the design must balance the practicalities of installation, cost effectiveness, interoperability and flexibility for technologyoptionsnowandinthefuture. ZigBee technology for the HAN and GSM/ GPRStechnologyfortheWANcanbebrought togetherbyspecialistcommunicationscompanies working in partnership with meter manufacturers to provide the communicationsplatformforbothsmartmeteringearly adopters and enduring roll outs. Enhance-

please visit: www.aslh.co.uk

Tel:+44(0)1604 883880 Fax:+44(0)1604 883881 Email:sales@aslholdings.co.uk

ments in technology can reduce ongoing support costs of installations and increase functionalitythatwilldovetailintothenew marketmodelasitdevelops,helpingdeliver thehigherpoliticalgoalsofreducingcarbon emissions.<<

DevelopmentsliketheASLHoldingsLtdnext generation Gateway Modem combine the technicalinterfacesofboththeWANandthe HANwitharepositoryofdatafrommultiple meters being available for interrogation locallyor remotely.Thismeansenergymanagement type information for the IHD and billing type information for the energy supplier,allinopenstandardformats. The design of the Gateway Modem needs to remain modular in concept but allow integrationforcostreductionandsecurity. The prospect of a completely standalone deviceisunlikelyasitwillraisetoomanyissues with installation in the home and its power sourcewillnotbesecure.Anydevicelikethis

56

TELITworLd

TELIT2MARKET 06|11

Show whatS inSide

You have a well-engineered m2m product. Yourcustomersvaluetheuser-orientedfunctionality, the high performance quality and the effortless handling. In addition, your customers surely greatly appreciate reliable and future-oriented technology. Show your customers that as a Telit partner you have chosenaTelitmodule.Asoneoftheleading manufacturers of m2m technology with many years of extensive experience, Telit offers state-of-the-art technologyonthehighest level which, already today, is aimed at the tomorrowsdemands.Additionally, Telit, a global player and currently the fastestgrowingm2mcompany, guarantees sustainabilityandthusimportant investment protection for your product development. Services such as the Telit Technical Forum (www.telit.com/ techforum)completethewiderangeofservicesoffered. Telitshighefficiencyisthereforearelevant decision criterion for your customers. Take advantageofthehighcommitmenttoqualitybythestrongbrandTelitandshowthat yourproductcontainsamodulemadebyTelit, on your website, your product advertising or your technical product descriptions. You can download the appropriate label from our website: www.telit.com >> DownloadZone>>Marketing&Sales>>Logos.We look forward to continuing our successful partnership.

Click the SMART way, log on to www.metering.com daily and gain access to the world of utility metering and customer management information.
Be in the know with metering.com!
Daily news updates: News from around the globe, updated daily FREE Weekly newsletter Virtual Press o ce: Microsites of whos who in the metering industry Industry directory and web links: Links to leading companies, associations and manufacturers White Papers: In-depth articles from leaders in the industry Conference calendar and papers: Presentations from Metering Internationals global conference series (Subscribers only) Magazine Archives: Perfect for research and reading the latest issue before distribution. (Subscribers only) Trade Leads: NEW business opportunities! Regional Contributions: News and reports from our global editorial network. Job Shop: Excellent specialist job opportunities and interesting updates on new recruitment solutions and service o erings

N FEA EW TUR E

Contact: info@metering.com TODAY!

TELIT2MARKET 06|11

TELITworLd

aMr

57

thanks to technical support from telit, aartesys was able to develop and certify its new high-end easyGateway in relatively short time and with much less risk.
Andreas Grossenbacher, Head of Product Management

>> Well-grounded with in-depth knowledge and experience in the field of quality measurements and monitoring services for telecommunication networks, Aartesys AG venturedintothem2mmarketwithitsfirst application in 2006. In addition to remote accesssolutionsandTelcodatacommunication applications, Aartesys AG has focused on future proof meter reading solutions whichareallIPIntranetandInternet.The platformconsistsofawell-managednetwork of intelligent gateways, running LINUX and acentralmanagementsystem. At the end of 2009, Aartesys AG decided to launch an innovative GPRS/Ethernet based devicefamilynamedAartesysEasyGateway well suited for metering and remote access solutions. Because of the excellent reputation and robustness of the much used Telit GE862moduleintegratedinthepredecessor device, Aartesys AG selected the Telit GE863 PRO 3foritsnewEasyGateway.Thedevelopment team benefited from the widely deployed product base and excellent Telit support. And along with proven hardware and software functionality achieved an exceptionallyshorttimetomarket.

The EasyGateway can be operated in standalonemodeorasamanagednetworkelement in a standard IT environment. Together with theAMIRAmanagementsystem,theproduct offers a sophisticated end-to-end, two-way communication solution over mobile and fixedIPnetworks. Customized pre-configuration coupled with additional resources from an auto-configuration server including important local diagnosticsviaLEDandantennapositioning, ensureeasycommissioninginthefield. The metering specific part of the application supportsdifferentmeteringprotocolssuchas IEC62056,M-Busandmultiutilitysupportfor electricity,gas,water,andheatmeters.Meteringdataistransmittedinrealpushmodeover theWANports. Each EasyGateway can serve up to 32 independentenergymeters. 4channelenergyprofilesforeachmetercanbeloggedandstored locallyforupto31days.NearrealtimemeteringdatacommunicationmakestheEasyGatewayidealforsmartmeteringapplications. Aartesys EasyGateway is also available in OEMvariants.<<

FAcTS
aartesys aG
system
AartesysEasyGatewayGPRS/Ethernet/ SerialGateway

www.aartesys.ch

which telit module do you use and why?

WeusetheGE863-PRO.Itprovidesreliable GSM/GPRS functionality and a powerful ARM processor in a space saving module, reducingdevelopmentandEMCrisk

features

Threshold monitoring Local monitor

(mobile)

and alarming Building automation integration

AMIRA Management System

Smart meter multi-utility - GPRS
Operation support and alarming Scalable and extendable Extensive commissioning support

G PRSandEthernetWANport D iscreteserialinterfacesandI/Olines U SBhostconnectorandSDcardslot S ealableconnectorbay S tandardDINrailandwallmounting B uiltinwiderangeACpowersupply 85 264VAC(optionalDC) W ebserverandremotemanagement capabilities I PtunnelingandVPNformultiservice, multiproviderapplications T ransparenttransmissionofserial dataoverWAN E xtendederrordetectionandlogging E asycommissioning M eteringspecificapplication
Aartesys EasyGateway

EasyGateway
Consumer control (Fail Safe)
Fiber xDSL Broadband

Local monitor

Wireless IP Network SOA based data interfaces Secure 2-way communication:

Cable

Wired IP Network
Multi service

Standard meter

Power Line

EasyGateway

Multi provider

58

aMr

TELITworLd

TELIT2MARKET 06|11

we developed a robust and high-performance GsM/ GPrs modem for metering application using telit's Ge864-QuaD v2 module.
T. Braun, Manager Development

FAcTS
Baer industrie-elektronik Gmbh
www.baer-gmbh.com system
UniModGSM-4

which telit module do you use and why?

WeusetheGE864-QUADV2becauseitfits toourrobustandhigh-performanceGSM/ GPRSmodem.

adiomodem(GSM/GPRS R withautoswitching) SM:Transparentreading G PRS:DIN43863-4(IP-Telemetry) G orBAER-Protocol rotocols:SCTM,LSV1,DLMS,IEC1107, P VDEW2+,IEC60870etc. ide-rangesupplyvoltage: W 80VAC-270VACand60VDC- 375VDC alternative:12VDC all-mountedhousingaccording W toDIN43861-2 isplay:9LEDsforpower,GSM,3INF, D RI,DCD,TxDandRxD n-boardinterfaces:20mA/CS,RS485 O 2-wireandRS232(forserviceonly) >> Bear industrial electronics is a leading international supplier of communication and metering technologies to energy providers and the industry. Uncompromising highclassmanagementhasbeenvitalinachieving our market share at home and abroad. With groundbreaking research and development welooktofurtherstrengthenourpositionin the coming years which will position our companyverywellforthefuture.

features

The world-wide Global System for Mobile communication (GSM) network provides in additiontodigitalvoicecommunication,the ability to transmit data. The universal radio modem UniMod GSM-4 was designed for remoteinquiryofanykindofmeteringdata especiallyfortelecountingapplications.The UniMod GSM-4 can be used in EGSM networks in 850, 900, 1800, and 1900 MHz and withanynumberofproviders.<<

uniMod GSM-4

TELIT2MARKET 06|11

TELITworLd

avl

59

we love working with the telit team of experts.

Alon Hengel, Technical Support Manager AVL

FAcTS
spetrotec ltd
system
MTS-MiniTrackingSystemandSolutions

www.spetrotec.com

which telit module do you use and why?

TheGE863-QUAD.Weselectedthismodem becauseithasabuiltinGPSmoduleand offerstheoptiontoportanapplication directlyinthemodemwithPython.

features

>>The MTS is a versatile and cost-effective GSMGPRS/SMSmonitoringunitthatprovides onlinetrackingcapabilitiesforvehicles,trucks and motorbikes. The MTS provides all the essentialfeaturesforAVLservicessuchasthe tracking and retrieval of stolen vehicles, fleet management,andemergencyandsecurityapplications.Thebasicplatformcanbeenhanced with expansion units utilizing a proprietary one-wirecommunicationprotocol. The MTS features the Telit GE863-QUAD modem.Wehavemadeabundantuseofthe cooperation with Telit and their team of expertswhowehaveconsultedwithextensively tomaximizetheuseofthemodem,delivering theunitsfeatures.TheGE863-QUADisaquad

Increaseddriversafetyandsecurity Increasedvehiclesafety ncreasedfleetutilizationthrough I improvedmonitoringandcontrol Reducedunauthorizeduseofvehicles Reducedtheftofcarsandgoods Improvedaccidenteventprocessing Reducedinsurancefraud ettermanagementoffleets B vehiclesarelocatableatanytime educedbillingproblemsfor R leasingcompanies educedunnecessarylaborovertime, R withassociatedsavings

bandmodem,whichgivesusahugeadvantageoverourcompetitorsworldwideinLatin America, Africa, Europe, and in our local marketIsrael.<<

MTS

60

avl

TELITworLd

TELIT2MARKET 06|11

the best strategy we adopted in terms of product development was to choose telit's GsM module to make our GPs trackers become rich featured products.
Frank Tang, CEO

>>ATrackTechnologyInc.isengagedindesign, developmentandmanufacturingofAVLtracking systems. It was founded by a group of professionals,withover10yearsofexperience in the AVL industry and has a proven record withover300kunitssoldintheEuropeanand NorthAmericanmarkets.ATracksstate-of-art manufacturing facility has over 10 SMT lines as well as automated testing and assembly equipment. ATracks goal is to provide the moststable,costeffectiveandrobustfeatured AVL tracking systems through a worldwide partner-based distribution network to the location-basedtelematicsindustry. ByJanuary2011,withinoneyearofbeingestablished,ATrackhasalreadylaunchedseveral models. Currently, both the AT3(E) and AT5(i) areusingtheTelitGE865-QUADmodule.Both modelshavebeensuccessfullyintegratedwith many useful accessories and are equipped with several unique functions. ATrack takes muchpridethatitsAT5iisthefirst1-wireintegratedGPStrackerinTaiwan.Thisprovesthat thecapabilitiesoftheR&DteammakeATrack pioneersinTaiwansAVLindustry.

IntheGPStrackingbusiness,thestabilityofa tracking device is the key to be successful. ATrack understands the importance of this factorwhendesigningitsGPStrackersandthat is the reason why ATrack selected Telit, the leading m2m module provider, as its GSM modulesupplier. WithTelit'sexcellentsupportandhighquality modules,ATrackhasgainedanexcellentreputation and has built up a stable distribution channelinaveryshorttime.ATrackisdevoted tocontinuallydesigninganddevelopingtrackingdeviceswiththehigheststabilityandqualityinthemarketandplansonbecomingthe leading company in the AVL industry across theglobeintheforeseeablefuture.<<

FAcTS
atrack technology inc.
www.atrack.com.tw system
AT5(i)-AdvanceGPStracker,AT3(E)-GPS tracker

which telit module do you use and why?

ATrackusestheTelitGE865-QUADmodule becauseitprovidesextendedtemperature range,whichissuitableforFleetManagementapplication.

features
AT5(i)

Key features of AT5(i): 1-Wireconnection(AT5i) SupporttoGarminFMI CANBussupportviaOBDII GSMjammingdetection&alarm Automotive3-axisG-sensorrated at+-16G FastOTAfirmwareupdateviaGPRS fromFTPserverat50seconds 8V~40Vwiderangeoperating supplyvoltage

AT3(E)

TELIT2MARKET 06|11

TELITworLd

avl

61

with telit hardware and software, the product success is fully guaranteed.
Arik Gantal, VP of International Marketing and Sales

>>Cartheftandfleetmonitoringhavebecome anightmareformoreandmoredriversandcar leasingcompaniesaroundtheglobe.Theneed to create a small enough unit has turned into a real headache for most of us. ERM R&D invested their efforts to create the smallest standalonedeviceincorporatinghigh-techan-

ti-theft functionality that can protect your car aswellasmonitoritsperformance including OBD fordiagnostics.Usingthe VIN,theunitalertswhenever the car ECU unit is removedorswappedwith another. The Zee PLC Ready Transceiver can communicatewithseveral engine-kill concealed relays achieving high level of theft protection. The communication is madeoverthepowerfeed lines and not through aphysicalwire,therefore making tracing of the relays seem to be a very, verydifficulttask. The device also communicateswitharangeofoptional external adapters suchasGARMIN,camera (for snapshots), temperature, DriverID, Trip-Type using a numeric keypad, Dallas iButton, Analog, andmore.Andforeaseof installation, a OBD T-cableharnesscanbeprovided,fittingthedevicestraightintothecars OBD socket. GPRS/GPS LEDs indicate the systemdiagnosticsstatus.<<

FAcTS
erM telematics and security systems ltd.
www.erm.co.il marketing@erm.co.il

system
TelematicZorinshort:theZee;areduced sizeTelematicsdevice.

which telit module do you use and why?

GE865-QUADisselectedusingthelessis moreguideline:thesmallestM2M modulethatenablesextremelycompact performancewrappedwithTelitsupport.

BD/CanBusHi/Lowsupport O IMLOCKbysoftwareandmechanical S design lessismorereducedsizewithfull scalefeatures:only60x50x25mm uiltinGPSmodulewithRFdesigned B antennaandbatterybackup GN, 2I/OsandLINfor2waycommuniI cationwithexternalaccessories TA O LCReady:Encryptedmodulator P operatingonthepowerlinestocontrol concealedEngine-Killrelaysfor maximumanti-theftprotection emperature,Garmin,eCALL,BlackBox, T FMS(j1939/1708)support Button/PINcodekeypad i
TelematicZ

features

62

fleet Management
we chose telit modules for their advanced integrated features and innovative solutions. we appreciated telits technical support efforts in supporting us with the implementation of their modules into our products.
Giuseppe Meroni, President

TELITworLd

TELIT2MARKET 06|11

>>KFTSpaisacompanydedicatedtoresearch, development, production, and marketing of radio location systems based on GPS-GPRS technologiessincetheeighties.Wearenowina leading position in the automotive anti-theft satellitemarket,boastingawellpreparedand always available staff of expert technicians, andoffering: Complete GPS location system: reliable, modular,andflexible,developedinresponse toourcustomersspecificneedsandadopted bymonitoringserviceprovidersoperatingin Italy, throughout Europe, the USA, South America,andtheFarEast. Mobilelocationsystemunitsfeaturingarchitectureandfunctionsdevelopedfromseveral years of in field operation experience, and abletobeprovisionedandworkwiththemost common communication links such as GSM, GPRS,CDMA,thankstoco-operationwithTelit wirelesssolutions.

FAcTS
kft spa
system
KT-200,KTCHASE,KTSKYWALKING GPS-GPRSunits Modular and expandable control base- stationsbasedonpopularandwidelyavailable open platforms. A sophisticated function set makes them easy to use and capable of optimizingoperationtime. To completely satisfy customers needs we notonlyprovideadvancedandcontinuously updated radio location solutions capable of meetingthemostsophisticatedrequirements from all market segments; design, manufacture, supply of anti-theft satellite and Fleet Managementsystems,butalsoprovidecomprehensivetechnicalsupport. KFTproductsrangefromentry-point,lowcost units to very sophisticated systems including fencingfunctions,videoacquisitioncapability from a multiple camera system, and a wide range of accessories based on the most advanced technologies (CAN BUS interfaces, dual mode communication systems,etc.).Thecommonelements inourproductsareahighperformance-to-priceratioandextreme flexibilty provided by a sophisticatedbutinteractiveconfigurationfunctionwhichallowsour systems to meet virtually any kindofneedwiththesamehardware(economyofscale)andwith noredesign(timetomarketequal to zero). An installed system can even be reconfigured on-the-fly withoutstoppingthevehicle.<<

www.kft.it

which telit module do you use and why?

WeusetheGE864 QUAD V2 becauseof itssize,lowpowerconsumption,high performanceandreliability.

features

KT-200

CE 97 directiveapprovals; E &TTEfullytypeapproved; R MS,data,andGPRScommunication S channels; ynamicanti-jammingfunction D usingnearon-roaddevicesasmobile markers; ativejammingdetectionfunction N owedtotheTelitmoduleenabling programmingoflocalreal-timereaction procedures; ocationviaGPSorGSMasabackup; L ntegratedCANBUSandK-BUS I management; ntegratedtransponderreceiver; I uilt-inBlackboxfunctionswith B programmablerecordingstrategies; ide 9-36Vsupply. W

KT chASE

TELIT2MARKET 06|11

Gateways
leucotron selected telit to develop its new Cellular Gateway because it boasts a wide product range and provides direct support for developers in the design and testing phases.
Jos Francisco Canado Braga, Operations Director

TELITworLd

63

>> Both iCell Light and iCell Plus versions boost savings on call tolls from landline to mobilephones. Thehighcostofcallsbetweenlandlineandcell phones represents an obstacle for companies looking to reduce telephony costs. Knowing this, Leucotron Telecom, a Brazilian company that develops integrated communications solutionsfortheenterprisemarket,hasincreased its product portfolio by launching the new cellular gateway iCell. This cellular gateway isusedtoconvertphonecallsmadebetween landline and mobile into mobile-to-mobile calls,reducingtollcosts. iCell is easy to install and offers various features that facilitate and ensure convenience inplacingsuchcalls.Itsmainfeaturesinclude: Carrierassignmentwhereitdeterminesthe carrier to use when originating calls so as to usebestroutepromotingadditionalsavings; Blockingincomingcallsbyregisteringdenied phone numbers or area codes; Call back - whichallowstheregistrationupto300(Light

version)or600(Plusversion)frequentlyused numbers,forwhichthedeviceisconfiguredto hangupandreturnincomingcalls. TheiCellLightissuitableforcompanieslooking for solutions that guarantee toll savings in telephony usage. The Plus version adds features for enhanced ease of installation anduse,suchasmonitoringthestatusofcalls viaLCDdisplay.Additionally,thePlusversion which is battery equipped also displays battery charge information. This feature allows thedevicenottorequireconstantconnection topowerwhileinoperation. To use either version all that is required is a SIMcardfromanyGSMoperatorenablingitas a cell phone. The product installation is fast andsimpleandtheconfigurationofthedevice canbeperformedlocally,viaananalogphone connectedtoit. The companys main goal is to consolidate itspositionasoneofthemosttopplayersin themarketofcellulargatewaysinBrazil.The launch of the iCell product family allows us tomeetnewcustomerneedsandmarketdemand in terms of innovation and efficiency, expanding our market share, concludes the companysseniormanager.<<

FAcTS
leucotron equipamentos ltda.
www.leucotron.com system
iCellLight iCellPlus

which telit module do you use and why?

WechosetheGE864-PYmoduleconsideringaspectslikereliability,complianceto Brazilianregulationsandprojectfeature requirements.

features

allprogressandbatterycharge C informationviaLCDDisplay allbacktoupto600numbers C ncomingandoutgoingcallfilters I arrierassignment C ncalltransmissionandreception O independentvolumecontrols omprehensivecustomersupport C B:Somefeaturesareoptional N

icell Light icell Plus

64

Gateways
the Ge864 module is a perfect match for our M2M products thanks to its small footprint and low power consumption.
Herv Bibollet, Sales Manager

TELITworLd

TELIT2MARKET 06|11

>>WebdyndesignsandcustomizesInternet gatewaysthatenableinitiallynon-communicating industrial equipment to connect andcommunicatewithRemotemonitoring applications. To do this, Webdyn works on two different kinds of products: OEM solutions designed to meet specific needs from individual clients and off-the-shelf concentrators designed for given markets. In both cases, Webdyn designs and manufactures the complete product (hardware, embeddedsoftwareandenclosure). WebdynSun is a perfect example of the applicationofWebdynscorecompetencies in designing multi-protocol bi-directional concentrators. The gateway can simultaneously monitor inverters, meters, analog sensors, and modbus equipments. Any alarmeventisimmediatelycommunicated

totheremoteserverwhileallcollecteddata isuploadedperiodically. Although an Ethernet connection is available,mostdeploymentsrelyonthedevices GPRSconnectivity.Robustnessandsimplicity of integration were therefore the main criteriaintheselectionoftheGPRSmodule. The Telit GE864 was easily selected and currently gives us complete satisfaction. In less than a year WebdynSun has made Webdyntheleadingproviderofphotovoltaic monitoring gateways in France. WebdynSun is already compatible with many inverter protocols and new protocols can be added via software update. Moreover itswiderangeofinterfacesmakesitaversatile gateway for other energy monitoring markets.<<

FAcTS
webdyn www.webdyn.com www.webdynsun.com system
WebdynSunphotovoltaicmonitoring gateway

which telit module do you use and why?

GE864-QUAD:Wechosethismodulefor itsexcellentprice/qualityratio.Akey pointwasalsotheeaseofintegration intoourmotherboard.

features
everalinverterprotocols(SMA, S KACO,POWERONE,SUNEZY,LTI, INGETEAM,FROSNIUS,etc.) S485/232 Modbus R 3-meterTIC relayoutputs 4 2pulseinputs 4analoginputs(0-10Vor 4-20mA) thernetandquad-bandGPRS E mbeddedwebsite E ailDinformat R

WebdynSun

TELIT2MARKET 06|11

healthcare
we valued the telit modules ease of integration as well as telits professional team for supporting us during the development and testing phases.
Laurent Seydoux, Director and Founder

TELITworLd

65

>> Twitoo is the fruit of the collaboration among3companies:H2ADforproductdefinition, marketing and property, Locatis SA forthemanufacturing,andSDATAWAYSAfor productdesignanddevelopment. SDATAWAY, a Swiss Engineering company specialized in electronic system design and industrializationisrenownedforinnovation and promptness. Its mission is to make cutting edge technologies available to its customers.Thankstoanetworkofregionaland worldwidepartnershipsSDATAWAYiscapable ofdrivingprojectsfromconceptelaboration through to mass production, providing full turnkeysolutionstocustomers. H2AD operates a 24/7 medical call center offeringfullysecuredsolutionswhichallow remote monitoring of vital signs and alerts,

structure is leveraged in ongoing development of secured solutions and reliable processes and is dedicated to secure and personalized control. H2AD is certified by the French health ministry for hosting healthpersonaldata. LOCATIS SA, a Swiss subcontractor, based intheJuraarea,takesonthemanufacturing of electronics products in the partnership. LOCATIS SA offers a comprehensive set of benefitssuchasprojectsupport(primecontractor for development and industrialization),cuttingedgeproductionwithtoolsand controlsofthemostcurrenttechnologyand apurchasingcenter.LOCATISSAisISO9001 andISO 13485(Medical)Certified. Twitoos aim is to be the link between in- dividualsneedinghealthmonitoringandtheir physicians. It is the hub for a whole family of health care measuring devicesincludingblood oxygen meters, blood pressure meters and others. It is capable of collecting data from thesemeasuringdevices throughaBluetoothconnectionandsendingthe data to the physician. ThelinkbetweenTwitoo and the server is a GSM connection established bytheTelit GE863-PRO module. For privacy and control reasons,thedatatransmittal procedure must be initiated by the user who just needs to touch a button on Twitootostarttheprocess.Aconfirmationis provided through a vibration, a visible feedbackandaconfirmationsound.<<

FAcTS
sDataway
system
Twitoo,Tele-medicinemobilegateway

www.sdataway.com

which telit module do you use and why?

WeselectedtheGE863-PROmoduleforits comprehensivefeaturesetincludingits abilitytorunthewholeapplicationonthe embeddedOS.

features
Twitoo,TelemedicineMobileGateway seamlesslydetectsandsynchronizeswith Bluetoothmedicaldevices.Itsecurely transmitspersonalmedicaldataovera GPRSconnectionthankstotheGE863PRO. Twitoosmainfeaturesare: owpowerconsumption L eliableGPRSconnectionfordata R transfer onnectupto5healthmeasuring C Bluetoothdevices asyforautomaticdatatransfer E actile,soundandvisiblefeed-back T whenbuttonisactivated

distant home care tele-assistance, and tele- diagnostics.Thesesolutionsaredesignedfor patients with chronic diseases, the elderly, andforindividualsintemporaryvulnerable conditions. H2ADs 5-year operating infra-

Twitoo

66

healthcare

TELITworLd

TELIT2MARKET 06|11

we appreciated telits experience and support which has been helpful in enhancing sonambas useability.
Ajit Pendse, CEO

loved ones living alone. Caregivers and family members receive periodic wellbeing text message alerts based on daily activity in the seniors home, as well as messages composed by the seniors themselves. Seniors continue to live independently connectingwiththeirfamily and caregivers through Sonambas texting feature, while benefitting from Sonambas medicationalerts, calendar reminders, emergency response options, gamesandphotos. Telit has been very helpful in Sonambas development process, in particular, workingouttechnicalchallenges andensuringthatourproductworkedespecially with carrier-specific changes made in thesoftware. Sonamba was designed to be something that becomes part of everyday life for both the independent senior and caregiver. The device uses familiar technology that provides the ability to communicate with ones family members and caregiving circle. It monitors daily activity and requests emergency assistanceifnecessaryallwithinanaesthetically pleasingdigitalphotoframethats aneasyandattractiveadditionto any home. Simply put, Sonamba isabetterwaytolive. Sonambaretailsfor$549.99with a low monthly subscription of $39.00. For more information, pleasevisitwww.sonamba.com<<

FAcTS
pomdevices, llC
system
SonambaaWellbeingStatusMonitor forSeniors

www.pomdevices.com

which telit module do you use and why?

WeusedtheGE864-QUADforVoice, SMS,andGPRS. Telitrecommendeddesignpartnerswho haveexperienceindesigningconnectivity cardsandgettingthemcertified.

>> Seniors will now be able to extend their independentlivingwhiletheircaregiversstay informed and connected, thanks to a revolutionarywellbeingmonitor,Sonamba.Sonamba is an in-home monitoring system featuring a 7-inch touchscreen LCD display, built-in motionandsoundsensors,emergencybutton, andcellularconnectivitypackagedinasleek designwhichdoublesasadigitalphotoframe whennotbeingactivelyused. There are 11 million seniors currently living alone in the US. They face loneliness, limited socialinteraction,dementia,andfearthatpersonalemergencieswillleadtolossofindependence. In addition, there are over 43 million caregivers in the US who want the peace of mindofknowingtheconditionoftheirloved oneseverydaynotjustinemergencies. Sonamba (which is a device placed in the seniorshome)helpstodaysbusycaregiveror family member stay connected with their

ellbeingStatusAlerts W toCaregiversviaSMS 7-inchTouchscreenInterface Built-inCellularConnectivity mergencyResponseButton E ocialCommunications S utomatedMedication& A CalendarReminders igitalPhotoFrame D Games aregiveraccessthrough C iPhoneAppandWeb

features

TELIT2MARKET 06|11

healthcare
telit offered the right and timely support in important phases of obtaining application level approvals in key markets such as the usa.
Sren Vester, Senior R&D Engineer

TELITworLd

67

>> FreedomandMobilityforpatients!Telehealthmonitoringincreasesthequalityoflife forpatientsofferingthemaconvenientmeans to comply with their daily health regimen avoiding the need to visit a hospital. It also helps monitored patients learn more about their condition, which in turn leads to better self management and handling of different ailments. EventhoughtheGE864-QUAD-V2isglobally approved, in order to meet the stringent requirementsoftheCEMedicalDeviceDirective as well as FDA registration, Telit teams inEuropeandtheUSengagedustosupport our development efforts in hardware and software while additionally providing relevant test & papers throughout the different approvalprocesses.Thiswas,forsure,valued asaverymajorcomplementarycontribution totheTunstallR&Defforts.

The telehealth monitoring business model is often based on short-term usage by the patientwhichmakesplug-and-playfunctionality and reliable installation via GSM/GPRS criticalfactorsinreducingtheoverallcostof providing the service. Strong presence of these factors can significantly improve the overall cost-benefit of Tunstalls telehealth monitoringservice. Thanks to increased flexibility and growing interestbyMobileNetworkOperators(MNOs) globally, the share of healthcare monitor installationsusingGSM/GPRSisgrowingdayby-day compared to land line connections. The current installed base of approximately 15 thousandGSM/GPRS-baseddevicesinthe fieldcouldverywellmultiplyinnumbersin theyearstocome.<<

FAcTS
tunstall healthcare a/s
system
TunstallRTX3371 GSM/GPRSTelehealth Monitor

www.tunstallhealthcare.com

which telit module do you use and why?

Sincethisapplicationvolumerequired agloballyapprovedmodule,theGE864QUAD-V2wasselectedbecauseitoffered BGAmounting.

features
uadBandGSM/GPRS,approved Q globally ntegratedantennaforincreased I robustness uilt-inPlug-and-Playfeaturesfor B quickandreliableinstallation udiosupportusingcompressed A audiofiles eportsfromstandardperipheralssuch R asbloodpressure,bloodglucose,weigh scalesandpeakflowmeters esidescollectingvital-signsdata, B itservesascommunicatorbetween careproviderandpatient IPAAcompliantSSL-128encrypted H DAregistered,CE/MedicalDevice F Directive

Tunstall RTX3371

68

Monitoring

TELITworLd

TELIT2MARKET 06|11

we appreciated telit's support on the hardware design, rf test, eMC test and field test.
JeongSoo Lim, Director

soonandreporttheemergencyinacalltoa fire station triggering a rescue response for that emergency. Also, by monitoring activity level of the senior citizen inside a home, the devicehelpstheservicecentertakeappropriateactionshouldthedetectedactivitylevelso determine. BecauseofHideaSolutionshighleveloftechnical skills and rich experience in the field of ubiquitous sensor networks (USN) using Zigbeeandthankstotheactivesupportfrom Telit in the CDMA part of the project, full system development was concluded successfully. Telit provided strong assistance in various phases of the project including CDMAmoduleselection,hardwaredesign,RF testing,EMCandfieldtesting. Hidea Solutions telecare service provides certain voice features that set it apart from thecompetitionsuchashot-keydialingwhich allows the elderly to call family or neighbors according to pre-memorized numbers by pressingshortcutkeysonthephone. TheKoreangovernmenthasbeenpromoting thetelecaremarketsince2008whenitstarted a trial service for senior citizens living alone.By 2010thegovernmenthadprovided telecare service to 28,000 households with plans to expand those services to 120,000 householdsby2012. Becausetelecareservicesimprovesafety,promoting independent life for senior citizens most of whom have chronic ailments, it is expected that the service will continue to expand including features for the remote healthcare field.Remotehealthcare management and telecare are service areas thatgreatlycomplementeachother.<<

FAcTS
hidea solutions
www.hidea.kr system
ZETgate9905isaremotemonitoringdevice thatsensesrisksoradecreaseinactivity insidethehomeoftheelderlyorother impairedindividuals.

which telit module do you use and why?

HideaSolutionsusedtheBCM-865.

features

>> Thenumberofseniorcitizensisrisingrapidlyaroundtheworldandsoisthenumberof elderly persons living alone. Hidea Solutions hasdevelopedatelecareservicesystemusing m2mfortheseindividualsbasedonacombinationofadeviceplusonlineservicesthatcan beclassifiedasu-Healthcare.Theproductisa personal emergency response system (PERS) that can monitor users via a CDMA gateway terminal, activity sensors, a fire alarm sensor, andagasdetectingsensor.Itisalsocapableof contactingfamilyandemergencycenterswhen anemergencyorlikelyemergencyisdetected. Dataisgatheredbysensorsinstalledthroughout the senior citizens home, transmitted to theCDMAgatewayterminalthroughaZigbee network, and then from there to the central monitoringsystemthroughtheCDMAcellular network.Byanalyzingsensordatathesystem canautomaticallydetectafire,agasleak,and

igbeetoCDMAGatewayTerminal Z ensorDatacollection,transmission, S storageand mergencycallingandregular E voicetelephony uilt-invoicechipforuserguidance B viavoice leanLCDviewingandelderly C friendlybuttons earingaidalgorithmsforthe H hearingimpaired ancelfunctionforalarmsandfire C andgassensormalfunctionwarning emoteenvironmentalcontroland R remotefirmwareupgrade

ZETgate9905

TELIT2MARKET 06|11

TELITworLd

Pos

69

the Ge863-Pro has the stability and flexibility required in order to process millions of online food orders every year all over europe.
Erik Mellstrm, CTO

FAcTS
onlinePizza norden aB
www.mat24.se system
OnlinePizzabox: OnlinefoodorderingPOSterminal

which telit module do you use and why?

TheGE863-PROwasselectedforits combinationofapowerfulprocessor andaGSM/GPRSengine. >> OnlinePizza Norden AB is a leading player inonlinefoodorderingindustry.Thecompany operatesinSweden,Finland,PolandandAustria. The business idea is simple: help restaurants increase revenue by receiving online food orders. OnlinePizza gets a commission fromeveryorderplacedthroughitsservice a win-win concept that has become a wellknown success story, particularly in Sweden whereitallstarted.InSwedenalonemillions offoodordersareprocessedeveryyear. OnlinePizzawasfoundedin2005inLinkping, Sweden,bythreefriends.Theyfounditridiculouslyhardtofindgoodhomedeliveryrestaurants and their menus. On top of that, they were usually low on cash to pay the person upondelivery.Someonejusthadtosolvethese annoyingissues. Theserviceneededtomaintainthebenefitsof a bidirectional telephone call while adding desirable conveniences of the digital era. The goalwastogivethecustomertheabilityto(1) create an order from the restaurants online menu, (2) pay online, (3) submit the order to therestaurant,(4)receiveanimmediateconfirmation with estimated delivery time from therestaurantand(5)havethefooddelivered. ThefirsttechniqueusedtoachievecommunicationbetweenrestaurantsandtheOnlinePizza servers was to placing laptops, printers and modems (ADSL was popular in 2005) at the restaurants.Thiswasjusttoocomplicated,even thoughthethreeentrepreneursactedashelpdeskandsupporttotherestaurants24/7.Other techniquessuchasfax,SMSandmobileapplicationswereevaluated,butnonecombinedthe wireless internet connection with printing capabilitiesandasimpleuserinterface. OnlinePizzathencameupwiththeidea tobuildtheirowndevice,withabuilt-in GPRS modem, a thermal printer, LEDs, a speaker and a simple keyboard for bi-directionalcommunication.Afterone year of development, the first 200 handmade units were released. Eventually the business started to grow at such speed that massproductionbecameaviableoption. Today, the third generation of OnlinePizzas unique solution is running on a GE863-PRO fromTelit.Thankstoitscombinationofapowerful processor and a GSM/GPRS engine, the GE863-PRO has the stability and flexibility required to process millions of online food orderseveryyearalloverEurope.<<

features

rinterforordersandmessages P eyboardforbidirectional K communication EDsforvisualnotifications L peakerforaudionotifications S asilyaccessibleSIMcardholder E SBsupport U

OnlinePizza

70

safety

TELITworLd

TELIT2MARKET 06|11

our experience with telit has been positive with excellent support and follow through.
Dave Arringdale, CEO

andreputationaswellasthefactthatitperformed the functions necessary to interface withourtechnologyasdefinedatthetime. Intoxalock engineers worked closely with Telitadministrativeandtechnicalpersonnel through each phase of development. This collaboration included the certification of our device on the cellular network with which we partnered. Telits engineers were very cooperative always responding in a timely and productive manner to our engineersrequestsateachturn. The deployment of this product provides our company with substantial competitive advantages. Because we have combined the functionalities described above under one technology, we have a much more robust BAIIDsolutionthanothersavailableinthat market. And the advanced features will allow us to penetrate the voluntary market includingfleetsandindividualsinsearchfor a solution to protect employees or loved ones.Boththemandatedandvoluntarymarkets will benefit tremendously from the abilitytotrackvehiclesanddrivers,andtoreceiveimmediatereportsontheiractivities. The outlook is bright for this product and wearealreadyseeingalotofinterestinthe technology with many jurisdictions adoptingitorevendemandingitforallorcertain offenselevels.<<

FAcTS
Consumer safety technology, inc.
system
TheIntoxalockIgnitionInterlockDevice

www.intoxalock.com

which telit module do you use and why?

TheCC864DualItwasoneofthefew modulesthatcontainedbothcellularradio andGPSinthesameproduct.Costand reputationweretheprimaryreasons.

features
eal-timereportingofvehiclestart R anddrivingevents. hotoimagingofthevehiclecabin P includingthedriver. PSlocationandtrackingcapabilities. G 11notificationofviolatingdrivers. 9 dvancedandreal-timereportingof A tamperandcircumventionattempts. oiceandvideocapabilities. V

>>Our company serves the breath alcohol ignitioninterlock(BAIID)market,morespecificallythosedriverswhohavebeenmandated eitherbycourtoradministrativedirectiveto installsuchadeviceintheirvehicletoprevent themfromstartingandoperatingtheirvehicleswhileundertheinfluenceofalcohol. TheIntoxalockAdvancedfunctionsasafulltime and real-time monitor of the vehicle and driver. It includes GPS tracking, realtime or near real-time reporting, advanced anti-circumvention and tampering features, photo imaging and 911- response. Our goal was to develop a product that took BAIID technology to a new level. We have successfully done so and are now deploying the productinthemarketplace. Our engineers researched various combination radio and GPS modules and evaluated each thoroughly. We chosetheTelitmodulebecauseofcost

Intoxalock

Your Ultimate Intelligence Hub of the Global M2M Market

THE INTERNET OF THINGS WILL SHAPE TOMORROWS SOCIETY. M2M APPS IS A UNIQUE PLATFORM TO FIND THE BEST-FIT SOLUTION FOR EVERY BUSINESS PRACTICE.
Find and qualify companies, products and solutions Present M2M offerings for free, reach out potential partners and clients Evaluate the core technological and business trends Engage in global panels and discussions around key M2M topics

SEARCH M2M SOLUTIONS AND REGISTER NOW FOR FREE!

www.m2mapps.com

72

security

TELITworLd

TELIT2MARKET 06|11

we appreciate the high level of performance of the telit modules.

Jaroslav Hrabalek, Engineer, R&D department

>> JABLOTRONALARMSa.s.isamanufacturer of intruder alarm systems, mainly wireless, which combine security, automation and communication solutions. The company has beenbringingnewsolutions(e.g.cameraPIR withflash)tothesecuritymarketfor 20 years. Jablotrons main product lines are wireless alarmsystems,homeautomation,GSM/GPRS caralarmsincludingtracing,babyrespiration monitors,andGSMcameras. The JA-82Y GSM Communicator ThecapabilitiesoftheOASiSsecuritysystem can be extended by the optional JA-82Y GSM communicator. GSM communication improves the security of the data transfer from the control panel compared to a PSTNconnection.TheJA-82Ycommunicator allowsremoteaccessviaGSMandtheInternet.Alarmeventscanbereportedtoupto8 telephonenumbersviaSMSorvoicemessages andtoupto2ARCs.Forvoicereportingupto

7messagescanberecordedforthedifferent events. The JA-82Y has a built-in module to receivepicturesfromtheJA-84PcameraPIR detector,whichcanthenbetransferredtoa secure server and optionally to a mobile phone. The communicator also enables systemprogrammingandoperationviaphone either by call-in using the communicator's voice menu or via SMS commands. The system(orhomeappliances)mayalsoberemote controlled from authorized numbers forfree.Themostconvenientremoteaccess via Internet is offered free of charge by the Olink software (ver.2.0 and higher) which providesoperationandfullprogramcontrol in a user friendly environment from your Internetconnectedcomputer.TheOlinksoftware also enables communicator firmware uploads. Jablotron had used different modules for its communicators, but was not satisfied with theirperformance,so for the new model producttheTelitmodulewasselected.What we also appreciate in the Telit module is thefour-bandfeature, which allows us to also use the communicator in the United States,whichisabig help for us. We use Telit because we it met our mechanical requirements (with the BGA package) as there is neither need forconnectorsnorthe needforspecialshoulderingtechnology.We also appreciate the service and technical support provided by Telit.<<

FAcTS
Jablotron alarms a.s.
www.jablotron.com system
JA-82YGSMcommunicator forsecuritysystems

which telit module do you use and why?

WeusetheGE864-QUADV2module.The mainreasonforitsselectionwastheprice andbetterperformanceofthemodulein comparisontoitscompetition.

features
NewgenerationCommunicator atacommunicationviaIP D communication,SMSorvoice oicemessagetoamobilephone V emoteaccessviaOLinksoftware R eportseventsupto2ARC(CID R protocol) oicemenu V

JA-82Y GSM communicator

TELIT2MARKET 06|11

security

TELITworLd

73

we are satisfied and proud of having telit in our products.

Mariane G. Peres, Marketing Director

FAcTS
PPa - Portas e Portes automticos
www.ppa.com.br system
Infinit:AlarmpanelwithGPRScommunication

which telit module do you use and why?

TheGE865-QUADforitshighquality standard. >>PPA is a genuinely Brazilian company that has been in the market since 1983. It was the firstcompanytoproducegateopenersinBrazil but as years went by, PPA, with its innovative philosophy, started entering the electronic securitymarket,producingalarmsystems. PPAiscurrentlytheleadingcompanyinboth gate openers and monitored alarm system segments,aswellasintheareaofdigitalalarm communicators and transmitters. The main functionofthesedevicesistoeliminatesecurity failures in the communication between theuser(alarm)andthemonitoringcenter. Communication between clients and alarm monitoringcenters,whichhadbeenpreviously accomplished through landline connections, isnowlargelydonewiththeuseofGSMand GPRS technology. That is where the Telit modules have an essential role, since the stability and reliability of PPA communicationsystemsdependonthem. The PPA products using this technology are thedigitalalarmcommunicatorsEllo,Monip andMonicelUSB,whichcanbeintegratedinto alarmsystemsalreadyinmarket,replacingor adding to the existing landline communicationfunctionality.Ourdevicesareconnected to these alarm systems, allowing them to communicatewirelesslyviaGPRStechnology. Infinit is another product developed around the Telit technology; it is an alarm system equipped with all the features of an alarm monitoringcenterandbecauseitisGPRS-data enabled it is possible to send it commands through SMS messages. The product can be remotely programmed with user access control and guard tour patrol parameters while maintaining a high level of integration with thealarmmonitoringcenter. The use of cell phone modules as the communication medium for electronic security is growing more and more. Every day a new use of this versatile means of transmitting andreceivingdataisuncovered.<<

features
6 4programmablezones(16onboard) 2 57userpasswords 3 000eventbuffer 8 partitionsandupto64virtual partitions F ullaccesscontroltoallusers E mbeddedEthernetport E thernet/GPRSremoteprogramming E thernet/GPRSfirmwareupdate U ser-friendly2-zone1-PGMLCDkeypad 1 6guardtourpatrolsystemcheckpoints 3 2PGMs(programmableswitches) S witchingpowersupplyunit O ptionalGSM/SMScommands

74

security
timely help has been available from telits software support team throughout our development of the v2 GsM with support via phone, email and face to face meetings when necessary.
Tris Young, Marketing Manager

TELITworLd

TELIT2MARKET 06|11

>> Celebrating their 25th anniversary this year Pyronix is a leading player within the security industry and is internationally renowned for award winning intruder alarm equipment. Products are designed, manufactured and despatched from two factories in theUnitedKingdom. Continuingintheirphilosophyoflisteningto their worldwide customer base Pyronix has development the V2GSM, which maximizes flexibilityandprovidestheabilitytocontrol thirdpartyequipment. The V2GSM works as a multi-function voice andSMSmessagedialerwithupto14trigger inputs and can be programmed to remotely controlthirdpartyequipmentwithupto54 outputs. TheV2GSMissuppliedinakeypadenclosure that has an on-board speaker, microphone, 6 inputs,4outputsandeasytousemenudriven

programming.OnlyaSIMcardisrequiredfor operation(anynetwork). Control of the outputs and other functions canbemanagedremotelysimplybysending SMS text commands to the V2GSM from a mobilephone: elephonedirectorynumberscanbe T changed healarmsystemstatus(armedor T disarmed)canberequested utputscanbeoperated. O Asecure,voice-drivenremote-controlmenu systemisavailablewhencallingtheV2GSM. Outputs can be turned on and turned off allowingremoteoperationoflights,heating systemsandgates. Inaddition,theonboardspeakerandmicrophonein theV2GSM canbe used asa2-way (full-duplex) speakerphone allowing a remote user to talk and listentotheproperty. Furthermore,theAutomaticNumber-Recognitionfeature allowsanoutputtotriggeras soon as the V2GSM receives a call from a recognized phonenumber.Forinstance; a user can telephone their V2GSM,hangupandthegaragedoorwillopenimmediatelywithoutthepressingof numerousbuttons.<<

FAcTS
Pyronix limited
www.pyronix.com system
V2GSM:V2GSMSpeechDialer

which telit module do you use and why?

PyronixchosetheGE864QUADbasedon features,size&price,withspecialmention giventothefactthatnoexpboard mountingconnectorwasrequired

features

ngineeranduserfriendlymenu-driven E programming oiceandSMSmessagesignaling V ullduplex(voice)communication F pto9telephonenumberdirectory U inputs(expandableto14using 6 1xinputexpander) outputs(expandableto52using 4 3xoutputexpanders) edicatedkeystooperateoutputs D ondemand emotecontroltriggeredoutputs R utomaticresponsecallerIDoutput A control sedasanormaltelephonefor U outgoingcalls MStextcommandstochange S telephonenumberdirectory, totriggeroutputs,etc.

V2GSM

TELIT2MARKET 06|11

telematics
insurance companies, fleets, and parents have no tolerance for drained batteries, professional installations, and unnecessary cellular costs. they want superior engineering in a plug-and-play solution.
Mike Carroll, VP Sales Telematics

TELITworLd

75

FAcTS
Danlaw inc
system
OBDIIVehicleDataLogger

www.danlawinc.com

which telit module do you use and why?

>>UBI,PAYD,fleetmanagement,teendriving, anddriverdistractionapplicationscontinueto swellintheUSandEuropeanmarkets.Ifyoure behindthewheel,wehaveyoucovered.With TelitsGSMorCDMAmodulesunderthehood, theDataLoggerprovidesunparalleledflexibilityacrossavarietyofcellularcarriers. Telitsrangeofsolutions,superiortechnology, anddevelopmenttoolsarewellknowninthe industry; but technology is only part of the equation. Their sales team helps with supply chain issues, certifications, and even marketingwiththeintegrityandprofessionalismour jointcustomersrequire. As a Detroit based automotive electronics andembeddedsoftwarecompany,Danlaws 27yearhistoryspecializinginOEMin-vehicle communications allows our business partnersandcustomerstosleepeasy,knowing theyve selected the safest platform on whichtodevelop. Theexpandingmarketsandderivativeapplications for easy to install, inexpensive, full featured,OBDIImodulesaredrivingsignificant growth. We plan on continuing our development, partner support, innovation, and application diversification for years to come.<< GE864-QUAD(GSM) CC864-DUAL(CDMA)

features
Userinstallable Customconfigurations Optimized,highspeeddatauploads FirmwareovertheAir(FOTA) OBDIIparameters 3-axisaccelerometer GPS GSMorCDMA Ruggeddesign Stand-alonesimplicity BroadrangeofOEMsupport Attractivepricepoint Automotive-gradeengineering

OBD II Vehicle DataLogger

76

telematics
telit has been an excellent technology partner for us. telit modules fully meet our requirements with numerous integrated features.
Sergejs Sofjins, Chairman of the Board

TELITworLd

TELIT2MARKET 06|11

>>EcoTelematics has been designing and developing robust telematics products for application in trucks and trailers since its inception. Cost pressures, more stringent controls over drivingtimesandrestperiods,increasingcustomerexpectationsshippingandtransport companies today have to compete in more challenging conditions than ever before. To avoid being left behind by the competition, application of NaviFleet can assists companiesinoptimizingtheirentirefleetandtransport chain, reducing fuel costs and ensuring compliance to regulatory requirements with respecttodriverworkinghours. NaviFleetprovidesrealtimemonitoringfor fleet operations communicating vehicle and driveractivityinformationincludingGPSand GPS/GlonasspositioningthroughaGSM/GPRS network.

ThebasicNaviFleetfeaturesare: eal time tracking (with available event R monitoringintransmission,engine,and sensors) leet Management (distance driven, fuel F control,enginehours,speed,RPM,andetc.) FuelManagement river monitoring (start and end of workD day,stopscontrol,privateactivitytimecontrol,anddigitaltachographinformation) ommunication with driver through C GarminNavigatorandhands-free ehicle diagnostics (fault-code reading, V enginesystemsperformance) railermanagement(temperatureanddoor T control) AutomaticpassengercountingusingIRMA sensors EcoTelematics Group is a customer-oriented company and is fully engaged with its customers in software engineering, applicationdevelopment,andtechnicalsupport. Telit's excellent development support also playedamajorroleinbringingtheseproducts tomarket.<<

FAcTS
ecotelematics Group oy
www.ecotelematics.com system
NaviFleetET100TelematicsDevice

which telit module do you use and why?

WeusetheGE864-QUADAutomotiveV2 module,becauseofitssize,lowpower consumption,performance,and reliabilityindifferentenvironments.

features
eal-timeTracking(time,distance R interval,specialconditions) leetManagement F ruckandDriverActivities T ntegratedCANinterface I achographinterface T PS/Glonass G nterfaces:CAN,RS485,USB,2xRS232, I 2xanaloginputs,8xinputs,and 4xoutputs Monitoringandcontrolofperipheral devices Two-waycommunicationwithdriver Temperaturecontrol Over-the-airupgradable RobustandWaterproofhousing ContactlessCANconnector

NaviFleetTM ET100

TELIT2MARKET 06|11

telematics
telit provided the right solution with the Ze61 100mw ZigBee modules and the powerful GG863-sr gateway bridging to GsM/GPrs.
Alexander Ivaine, CEO & Founder

TELITworLd

77

>> IGL-Technologies is a Finnish company specializedinwirelesssolutionsandend-user short-range network access products. For markets with harsh winter conditions, the eTolppa.fi system can offer users maximum comfort by providing them the ability to remote-managepre-heatingoftheirvehicles atelectricheatingpoles.Accurateandtimely heatingofthecarultimatelycombinescomfortwithoptimizedenergyconsumptionand cost management, reducing the ecological loadaswellaswearontheengine. Inanotherapplication,notnecessarilyforsub freezing environments, the control system can also be adapted to charging stations for electricvehiclessuchasscooters.Inasub-meteringapplication,itcanalsobeconfiguredto remotelymeasureandcontrolmanydifferent appliances. The eTolppa.fi heating-pole system can be operatedviaInternetormobilephones.Its modular structure even allows it to be

FAcTS
iGl-technologies oy
www.igl.fi system
eTolppa.fi

which telit module do you use and why?

The GG863-SRapowerfulgatewaythat managesquitecomplexapplications providingseamlesscommunication totheZE61-2.4/SMDbasedsatellites

installed as a retrofit into existing heating polesalreadyinuse. Ateachpole,thesystemexchangesdatawith the server including time-slots of operation, online modifications to the time-slots, controls for the charging/heating station, readings of electricity consumption, and other information requested by the server, all via the multiple ZigBee ZE61 100mWTelitradiomodulesconfigured in Mesh/Router/end-point throughtotheTelitGG863-SRGateway GSM/GPRS-ZigBeeall-in-onesolution. The system works on any ordinary webbrowser. It has a very simple user interface from where it is possible to set heating/ charging times, monitor consumption of electricity,andalsocollectvariouspieces ofstatisticaldata.<<

features

irelesscommunicationto W heating/chargingstations erver-sideplatformwhich S bringsshort-rangemodules totheweb-browser cologicalsolutionswith E heatingpoleintegration

eTolppa.fi

78

telematics
we appreciated telits engineering support integrating the module into the PnD environment both on hardware and software and also for verification of antenna performance.
Thomas Engelhardt, Senior Project Manager, Devices

TELITworLd

TELIT2MARKET 06|11

>> TheNAVIGON70PremiumLiveisprimarily targetedattheconsumermarkethowever,it is also offered as a hardware platform with WindowsCE6.0operatingsystemforbusiness customerssuchasfleetmanagementcompanies or other mobility services requiring an internetconnectionviatheGSMnetwork.The productisbasedonSTMsCartesioPlusprocessor equipped with 128MB of DDR2 RAM and 4GB of internally managed NAND flash. Integratedperipheralscomprisean-SDcard reader,aSiliconLabsSI4703FMtunerforTMC message reception, a 5-inch WQVGA display withresistivetouchscreen,andaCSRBC05MM Bluetoothsystem-on-a-chip(SoC)forhandsfreeoperationandphonebooksyncwithmobilephones.Thestandardversionispowered

Thedevicewasdevelopedasavariantofthe NAVIGON70PNDseriesincooperationwith anAsianODM.Thefirstintegrationattempt of the GPRS module created challenges on powermanagement,EMIandmulti-bandantenna design. It is hard to find Asian ODMs with solid experience in these areas. Here, the hardware design, antenna performance verification,aswellassoftwaresupportfrom Telithelpedagreatdealtomakethedevelopment run reasonably smoothly, getting to a stable, well performing product and still meeting time-to-market targets. The small footprint and low height of the module substantially helped keeping the product dimensionsveryattractive.

FAcTS
naviGon aG
system
NAVIGON70PremiumLive

www.navigon.com

which telit module do you use and why?

TheGE865-QUAD.Weutilizeclass-8data transferinthe900,1800,and1900MHz bands.Weselectedthemoduleduetoits pricecompetitivenessandsmallsize.

features

N AVIGONLiveServicesPro A ctiveLaneAssistant P rofessionalVoiceCommand2.0 B luetoothhands-freekit2.0 C ityView3D2.0 R ealityViewbyNAVIGON M yBestPOI P OIImportandPOIClick T ext-to-speechandspokenTMC N AVIGONLastMile

via the 10-pin Mini-USB socket which also includesa3.3VUARTdataconnection.Avariantcanbedevelopedwithanintegratedelectrical automotive interface that connects power, two UARTs, audio, and TMC antenna signalthroughaNAVIGONautomotive-grade car holder to external peripherals and the vehicle.

Such connected personal navigation devices, as they are known, are expected to gain more and more market share as customers continue getting increasing, concrete value aggregation through realtime services such as Clever Parking Live, TrafficLiveorGoogleLocalSearch.<<

NAVIGON 70 Premium Live

TELIT2MARKET 06|11

telematics
thanks to telits modules, semaConnect is able to advance in creating wireless networked electric charging stations for the new generation of electric and plug-in hybrid vehicles.
Naly Yang, Marketing Specialist

TELITworLd

79

FAcTS
semaConnect
on charging status through text messages, find a charging station, andmore. Station owners can log into a web portal to comprehensively monitor and control station operations.Flexiblenavigation features allowing review of revenue generation, running sustainability reports, tracking energy usage, and billing end-customersforusageonlybrieflydescribethearray ofcapabilitiesthatstationownershaveattheir disposal. Customers who already have stations are increasinglysatisfiedwiththeproductandthe amount of positive feedback received from theirlocalcommunities.Currentdeployments areongoingintheUnitedStateswithinternationaldeploymentplanscomingin2011-2012. For more information, visit www.semaconnect.com and follow us on Twitter @Sema_ Connect.<<

www.semaconnect.com system
ChargeProChargingStation

which telit module do you use and why?

TheCC864-DUALandGC864-QUADV2 allowustoupdatesoftware,configurethe station,performaccountauthentication, andmonitorthestationremotely.

>> SemaConnectisaleaderindevelopingand producingwirelessnetworkedelectriccharging stations along with management and driver software for the new generation of electric vehiclessuchastheChevyVoltandtheNissan Leaf.Foundedin2008andbasedinAnnapolis, Maryland, we are the only company of this calibertobelocatedontheeastcoast. Our advanced charging stations are ideally suitedforcommercialchargingapplications. Municipalities,fleetcompanies,hotels,parking garages and multi-family buildings will find them most useful. We offer a complete turnkeysolutionfordeployingtheChargePro ChargingStation:installation,operation,and maintenanceservices. To use the system, simply wave a ChargePro smartcardatthestationsfrontpanel.Through the integrated Telit module, the charging station wirelessly authenticates your informationandallowsyoutochargeyourelectric vehicle (EV). The SemaConnect back-office softwareaggregatesallinformationcollected throughtheuseoftheChargeProsmartcard allowingtheEVdrivertologintoaweb-based tool to monitor electricity usage, pay bills online, request to receive push notifications

features

irelessNetworkedElectricCharging W rightLEDlightsforeasyrecognition B emotemonitoring,maintenanceand R upgrades martgridintegration S martcard S authentication eb-basednetwork W management& driversoftware utomated A paymentsystem nergymetering E
chargePro carging Station

80

telematics

TELITworLd

TELIT2MARKET 06|11

"telit understands the market needs: multiple standards one form factor; newest technologies; long term avail-ability; excellent performance; best pricing; and comprehensive technical, logistics and commercial support. this convinced us to develop competitive products for the future based on telit module family.
Guido Voigt, CTO Falcom Wireless Communication GmbH

WIRELESS COMMUNICATIONS GMBH

system: ROCK(ASSETTracking)
>>German-basedFalcomWirelessCommunications,theleadingsupplierofwirelessm2m solutionshasjustintroducedtheROCK,aninnovative, adaptable and standalone tracking device that can be used for both mobile and fixed asset management. The device concept combines the latest quad-band GSM/GPRS technology (Telit GE865) for communication, ahigh-sensitivityGPSreceiverforpositioning, awaterproofcompactcase,anddurableinternalbatterypackforlong-lifeoperationeliminatingtheneedforanexternalpowersource. This is an ideal solution for managing and tracking containers, trailers and high-value assetswherenopowersourceispresent.Many features of the device and the new firmware can be downloaded over-the-air helping you manageyourmobileandfixedassets,provide better customer service, reduce costs and increaseprofits.Anenergyharvestingversion iscurrentlyunderdevelopmentanditwillbe available4Q2011.<<

FAcTS
falcom wireless Communications Gmbh
www.falcom.de which telit module do you use and why?
WeusetheGE864-QUADandGE865-QUAD becauseoftheirverycompactform factors,BGAmounting,reliableGSM/GPRS protocolstackforvoice,SMS,CSDand GPRScommunication,andexcellent cost-to-benefit.

ROcK

features
tate-of-the-artGSM/GPRScore(Telit S GE865)fortwo-waycommunication igh-sensitivityGPSreceiverfor H positioning tand-alonetrackingdeviceneeding S noexternalpowersupply xLR20internalbatterypackfor 5 long-lifeoperation Very-efficientpowersavingmodes HighlydurableIP69waterproofcase mbeddedTCP/IPstackforclient-server E application rovidesexactreportsabout P currentassetlocation inimalmaintenance M Easyinstallation emoteactivation,configuration R andadministration Over-the-airfirmwareupdate ustomizedreportsand C sendingintervals

TELIT2MARKET 06|11

TELITworLd system:FOX-LT-IP-GLONASSthefirstdual
mode(GPS+Glonass)telematicsolution >>Falcomiscurrentlyprovidingseveralkinds of GPS and telematics products responding tomarket demands. The company recently launchedanewvehicletrackingsystem;aspecialversionoftheFalcomAVLdeviceportfolio combining GPS and GLONASS positioning systems with a higher level of reliability for complete telematics functionality. Using quad-bandGSM/GPRStechnology(TelitGE864) for two-way communication, high-capacity Li-Polymerbackup-battery,andhousedina weatherproof plastic case, the device is suitableforawiderangeofmixedindoor/outdoor applications in the AVL, fleet management, asset tracking, vehicle security and recovery, andtransitsegments.ThedevicehasanIP69K protectionclass,whichallowsittobepermanentlymountedontheroofofavehicle,truck, train,vessel,orotherassets.<<

81

features
State-of-the-artGSM/GPRScore(Telit GE864)fortwo-waycommunication ombinedGPS/GLONASSreceiversfor C precisepositioning EmbeddedTCP/IPstackforclient-server application Voice,SMS,Data,GPRS,TCP/IP/UDP/ HTTP/SMTP igh-capacityLi-Polymerrechargeable H backup-battery

ighlydurableIP69Kweatherproof H enclosure Very-efficientpowersavingmodes 3Daccelerometerfordetection ofassetmotion Providesexactreportsaboutcurrentasset location Remoteactivation,configurationand administration Localandover-the-airfirmwareupdates ustomizedreportsandsendingintervals C Data-loggerfunctionality

erritoryandtripmanagement T withrouteverificationanddistance calculation

FOX-LT-IPGLONASS

system: MAMBO PersonalTracker

>> Falcom introduces the new MAMBO, an advancedpersonaltrackerconceptcombining a quad-band GSM/GPRS phone, a high-sensitivityGPSreceiver,GSMandGPSantennas,a three-axis motion sensor, full-color OLED display (128 x 128 px), a five-way navigation button and a 1300mAh Li-Polymer battery intoacompact(97 x 48 x 23 mm)enclosure.At firstglance,MAMBOlookslikeaconventional mobile phone. It incorporates a number of functions designed specifically for use by logistics providers, cab companies, security andfireservices,police,technicalemergency serviceproviders,andmanyothers.MAMBO canbeusedasacellphonewiththefullcomplementofstandardfeaturesincludingvoice callsandSMS,allthroughsimplemenu-guided operation.Thissmallrobustdevicecanbecarriedalonginapocketoraffixedtoavehicles interior.Itisatruemobileall-rounderbothfor commercial and private users. MAMBO also supportsaseriesoffunctionsforGPSnavigationandtrackingviaSMS,CSDandGPRS/TCP.

MAMBO

This all-rounders true strength lies in themultitudeofitsconfiguration options: rolling GPS display, geo-fencingcapabilitywith alarm, and an ultra-precise mo-vement detector are just some of the MAMBOscorefunctions. MAMBOcanintegrateup to five communication options including GSM and TCP, system-wide IEEE 802.15.4forcommunication withakeyfob,Bluetoothfor hands free communication, ANT for heart-rate monitoring and ISM for short range applications.Thisfirst-of-its-kind solutionwithsophisticatedsoftware offers system integrators and developers the abilitytodeveloptheirowncostefficientand flexiblesolutions.<<

features
igh-sensitivityGPSreceiver H ommunicationvia C quad-bandGSM/GPRS oice,SMS,Data,GPRS, V TCP/IP ull-colorOLEDdisplay F emoteadministration& R firmwareupdate nlinetracking,history, O geofencing ullycustomizable F utonomousoperation A ersonalsecurityand P recovery Deadman"motion " detection Options:harshenvironment protection,Bluetooth,IEEE 802.15.4,ANT,MicroSD-CardReader, ISMshortrangetransceiver(868/433MHz), andRFID

82

telemetry

TELITworLd

TELIT2MARKET 06|11

the extensive on-site Quality audit of telit facilities paved the way for a strong partnership with Grundfos.
Mads Kring, Telit Regional Sales Manager, Key Account Manager for Grundfos

>> Grundfos Communication Interface Modules(CIM)andCommunicationInterfaceUnits (CIU) enable data communication via open and interoperable networks for complete control of water supply, waste water pumps, andpumpsystems.TheCIM 250isastandard interface module for remote wireless data transmission via GSM/GPRS networks. The GSM/GPRSmodulecanfunctionasaSCADAinterface enabling a SCADA system or other PLC controller to establish a remote connectioneitherviaGSMcall-upusingtheModbus RTU protocol or via a GPRS connection using thesystemsModbusTCPprotocolsupport. The simple SMS interface enables users to controlandmonitorGrundfospumpsfroma mobile phone. The system makes it possible foraprogrammednumbertoreceivemessages whenever a warning or an alarm condition occurswhilealsoallowingtheusertorequest statusorexecutesimplecontrolfunctions such as start, stop, and setpointadjusting.

FAcTS
Grundfos a/s
system
CIM/CIU250GSM/GPRSCommunication Interface

www.grundfos.com

which telit module do you use and why?

TheCIM/CIO 250GSM/GPRSCommunication modulecomplementstheextensiverangeof industrial (wired) communications modules which interface the millions of Grundfos pumps installed each year. Thanks to strong R&D team efforts by Grundfos and Telit, the CIM 250 carries all major mobile GSM/GPRS network approvals, thus aggregating uncomplicated wireless data transmission and remote control capabilities for Grundfos pump systems across theglobalmarketplace. Last year several thousand Grundfos pumps worldwidewereconnectedallowing monitoring of data points to optimize performance, yield, and maintenance service intervals. And since demand for reliable water supply and efficient disposal of wastewaterwillonlyincreaseinthefuturetheoutlookforwirelessly connected pump systems is verybright. All Grundfos CIM/CIU communication interfaces offer easeofinstallationandprovisioningareuser-friendlyanda great value for money in the longterm.<< Globalapprovals,robustBGAmounting technologyandlongcontinuityofsupply werekeyfactorsintheselectionofTelit GE864-QUADGSM/GPRSmodule.

features

cIM250 with cu361

W irelessDataTransmissionandRemote ControlofGrundfosPumpSystems: lobalapprovals,QUAD-band850, 900, G 1800,and 1900 MHzGSM/GPRSAdd-on (built-in)andexternalversion(DIN-rail) impleconfigurationviaSMS S commands 24-240VAC/VDCpowersupplyinCIU irelessremotecontrolandmonitoring W tatusrequestandcontrolviaSMS S SMcallup&TCPoverGPRSconnection G ptionalbuilt-inbatterybackup O

cIM 250

ALPhA 2

TELIT2MARKET 06|11

tracking

TELITworLd

83

telits leading technology enabled us to create the smallest tracking device of its kind.
Frank Heineck, Director

>> Telicsfocusisthedevelopment,production and sales of flexible telemetry and telematics productswiththeMadeinGermanyquality standard. The first generation Picotrack was alreadythesmallesttrackingdeviceofitskind. The new generation Picotrack is even smaller enabling use in a greater number of business models.AlthoughthenewPicotrackisassmall asamatchbox,itispackedwithhighendfunctionality such as a complete set of telematics softwarefunctionswhichcanbeeasilyconfiguredovertheairorviatheTelicconfiguration tool.Becauseofanewlow-powerarchitecture, Telic customers can apply it to asset tracking projectssuchastrackingofvaluablegoods.The PicotrackPowervariantincorporatesastacked LiPo (Lithium-Polymer) battery with double thecapacitytofulfilleventhelongestbatteryliferequirementsinthissegment. The Picotrack hardware platform is ideal for container and trailer installations. In combinationwithsolarpanels,thePicotrackcanbe used for years of maintenance free tracking tasks.

The configurable motion sensor and alarm buttoncombinedwithitssmallsizeallowfor useinnearlyallsecurityapplications.Thelarge GPS-patch antenna ensures high accuracy of location information, even under bad reception conditions as for example, inside a home. Unlike other leading tracking service providers in Europe, Tracker.com offers the Picotracktogetherwithitstelematicsservices which, through a unique and free-of-charge iPhoneApp,canprovideendcustomerswith constantaccesstopositioninformation,availablealsotofamilymembersandfriendsatthe discretionofthecustomer. Tracker.com offers the Picotrack together withtrackingservicesforlocatingathletesin outdoor activities, children, the elderly, and impaired individuals requiring care. Picotrack helps increase personal safety for these individualsbykeepingthecareproviderconstantly informed of their whereabouts. Athletes can use Picotrack to chart their training and competitionroutesonline,keepingthemselves constantly updated on distance covered and average speed. Personal trainers and coaches can easily view the training modules completed by their athletes online. Pets can also betrackedwiththePicotrack.<<

FAcTS
telic Gmbh
www.telic.de system
PicotrackGSM/GPS-tracker,newgeneration

which telit module do you use and why?

TheGE865-QUADenabledustocontinue ourtargetstrategytofurtherminiaturize ourGSM/GPS-trackingdevices.Size, reliabilityandlowpowerwerekeydeciding factors.

mallestsizeinall3dimensions S atestGSM/GPStechnologywith L in-housetracking iPobattery(alsoavailableinpower L version) larmbuttonandstatusLEDs A owpowermodeallowsweeksof L operation ntegratedmotionsensorforalarm I andpowersave ulltelematicsfeaturesembedded F onfigurableovertheairorviaRS232 C withconfigtool adeinGermany M iderangeoftrackingservicesavailable W throughTelicspartnerswhohave successfullyintegratedPicotrackinto theirtrackingplatforms

features

Picotrack GSM/GPS-tracker

84

tracking

TELITworLd

TELIT2MARKET 06|11

we appreciate the quality of telits modules which meet our requirements perfectly.
Lider Yasar, Technical Coordinator

>> Fideltus Advanced Technology Venture's disciplined investment strategy focuses on emerging growth businesses across four primaryareasofinterest:communications, infrastructure, software and services, consumer technology, biopharmaceuticals, medicaldevicesandemergingtechnologies. The vast majority of our portfolio companiesarebasedinTurkey.Ourtargetmarkets arecommunications,infrastructure,software & services, emerging technology, consumer technology, biopharmaceuticals, medical devices,andinformationtechnologies.

and efficiently store, protect, and manage yourinformationsothatitcanbemadeaccessible, searchable, shareable, and, ultimately, actionable. You can also use FIDELTUS information infrastructure as the foundation for implementingyourinformationlifecyclemanagementstrategies,securingyourcriticalinformation assets, leveraging your content for competitive advantage, automating your data center operations, reducing power and coolingcosts,andmore. We help a range of customers FIDELTUS works with organizationsaroundtheEMEA,inevery industry,inthepublicandprivate sectors, and of every size. Our customers include banks and other financial services firms, manufacturers, healthcare and life sciences organizations, internet service and telecommunicationsproviders,airlinesandtransportationcompanies,educational institutions, and public-sector agencies. Strong leadership record Our differentiated value comes from our sustained and substantialinvestmentinR&D,ourtechnicalR&Demployeesaroundthe globe, the industry's broadest portfolio of systems, software,andservices, our ability to create total integrated solutions all designed in-house from top to bottom and our commitment to delivering the best total customerexperienceinthisorany industry.<<

FAcTS
fideltus ileri teknoloji a.s.
www.fideltus.com www.pergo.com.tr system
PERGO

which telit module do you use and why?

GE865-QUADandGL865-DUAL becauseoftheirsmallsizeandthe goodperformance.

features
Pergoisatrackingandsecuritysystem withsoftwareandhardwaredevelopedby Turkishengineers.Vehicles,persons,goods, andanimalscanbetrackedanywherewith astrongsetoffeaturesfordetermining theirlocationandprovidingcommunicationtothecontrolcenter. ThepowerofPergostemsfrom: nstantlocationinformationand I reportingfortrackedobjectsand individuals; ncreasedperformancewithlowered I costsintheactivitiesoftheworkforce; Preventionofabuseinvehicleusage; ncreasedsafetyandsecurityforpeople I andassets.

FIDELTUSprovidesthetechnologiesandtools that can help you release the power of your information. We can help you design, build, and manage flexible, scalable, and secure information infrastructures. And with these infrastructures,you'llbeabletointelligently

PERGO

TELIT2MARKET 06|11

Tracking
GTM Tecnologa has nearly a decade of experience in smart recovery tracking and is always looking to be at the forefront of technology and maintaining our customers full satisfaction.
Israel Negrete, CTO

TELITworLd

85

>> GTM Tecnologa is dedicated to the communication, location, and satellite tracking of commercial vehicles. Services based on tracking technology are a growing market and that is why GMT created a new division called Star911 (Smart Tracking for Automatic Recovery), dedicated to research, design and manufacture of satellite global positioning systems. Star911 was created to help companies in Mexico manage, locate, track and recover their assets utilizing GPS tracking systems. Our application provides useful information to assist with fleet management and monitoring as well as route management through mobile cellular networks. A couple of years ago the company sought to eliminate the dependence on foreign AVL suppliers; this led GTM to design its own terminal adapted to the needs of the Mexican market and to achieve competitive pricing compared to foreign offerings. Different brands of cellular modules were tested but none achieved the stability that we found in Telit's product families. The development started with the GM862-GPS module

and now the newest version of the application, HOPE1, takes advantage of the benefits offered by both the GE865-QUAD and SE867-AGPS modules. These modules performed above expectations meeting the stringent requirements of customers in the vehicle tracking industry. Key elements of optimization have been achieved in the GTM product in the areas of electromagnetic radiation, power consumption and integration scale. Our development based on the Telit modules has made possible the introduction of a new device which is entirely reliable and with the great contribution that they allow for a highly optimized manufacturing process. Together and in cooperation with Telit, GTM is able to provide reliable competitive products that serve as a base for different applications, making m2m accessible for different application areas. At this time there are three segments GTM is focusing on: security products, industrial telemetry and vehicle tracking. But the broader market in Mexico is ripe for receiving a versatile new device with competitive pricing. <<

FACTS
GTM Tecnologa S.A. de C.V.
www.star911.com.mx System
Star911 Model HOPE1, AVL platform

Which Telit module do you use and why?

The GE865-QUAD for absence of connectors; the SE867-AGPS for its high sensitivity; and both for the ultra-compact design and extended temperature range characteristics.

SM/GPRS Quad-band 850, 900, G 1800, and 1900 MHz oice, data and SMS services V CP/IP data protocol T PS high sensitivity G GS-84 system reference W ccuracy position 1-5m, speed 0.05 m/s A -axis motion sensors 3 nternal flash memory for at least I 2000 positions nternal antennas I wo digital inputs T ne digital output O 1200 mAh internal battery 30 A sleep mode 40 to + 85C temperature range to 40v supply voltage range 7
Star911 Model HOPE1

Features

86

tracking
we selected the Ge865-QuaD because of its small form factor, low power consumption, quad-band range, and suitability for the harsh automotive environment.
Guy Chevrette, CEO

TELITworLd

TELIT2MARKET 06|11

FAcTS
basedinsurance,stolen vehicle tracking and fleetmanagement. The iMETRIK-collect is the companys principal offering to subprime lenders and BHPH car dealers in the US and Canadian auto finance markets. Byembeddingthedevice in the borrowers vehicles, a lender can prompt them for car payments when they miss due dates, disable thestarterifdelinquencyescalates,andtrack the collateral with the GPS if repossession of thevehicleisrequired.TheunitfeaturesaninternalGSMantenna,anexteriorGPSantenna, accelerometerfortamperalerts,andaninternalbackupbatterythatlastsuptofourdaysin theeventmainpowerisdisconnected. A key requirement for lenders is a very discreet tracking device that can be hidden in the vehicle to reduce the temptation of removal or tampering by the borrower. The extremely compact device design (3.37 x 2.37 x 0.87) required a small module like the GE865-QUAD. Its optimized power consumption and extended temperature range roundedouttherequirementsfromtheideal modulefortheiMETRIK-collect.<<

iMetrik automotive
www.imetrik.com system
iMETRIK-collect,loanscollection&asset recovery

which telit module do you use and why?

WeusetheGE865-QUADbecauseofits smallformfactor,lowpowerconsumption, quad-bandrange,andsuitabilityforthe harshautomotiveenvironment

>> Canada-basediMETRIKisawirelesssolutionproviderforthem2mmarket,andclaims to be first to provide all three essential elementsofanywirelessm2msolutionthe device, network access and applications, to monitorandcontrolfixedandmobileassets globally. The companys products serve the needs of auto finance companies, buy-herepay-here(BHPH)cardealers,insurancecompanies, car retailers, and fleet operators. The companys complete product offering includespaymentprotectiondevices,usage-

features

ompactsizeandencapsulated C designforfastanddiscrete installationInstallsinlessthan 15minutes esignedfortheharshautomotive D environment iMHhigh-temperatureintegrated N back-upbattery ensordetectorfortamperalerts S ltra-lowpowerconsumptionwith U lessthana4mAdraw ermanentlysoldered,heat-resistant P siliconSIMChipforglobalconnectivity mergencyby-passcode E

iMETRIK-collect

TELIT2MARKET 06|11

tracking
telits effective cost, local production and technical support, good documentation and useful sDk were definitely the key features for our successful product design.
Rogrio Camargo, CEO

TELITworLd

87

>> Integratingsophisticatedtechnology,OrbiSatmakesavailabletothemarketareliable, easytoinstallandlowcostGPS+GPRSvehicle trackingsystem.Itisaperfectchoiceforinsurers,carriersandcardealers.Fleetmanagement, vehiclerecovery,andmonitoringofcarroutes aresomeofitsmainpossibleapplications. The OrbiSats Vehicle Tracking System combinesallthetechnicalknowledgeofOrbiSats engineering teams from the development of telecommunication equipment, to radar systems, to expertise in development and production of high volume consumer electronicsdevices. The main challenge in the development of this system was finding the perfect balance betweenqualityandpricetoaddresstheBrazilianafter-marketautomotiverequirements. Investinginareliablehardwaredesign,findingstrongsupplierssuchasTelitwerethefirst stepsandwiththesechoicesmade,securinga soundcombinationofmoduleswastofollow. Redundantinternalsystems,realtimekernel, a strong watch-dog function, ESD and EMI protection,allSMTboardassembly,intensive testingcycles,andcompliancetogovernment

regulationsandcertificationswereallpartof thisproject. Consideringthattherearealreadyanumber ofcompaniesinthemarketsupplyingvehicle tracking services, and many with their own trackingsoftware,OrbiSatmovedtooffer,at nocharge,asoftwarelayercalledCollector, whichcanbeeasilyintegratedintoproducts already available in the market, allowing securitycompaniestoworkwiththeOrbiSats tracking device in a seamless way. The communicationprotocoldevelopedbyOrbiSatis compactandlight. Anotherfeature weintroducedistheconfzero,allowingtheOrbiSatstrackingdevice to be configured at activation time, once it is installed in the car. Using configuration parameters pre defined in the control software of the service provider, this informationistransmittedoverGPRStothedevice, preventing issues such as misconfiguration and other errors or mistakes that can cause thesystemtomisbehaveorperformpoorly. The GA-2010 Vehicle Tracking System is the new security product offered by OrbiSat to themarketinanapproach allowing either small or large vehicles location and tracking companies to have their needs addressedbyareliable,accurate, economic, and professional-gradedevice.<<

FAcTS
orbisat da amaznia s.a.
www.orbisat.com.br system
GPSVehicleTrackerOrbiSatGA-2010

which telit module do you use and why?

TheGE864-QUADAutomotive.Local supportandmanufacturing,costeffective, easytoprogramandscalabilitywerethe mainfeaturesconsidered.

features

eliable R asytoinstall E owcostGPS+GPRSvehicletracking L system llSMTassembly A llopticallyisolatedinputsandoutputs A MIandESDprotected E PSandGSMInternalantennas G ompliantwithBraziliangovernment C regulationsfortelecommunications equipment(ANATEL)

OrbiSat GA-2010

88

vehicle asset Management

telit supports reDtails strategic direction and has enabled us to roll out a comprehensive and competitive hardware platform.
Dr. Colin Smithers, Managing Director and CEO

TELITworLd

TELIT2MARKET 06|11

FAcTS
reDtail telematics Corporation
system
VAMisaglobalautomotiveGPStracking platform.

quicklynavigatethrough the PTCRB and AT&T approvalprocesses. TheREDTAILTelematics VAM is a best-in-class GPS hardware solution with an advanced feature set designed to exceed market demands. Its features were identifiedbyleadingindustry professionals in multiple markets within the telematicsindustry. >> REDTAIL Telematics is a global hardware manufactureranddistributorofGPStracking solutionsforfleetmanagement.Ourproducts are designed and developed by an experiencedengineeringteam,globallyrecognized aspremierleadersinwirelesstechnology.The sameengineeringdesignteamhasdelivered morethan5milliontrackingdevicestomarketsworldwide. TheVAM(VehicleAssetManagement)features abinaryprotocolavailableinTCP/IPandUDP overGPRSandSMS.Itissupportedbyacomprehensive software development kit (SDK), haslowoverheadforefficientdatacommunication, and is future-proof with a full overthe-air(OTA)firmwareupgradecapability. TheproductisbasedontheGE865-QUADmodule,whichcontinuestoshowoutstandingreliability.Portingthefirmwarefromaprevious Telitmodulewasextremelyeasy,savingREDTAIL Telematics valuable development time. The Telit support team also prepared us to Ourcompanyoffershigh quality,lowcosthardwareproductsdirectlyto GPS vehicle tracking providers. The evolution of the REDTAIL Telematics roadmap happens inlockstepwithcustomerdemandandacceleratedjointdevelopmenteffortswithourcustomersarealwaysconsiderediftoachieveoptimalwin-winsolutions. REDTAILTelematicsbringsfull-featuredfleet management solutions to market based on themostdesiredfeaturesfromfleetmanagers. Our feature suite focuses on driver behavior,dashboards,enhancedmapping,vehiclemonitoringandmore.Weexpect2011to be a very exciting year with more and more companies developing their own solution or looking to partner with a company having proventrackrecordinthemarketplace. Visitoursiteatwww.redtailtelematics.com/VAM to learn moreaboutourproducts andservicesortorequest freedemounits.<<

www.redtailtelematics.com

which telit module do you use and why?

TheGE865-QUADiscompetitivelypriced, fullfeaturedwithasmallfootprintand hasbeeninlargescaleproduction providingastable,globalplatform.

features

T rackandlocate S mallform-factor O ver-the-airupdates Journeybuffering G PSjamming/tamperprotection V ehiclestatusenginedetection M otionsensor(3-axisaccelerometer) I nternalGSM/GPSantenna (externaloptional) omprehensivesoftware C developmentkit(SDK)

TELIT2MARKET 06|11

tracking
the invaluable partnership with telit has provided us with excellent opportunities for further development and strong market position.
Andrey Bondarenko, CEO

TELITworLd

89

It is based on state-of-the-industry technologies and helps optimize transportation processes,controllocationandfuelconsumption, prevent non-authorized vehicle usage, while also improving safety for both driver and transport. TechnoKomhascausedagreatdealofimpact innavigationdevelopmentsofarandwillcontinueworkingtoleverageitsrelationshipwith Telit. In2010TechnoKomintroducedanewproductlinetheAutoGRAPH-Mobileforpersonal monitoring. The core of this compact, stylish and durable device is comprised of a high-throughput ARM processor, a sensitive GPS-receiver,andtheexceptionalTelitGE865QUADGSM-modem. The field of application is wide: for on-duty employee tracking on large enterprise campuses,asanelderlyandchildcontroldevice with an alarm button and 2-way voice-connectioncapabilityoverGSM,forautonomous assettracking,andasadeviceforavarietyof securityneeds.Itsbuilt-indataloggerrecords upto270,000track-pointsandevents.Setan AutoGRAPH geofence function and you can be alerted when your children arrive at or leaveschool,orwhentheygetintodangerous areas. Geofencing is also an invaluable tool for employers to control staff movements monitoring effectiveness of the workforce whiletheyareonpayrollclock.<<
AutoGRAPh-GSM+

FAcTS
technokom ltd.
www.tk-chel.ru system
AutoGRAPH-GSM+/Mobile: AVLandPersonalTracking

which telit module do you use and why?

TechnoKomselectedTelitsGE864-QUAD andGE865-QUADbecauseoftheirhigh leveloffunctionality,durability,excellent performance,goodtechnicalsupport, andpricing.

>> TechnoKom is a company focused on research,design,development,andproduction ofelectronicdevicesforvariousapplications. Withover17yearsofexperience,itiscurrently one of the leading vehicle tracking device and software manufacturers in Russia. The TechnoKom dealer network covers over 95% oftheregionsinRussiawithanumberofrepresentativesabroad. TheAutoGRAPH-GSM+(GPS/GLONASS)was designedtoprovideaprofessional-grade,safe andflexiblevehicletrackingsolutionforawide range of customers with different needs and applicationopportunities. TheproductisequippedwiththeTelitGE864QUADmodulewhichisaperfectplatformfor medium-to-high-volume m2m devices and applications. Automatic vehicle location is a powerful conceptwhenmanagingfleetsofvehicles such as service, emergency, public (buses and trains) and personal transport, water and rail transport, agriculturalandbuildingmachinery, aviation, etc. The AutoGRAPH-GSM+ can also be used to track mobile assets,suchasnon-wheeledconstructionequipment,non-motorizedtrailers, and mobile power generators.

GPS/GLONASS/GPRS eal-timevehicletrackingand R monitoring lerting,collectionandreporting A oflocalexternalevents Internaldataloggerwith270,000records EasyconfigurationviaSMS/GPRS/USB ull2-wayvoiceandtext-messaging F communicationinterface AN(SAEJ1939/FMS)/RS-485/1-Wire C interfaces rogrammableanaloganddigitalinputs P uelconsumptionandfueltanklevel F monitoring onitoringandcontrolofauxiliary M vehicleequipmentandsensors ERA-GLONASSready

features

90

tracking

TELITworLd

TELIT2MARKET 06|11

we appreciated telits technical support which significantly reduced our product development time.
Mark Hu, Vice President

FAcTS
wonde Proud technology
www.wondeproud.com system
Devicename:M7(GPSPortableMagnetic Tracker).TheM7isaportableGPSTracking devicecompactinsize,easilymounted(or hidden)throughmagneticinstallationto anymetalpartofavehicle.Withsuperior GPSandGSM/GPRSmodulesonboard, ultra-lowstandbypowerconsumption, andIP67-ratedwaterproofenclosurefor outdoorenvironmenttheM7represents thebestchoiceforyourGPSvehicle trackingapplicationforitsreliability, convenience,andflexibility.

>> Wonde Proud Technology specializes in designing the most advanced, integrated, and user-friendly GPS devices. Our products have been widely used in commercial andmilitarymarkets,wherereliabilityand stability are top concerns. Over the past years, we have registered a number of patents and intellectual property disclosures givingusacompetitiveedgeinthisvigorous market.

ratedwaterproofcompact-sizeenclosure.This portabletrackingdevicecanbeeasilyattached underanyvehiclethankstoextra-strongmagnets while a tamper-detection switch equippingitactivatessendinganalarmreportshould thedeviceberemovedfromthevehicle. ThankstoTelitshighsensitivityGSM/GPRS modem, the GE864, this portable tracking deviceisabletooperateinanyenvironment especially under poor GSM receptionconditions.Wereceivednotonlyoutstanding hardware but also strong andseamlesstechnicalsupport from Telit during the product development period which significantly reducedourtime-to-market, maintaining our competitiveadvantage. Westronglybelievethatthis portable tracking device will soonbecomeanindustryleaderascustomers begintoreapthebenefitsfromitshighperformance, reliability, and cost-effectiveness as a GPSsolution.<<

which telit module do you use and why?

TheGE864-QUADband,good cost-performancerating

atacommunicationvia D SMS/GPRS/UDP/TCP evicedetachedtamperalert D Motionreport oamingpreferencesetting R owbatterylevelalert L owermanagementsetting P rackingbyvoicecall T nstallationinseconds I pto3yearsofstandbytime U

features

WondeProudteamedupwithTelittodevelop the most advanced portable GPS tracking device featuring ultra-low power consumption, superior GPS/GSM reception, and an IP67-

Consult | Components | Logistics | Support

Semiconductors

Passive Components

Electromechanical Components

Displays & Embedded Boards

Storage Technologies

Wireless Technologies

Lighting Solutions

Photovoltaic Solutions

www.rutronik.com

92

TELITExpErT TaLk

TELIT2MARKET 06|11

Shaping EuropES Digital FuturE

interview with robert Madelin, Director-general for the information Society and Media, European Commission
telit2market: Research for Information Communication Technologies takes up the single largest portion (over 9bn) of the EUs Seventh Framework Programme for Research (2006-2013). What have been the main research achievements in the area of m2m in the past few years? Madelin: More interaction requires innovative architectures, mechanisms, and protocols, all of which increase the number of applications envisioned for m2m communication but also provide the opportunity for the use of resources more efficiently. In particular, great achievements have been accomplished in interoperability. Sensors are able to communicate with more devices on wireless networks and we are aiming to connect some 70 billion machines to wireless networks, whereas only 1% of these are connected today. These achievements will drive the m2m market and will encourage the development of smart systems. t2m: Can you tell us something about current research projects in the m2m space? Madelin: Our current flagship projects in m2m are SENSEI (15 million of EU contribution), EXALTED (7.4 million), and LOLA (2.6 million). SENSEI provides the necessary network and information management services to enable reliable and accurate context information retrieval and interaction with the physical environment. EXALTED works on

TELIT2MARKET 06|11

TELITExpErT TaLk

93

energy efficient means to convey information. Both should enable more accurate interactions with the physical environment and embed m2m communications into the Long Term Evolution (LTE) infrastructure. As for LOLA, the project focuses on access-layer technologies to develop low latency communications for a set of applications ranging from m2m to gaming services. t2m: Equally important to technology is the legislative framework for ICT. What were the most important regulations revolving around m2m? Which important laws are currently being processed? Madelin: Regulation must be as dynamic as ICT innovation. For instance, in 2011, the Commission will review its decision on shortrange devices for the fourth time since 2006 to ensure that spectrum regulation can keep pace with the technology developments in this area. This is a necessary move to ensure that access to the radio spectrum, which is so important for many m2m applications, is guaranteed throughout Europes single internal market. We also need to ensure that industry works to build equipment that can be operated everywhere in the EU. For example in 2006, the Commission set common frequencies for RFID applications. As a result, the global equipment manufacturing sector clearly oriented itself towards European customers and standards developing an RFID transponder that could be operated not only in the EU but also in Asia and the United States. t2m: One goal of your directorate is to promote wider use of technology. Do you have further means to achieve this goal besides regulations? Madelin: The wider use of technology is a key to a smarter way to live and work, so it is indeed one of our main goals. We want to make every European digital. This implies having services and applications that better suit the needs and expectations of users, whether they be citizens or businesses, and that those users feel safe and comfortable with them. That is why in addition to our legislative proposals and regulatory role, the Commission is rolling out and fostering investments in ICT research.

An essential element of the Digital Agenda for Europe is that the strategic use of pre-commercial procurement should help leverage more private investment. We are investing 1 billion of EU funds in six ICT-related publicprivate partnerships which we hope will attract about 2 billion of private spending. By increasing the ICT R&D budget, we will create more opportunities for European knowledge institutions. We will also reduce paperwork to help give young researchers and small and medium-sized companies easier and quicker information and access to EU research funds in the ICT. These are incentives and signals we want to send to the market to help establish European t2m: How do you rate the European m2m market compared to other regions in the world? Where does Europe have a leading position, where does it need to catch up? Madelin: Europe certainly is leading the m2m market. The orientation of m2m deployments towards consumers is a very important factor in this regard. m2m market growth is mainly driven by large corporations and in order to remain globally competitive, these companies must seek creative ways to cut costs and optimize productivity. In addition, new regulations at EU level are needed to seize the colossal opportunity generated by m2m technologies. In this respect, it is worth mentioning the e-call regulation. It requires all new vehicles to be equipped with the m2m technology that will roll out an invehicle emergency call system across the EU. We also have the Directive that encourages the implementation of smart meters for energy distributors. There are many other well-known examples of projects in Europe like Germanys truck road charging system, Londons congestion charging system, and Italys car telematics solutions which allow insurance companies to match their offerings to the way vehicles are actually being used. t2m: One item of the mission of DG INFSO is to represent the European Commission in international dialogue and negotiations with regards to ICT, and to promote international cooperation in ICT research and development. Which international organizations do you

vita

Robert Madelin became DirectorGeneral for the Information Society and Media at the European Commission in April 2010. Born in 1957, a British civil servant since 1979, Robert has served in the Commission since 1993: as Director General for Health and Consumer Policies from 2004 to 2010, as a Director in DG Trade, and in the Cabinet of Sir Leon (now Lord) Brittan, European Commission Vice-President. Madelin was educated in England at the Royal Grammar School, High Wycombe and at Magdalen College, Oxford, where he graduated as Bachelor of Arts (Honours: First Class) in Modern History and Modern languages, 1979. He has also studied at the Ecole Nationale dAdministration in Paris.

cooperate with and what are the main topics in this area? Madelin: We collaborate with the ITU (International Telecommunications Union) when it comes to the availability and use of radio spectrum, numbering resources or international standards. And in addition the ICANN, ISO, IEC, W3C, IETF, UNESCO, WIPO, OSCE and so many others are also very valuable partners. The Commission was also strongly involved in the World Summit on Information Society. We have very good bilateral contacts with individual countries. We cooperate with the United States in many areas including those of Cyber Security or Cloud Computing, the Internet of Things with China; Green IT, Energy Efficiency or Information Grand Voyage with Japan, etc. When it comes to research and development, organizations from countries outside Europe can take part in the EUs 7th R&D Framework

94

TELITExpErT TaLk

TELIT2MARKET 06|11

das goal to harness Programme, which the potential of ICT includes the ICT Pro- than 14 devices at home waiting to boost prosperity gramme and impor- to be connected. and improve peoples tant activities in the quality of life. area of eInfrastructures. International organizations can also and actually do The Digital Agenda for Europe is really comparticipate in research projects. We cooper- mitted to help these technologies to work ate closely with regional organizations (e.g. seamlessly across the EU for the benefit of the African Union) and several non-Europe- all. This is a challenge, but a contribution to an countries as well, in particular those the future of healthcare is definitely worthwhich have signed Science and Technology while. I therefore intend to capitalize on my previous experience in SANCO and to foster Agreements with the European Union. innovation in the health domain. t2m: eHealth has become a highly visible subject. Healthcare systems in Europe, however, t2m: m2m is often seen as the enabler of the are very heterogeneous, as a result of national Internet of Things. What are, in your opinion, structures that have evolved over time. How the main drivers and challenges for the Interstrong is the influence of the European Com- net of Things? mission in this area? Can you create synergies from experiences you gained during your Madelin: Today Europeans have each more recent assignment at DG SANCO (Directorate than 14 devices at home waiting to be conGeneral for Health and Consumer Affairs)? nected. If we assume that by 2020 around half of the world population will have the Madelin: I am awe struck by ICT and health same number of devices, we can imagine synergies, which go well beyond IT use in around 50 billion devices with embedded health care extending into areas like compu- connectivity! For me, there is no question tational biotechnology, Virtual Reality as a that the revolution of the Internet of Things tool for mental well being, smart phones as a is already well underway. vehicle for health promotion and health maintenance. However, there are many challenges to overcome to make the Internet of Things a reality. For instance, online medical consultations Firstly, todays technical solutions are highly and portable devices that monitor the health fragmented and usually dedicated to a single of people suffering from chronic disease and application, such as fleet management or medisabilities have the potential to offer a free- ter reading. Second, the variety of different dom of movement that patients have never technical solutions tends to slow the growth enjoyed before. In practical terms, eHealth can minimize the risk of medical errors and help the early detection of health problems. ePrescriptions can reduce errors in drugs dosage by 15%. Luckily the IT and Health parts of the Commission have already been cooperating for years and will continue to do so. In particular, in 2011 we will launch the European Innovation Partnership, which will seek to meet three goals: to improve the health and quality of life of older people, enabling them to live active and independent lives; to contribute to the sustainability and efficiency of health and social care systems; and to foster competitiveness and business opportunities. This corresponds with the Digital Agen-

Today Europeans have each more

of the m2m market. Third, the lack of standardization is hampering the removal of technical barriers as well as the interoperability of m2m services and networks. And last but not least, security and privacy issues need to be addressed properly. t2m: Which privacy and security challenges do you expect in a world of smart and connected objects? What is DG INFSO doing to meet these challenges? Madelin: Traditionally, we are used to deciding ourselves when we communicate or disclose our personal data to someone else. The Internet of Things will change that: When smart connected objects communicate with each other, they do that on behalf of humans, but often without a human having initiating the conversation. Some of the information these objects exchange is personal data and the increasingly smart environment will considerably increase the possibility for information about people to be collected, exchanged and processed. Furthermore, it will multiply the possibilities for automated decisions, thus requiring careful design to ensure that we maintain adequate control for those who are affected by these decisions. We need to devise strategies to build trust and acceptance in the public at the same time as we develop the connected environment itself. This approach is often referred to as Privacy by Design. As part of this strategy, I believe that Privacy Impact Assessments (PIAs) will become crucial tools, not only

TELIT2MARKET 06|11

TELITExpErT TaLk

95

about isolated applications but in the more general context of the networks in which these applications operate. Incidentally, the Privacy Impact Assessment framework that is currently developed by the European industry for RFID could be used as a good model for future PIAs. Another element of the Privacy by Design strategy is the use of technologies which support privacy and security of the new systems, privacy enhancing technologies or PETs. This may include complex identity management systems, based on interoperability identification and authentication, encryption systems to avoid unauthorized access or modification of data, etc. And with respect to security, besides the current problems like SPAM, DoS attacks, identity theft or viruses, it is likely that new issues will gain importance as the Internet of Things unfolds. We have recently set up an expert group on the Internet of Things to advise the Commission on the critical issues, such as data confidentiality, availability of services, accountability and legal liability. t2m: What is your vision for a future in which all things are connected via the Internet? Madelin: This is a difficult question because nobody today, I believe, can claim to have a definitive answer to it. Each country or region seems to have its own vision of the emerging Internet of Things whether they use that phrase or neighbouring concepts such as Ubiquitous Computing or Ambient Intelligence. The expert group that has been tasked with advising the Commission on the Internet of Things will certainly provide useful guidance to bring coherence and clarity. I hope that the Internet of Things will develop as an open and comprehensive network of intelligent objects with the capacity to selforganize; to share information, data, and resources; and to act and react in face of situations and changes in the environment. We cannot be indifferent to such an evolution where objects are endowed with the ability to become subjects. <<

new trends of the automotive law in brazil

antonio Calmon and Flavio Sakai

For over three years, the automotive sector Brazil has waited for the implementation of Resolution No. 245 of Contran (National Transit Council), which requires the mandatory use of anti-theft devices in new cars. Currently on final implementation, the New Automotive Law has mobilized major organizations related to Brazilian traffic regulations such as Denatran (National Transit Department) monitoring companies, risk managers, automakers and telecommunications operators. To get a better understanding of this situation, telit2market spoke with Antonio Calmon, who coordinated the project

96

TELITExpErT TaLk

TELIT2MARKET 06|11

within the National Traffic Department. As an electronics engineer with extensive experience in telecommunications and semiconductors, Calmon works as market consultant now. Included in this conversation is Flavio Sakai, representative of SINDIPEAS for this legislation specific project an entity that also has been active in the protocol model m2m communication that should be adopted with the new regulation. During the meeting, both commented on the trajectory traveled to meet the new standard, including the compliance of the automotive industry and the participation of Telecommunications companies in the provision of services. t2m: Mr. Calmon, what is the goal of the new Brazilian automotive Resolution Law? Antonio Calmon: The main objective is to adopt an anti-theft device to prevent vehicle theft. There are two important areas: Electronic Vehicle Identification, and another that is capable of supporting the location and cars security. t2m: How were the services for tracking of vehicles before the new Resolution? Antonio Calmon: Until then we only had the aftermarket, where the vehicle owner have to go to an accessory store to buy automotive products such as car sound systems and alarm, and buy a non certified tracking device homologated by Anatel. Each equipment manufacturer had its own specification. This

culminated in the creation of a new standard for protocol communication between devices called ACP245 (Application Communication Protocol). After the introduction of the new Resolution, the customer can select any other communication protocol (tied to a specific equipment manufacturer) that provide other services, he will have total freedom, but the original protocol the ACP245 will be on file to provide total transparency and interoperability. t2m: Mr. Sakai, what has had the greatest impact from the new law with respect to telemetry and telematics? Flavio Sakai: With the publication of the new Resolution, in August 2007, we immediately evaluated the existing technologies. In September of that year, SINDIPEAS began the discussions with automakers. Some acted quickly, others took a little more time and started from the middle of 2008 forward. t2m: And what consequences are there for the m2m market? Antonio Calmon: I see four service areas. The first involves the automakers and the monitoring companies regarding the security of new cars. Another relates to the insurance companies. Currently, the level of recovery of the insurance companies is up to 90% on cars equipped with a crawler, making the risk of the insurer drop dramatically. Moreover, can have access to profile of drivers and know how their customers are driving. A third area includes the financial statements. With the new Resolution, the market of tracking devices will include low cost vehicles and a great change in the number of tracked vehicles. With Resolution 245, the cost of equipment for the financing and insurance companies has disappeared and a whole new model can be implemented. Therefore, tracking can happen in 100% of the fleet. There is the great possibility of even motorcycles being tracked and recovered. Finally, the fourth largest market, of course, is the car owner, who would benefit from a new set of services that goes from, what I like to call the Guardian Angel, which could be used in the case of a flat tire, a dead battery, and in other similar situations, up to remote diagnosis of the vehicle. Locating the vehicle position and sending

assistance could occur at the same instant. Those features could be easily achieved at a fair price, costing around five dollars to ten dollars each per month to the end user.

The main objective is to adopt an anti-theft device standard to reduce vehicle theft.

Flavio Sakai: The type of monitoring (how to drive, where you drive) required by these possible services has been questioned because some people are sometimes afraid of such a discussion. However, in the long term, I believe that all this will be beneficial and may improve driver education and behavior. As a consequence, when purchasing new insurance, the driver can no longer declare a profile type and continue driving in a totally different way. t2m: How was the issue related to the invasion of privacy by the Wireless telephony operators resolved? Antonio Calmon: Under the Anatel rules, the user is the one who chooses the provider of cellular telephone service. A committee with all the module/SIM cards manufacturers and Wireless Carriers was created, where we discussed the introduction of the SIM 245. It is a SIMCard configured to the National Traffic Department DENATRAN Telecom service, preventing the person from being screened. It has no Telecom Carrier configured and can remotely configure up to 30 Cellular operators. The leaders of the project have decided to not include carriers functionalities in specification of the device. Soon all cars will come out with the SIM245. We have been able to get a unique and open solution for acquiring services from local Telecom Carriers, which has put an end to the dependence on a specific Telecom service provider.

TELIT2MARKET 06|11

TELITExpErT TaLk

97

have been waiting for almost three years for the viability of the new Resolution. Will the legislation actually be implemented? Flavio Sakai: SINDIPEAS works in a very transparent way with their members. As we follow the question closely, ANFAVEA (Vehicle Manufacturers Association) also declares that it cares about deploying the system in a secure manner. Today the available system has reached a feasible level of development for it to be released. There was a slight delay due to the presidential elections, but now, with all the new governmental structures set, everything indicates that the new law will go into effect. There is a system almost ready, needing only part of the infrastructure. All the groups that participated in the project and invested efforts during the last 3 years are ready. Antonio Calmon: In my opinion, the chance that Resolution 245 does not happen is almost zero mostly because of the huge investments made by all segments of the industry.

t2m: What were the main problems you faced when designing this project? Flavio Sakai: We do a detailed evaluation of all the possible failures of a particular product, along with the provider service. An example of our thoroughness is that one risk analysis of some pages, turned into one of some hundred pages. The product/system specification has some thousand pages. In the beginning we had some concerns, but during the development and discussions in which we had some successes and some good ideas, we were able to carry out a comprehensive and thorough analysis as well. All this required an investment of about $ 200 million on the part of SINDIPEAS. t2m: How is the chain of risk through this new technology? Antonio Calmon: As required by the new Resolution, the system must be robust enough to trace all parts of communication and store all pieces of the process. If something goes wrong in the system, everything related to that event will be recorded, such as location, vehicle status, communication status, voice messages, timestamp, etc. This reduces the risk of system failure since all modules have intelligence and autonomy. For example, if somebody tries to steal a parked car, the antitheft equipment will not depend on the service provider to take control of that situation because there are other means for a car to be automatically blocked. t2m: How was the blocking function, defined by DENATRAN, implemented by the equipment manufacturers?

Flavio Sakai: The format of this blocking will occur according to the specification or determination of each Vehicle Manufacturer. However, in some risky conditions, the autonomous blocking defined by Denatran may also be used. Antonio Calmon: We have created two different blocking methods. The autonomous one is for vehicle theft. In this case, when someone try to invade and breaks the protection strategy of a car, the antitheft equipment will automatically block the vehicle. Only the car owner is able to re activate it. In the case of robbery, you can call the service provider number and ask to block your vehicle. If the thief tries to remove the antitheft equipment, the vehicle will be automatically blocked. The remote mode allows the service provider to safely perform a vehicle blocking. t2m: What if the theft occurs with the usage of a Jammer device (an illegal block that prevents communication with the monitoring station)?

vita

Flavio henrique Sakai Antonio Calmon: The car is blocked if equipped with the anti jamming functionality. The moment the thief stops the car, the vehicle will no longer start. Flavio Sakai: In the American market, some manufacturers have developed a command that determines the reduction of speed and the subsequent blocking of the vehicle in the cases of theft or robbery. t2m: Given the good prospects that the m2m market will have a substantial growth in the short and medium term, many companies have made huge investments in the sector and Married, 2 kids, 46 years Graduate in Telecomunication Engineer in USP/SP in 1986 Worked in different roles at Siemens (HW developer, Product Engineer, Project Manager, Business Developer) from 1987 e 2001 Joint Siemens VDO in 2004, becoming Development Engineering team manager. Nowadays he is responsible for the Business Unit Infotainment and Connectivity, at Continental Brazil.

98

TELITExpErT TaLk

TELIT2MARKET 06|11

vita

Possibly what can still be debated is the date of the 100% adoption percentage, established by DENATRAN. t2m: The Resolution helps to reduce the number of robberies and thefts, but apparently there will be a great number of added services to the device. How much benefit does this represent to the user? Antonio Calmon: Services are going to be just a consequence of the installation of the antitheft device. If you think about protection devices for vehicle, the automakers are already investing and installing a series of new devices in vehicles targeting security, but if we take a look into the average figures of vehicle thefts and robberies from the past five years, we will easily realize that there is no big change in the curve trend. Almost four hundred thousand vehicles are stolen every year in Brazil. This is equivalent to the total production of several automakers producing vehicles in Brazil. The losses in this area easily surpass five billion dollars. Therefore many aspects of the country losses in the stolen vehicles and cargo should be taken into account for an appropriate solution. t2m: Is there a similar Resolution in other countries? Antonio Calmon: In Mexico City there was a similar Resolution which failed because it was not managed appropriately. It was managed by private companies including a Telecom carrier. In Brazil, according to resolution, it

is forbidden for a telecom company to participate in the monitoring service. Russia is implementing a similar program called ERAGlonass that will be mandatory for all cars from 2012 on. The antitheft device designed in Brazil is similar and in most cases superior to similar devices produced around the world. They were

antonio Sergio Calmon Consultant at Kaitech Consulting Electronic Engineer, Master in International Management By Thunderbird School of Global Management, Glendale, AZ, USA. From May 2008 to May 2010, was the General Coordinator for Normative and Strategy Policies at Denatran, being responsible for 2 important policies, SIMRAV (or Automotive Law) and SINIAV (electronic tag). Had experience for 15 year in the telecommunications and semiconductor at Motorola and Freescale as General Director for 8 years

The system is almost ready, needing only the infrastructure. All the investors in the service area are ready.

designed under the sever specification of the auto industry and this fact makes the Brazilian device one of the most secure equipment of the world. One big advantage that the Resolution brings is the ability of Brazil to be a world leader in a very important technology. t2m: Will this impact other countries? Antonio Calmon: Absolutely, I think this is the beginning of several new applications. The European e-Call is a good example. The implementation of this system has been successively postponed and I believe that Brazil can contribute to this important application. After the beginning of the massive installation of the antitheft device, the country will be ready to quickly move into the safety direction. t2m: Will this project be a driver for other m2m applications that are growing in Brazil? Antonio Calmon: I see many m2m applications. What I would first see is that you have an integration of antitheft device with navigation systems, which may impact the routing algorithms and have several different routes to the same place with online traffic feedback. The usage of Wi-Fi, Bluetooth and ZigBee as a second technology to the device, in order to implement an environment without wires inside the car, we will enable Internet and entertainment services in a car. The evolution of those devices has no limit, and I see a great opportunity for the m2m market. <<

TELIT2MARKET 06|11

TELITExpErT TaLk

99

tEaChing anD rESEarChing M2M

interview with prof. axel Sikora, head of the information technology Department, Duale hochschule Baden-Wrttemberg, germany

t2m: What areas in the domain of m2m are currently being intensively researched; and which promise particularly revealing findings? Sikora: The various areas of application touched by m2m are associated with a multitude of tasks and challenges. These range from the ultra-energy-efficient or even selfsufficient connectivity of sensor nodes and the autonomous management of scalable and adaptive networks to issues of security and safety. There are a great number of ideas and solutions for these topics, but there are still many questions to be answered to achieve simple, inexpensive and autonomous m2m commu-

nication between systems with completely open and interoperable interfaces. t2m: Analysts forecast that the m2m industry will experience tremendous growth over the next years. Are universities prepared for this boom? Sikora: We believe this to be a rather ambivalent situation. Many of my colleagues at universities throughout Europe focus on the issue of m2m, looking at both its economic and technical aspects. So from my point of view, m2m has arrived at Europes universities. On the other hand, we are realizing that acceptance among students isnt as great as we might wish it to be. Very often, consumer

DHBW Loerrach

100

TELITExpErT TaLk

TELIT2MARKET 06|11

electronics with colorful multi-media technology appears much more exciting and therefore more attractive to students. t2m: Besides strong technical expertise, you also have an in-depth knowledge in Economy and Markets thanks in part to a degree you hold in economics. How important is a basic understanding of economics for researchers in this field? Sikora: Economic framework conditions are a fundamental requirement for any technical innovation that turns inventions into usable technologies and products. This aspect is particularly true for m2m innovations, since in most cases the task is to optimize work processes and work flows that are distributed over a wide area. Since the optimization of these processes is often very dependent on the accompanying technical conditions, close collaboration is needed between the technical and economic specialists. t2m: What factors are crucial for making m2m technology innovation economically successful? Sikora: The fundamental balance of effort and benefit needs to be maintained. In other words, communication between spatially discrete nodes must first and foremost deliver a real benefit. Secondly, the outlay involved must of course be smaller than the attainable

benefit. And this outlay is described as the total cost of ownership including all cost elements, i.e. not just hardware, software and installation, but also costs associated with maintenance, energy, battery changes and communication fees. t2m: At your Steinbeis Transfer Centre for Embedded Design and Networking, you are working on translating the results of your research into practical solutions. Are there any examples of particularly successful commercialization? Sikora: With our team of 15 experienced engineers, we have been working for almost a decade with cooperation partners at our Transfer Center to create solutions based on embedded systems. We take care of the communication issues, so that our partners are able to focus on their actual applications. We already have a variety of successful projects under our belt. Our own embedded Internet stack, which we call emBetter, is particularly important for us. It features tremendous scalability, simple operation and SSL/TLS security modules. This stack is already in use in one of the health-card readers certified by gematik. In the context of other projects, we have developed our own wireless M-Bus stack for use in remote meter reading. This is currently enjoying significant demand and is helping us better understand the many day-to-day

vita

prof. Dr. axel Sikora is head of the IT department at the Baden-Wrttemberg Cooperative State University Lrrach (DHBW Lrrach). He holds a Ph.D. in Electrical Engineering with a thesis on SOI-technologies and a diploma in Business Administration. In 2002, he founded the Steinbeis-Transfer Centre for Embedded Design and Networking (stzedn), which is active as a design center, offering training, consulting, project and product implementations. The center also develops work on standard communication protocol

suites, including the generic and extremely flexible emBetter TCP/IP-protocol stack as well as a very up-to-date Wireless M-Bus stack. Dr. Sikora is author, co-author, editor and co-editor of several textbooks and numerous papers in the field of embedded design and wireless and wired networking. He is reviewer to many journals and co-organizer of various conferences and workshops.

TELIT2MARKET 06|11

TELITExpErT TaLk

101

challenges of major m2m applications in greater detail and develop customized solutions for them. t2m: When it comes to road traffic safety, at the moment everybody is talking about Europes automated emergency call system eCall. You take the next step and that leads to the use of m2m technology to make pedestrians lives safer with the key word being Car2VRU* communication. What is the principle behind this technology and what is its status? Sikora: eCall is certainly on everyones lips, but scarcely in anyones car yet. For me, eCall is a perfect example of how the economic, political and organizational conditions of European diversity can hinder the use of an architecture that is not all that complex from a technical perspective. Our approach, involving communication between pedestrians and cars, is however to be regarded more as an addition to developments in car-to-car (C2C) communication. These projects involve the development of combined communication and location systems that are intended to improve mutual sensing between cars and pedestrians. These systems allow the reliability and accuracy of imaging systems already in use to be increased markedly. We are working in this regard within the initiative sponsored by the German Ministry of Economics known as the Cooperative Driver Assistance Systems (KoFAS) alongside other key partners from the automotive industry and academia. t2m: As part of the phaenovum initiative, you are involved with students of tomorrow and beyond. The pupil research network, cofinanced by the EU, is intended to inspire, motivate, and educate children and youth between 4 and 19 years of age with regard to science and technology. What encouragement are you able to offer these young people? Sikora: The phaenovum initiative is part of a fantastic project, a pupil research centre, that has been created as a training and also interdisciplinary network in a fruitful symbiosis of the public sector and private companies. The aim is to inspire young people about technology and science, and to show them how much fun it is to work in a stimulating environment with other open-minded people creating solutions together. By doing this,

we want to counteract the lack of skilled newcomers to the MINT subjects (Mathematics, Informatics, Natural sciences and Technology) on a regional level. Far too many prospective students are still under the impression that engineers tinker about on their own in their laboratories as portrayed by Walt Disneys Gyro Gearloose. We definitely need more of Gyro Gearlooses excellent ideas, but he would have no present hope of success with his way of working. <<
*VRU vulnerable road user

The aim is to inspire young people about technology and science

102

TELITExpErT TaLk

TELIT2MARKET 06|11

trEnD toWarDS highly SpECiFiC, CuStoMizED SolutionS

interview with Dr. roman Friedrich, Vice president Booz & Co. gmbh
can now be implemented at low cost and the required m2m eco-system of service providers, software developers, network operators and hardware manufacturers is up and running. We predict that in around five years the global market volume will be somewhere in the region of US$ 19 billion. For network operators in particular, m2m has once again become a hot topic. This is primarily a result of the operators new approach of covering the m2m value-added chain via partnerships rather than doing everything themselves.

M2M

t2m: If you look at the entire m2m value-added chain, in what areas do you expect to see strongest growth? Friedrich: We expect the strongest growth to come from the services sector, and here in particular in the field of Business Service Providers. Network providers have learned in recent years that high margins can be realized if intelligent partnerships are forged instead of trying to cover the entire value chain on their own. Collaboration with service providers such as Jasper; hardware and software suppliers; and systems integrators will be indispensable. Network providers that are able to rely on internal systems integrators are clearly at an advantage because they are able to offer two important components project management and connectivity themselves. However, collaboration with other players in the m2m eco-system will be unavoidable if they are to be able to offer low-cost, efficient solutions to industry and service providers. t2m: And what sectors will experience the greatest changes in the short term as a result of the application of m2m? Friedrich: We mainly see the biggest changes occurring in four areas. Innovative telematics and safety applications will make inroads into the automotive industry. Healthcare will

t2m: In the past, forecasts for the growth of the m2m market have often been laden with substantial amount of hype. How do you view the current situation? Friedrich: The situation has improved markedly. All of the requirements are now in place for the market to develop at a rapid pace. The strong trend towards digitization and the demand for cost reduction are present in virtually every industry. m2m applications

TELIT2MARKET 06|11

TELITExpErT TaLk

103

progress at speed, espebenefit greatly from In the short term, the m2m cially via mobile means; telediagnostics and landscape is not likely and in the services secremote patient monto undergo consolidation. tor: consumers will in itoring technologies. the future perceive the Other industries are smartphone as their without doubt energy supply (key theme: smart metering) and main communication device in the widest sense of the definition. Since around 75 consumer electronics. million smartphones were sold in Western These are also areas towards which network Europe last year, we anticipate that the operators in Europe and North America have volume will double over the next five years. turned the most attention to. Although This will naturally lead to a considerable operators try to implement their solutions growth in mobile data traffic predicted to across all industries, or in some cases follow a be around 60 per cent by 2015. more horizontal strategy and like Telenor for example have specialized in the devel- t2m: And what about the industrial sector? opment of software components that have a What developments harbor the greatest potenconsiderably wider range of applications, the tial here for additional telecommunications majority of providers rely on vertical spe- business? cialization and set their sights on certain industries through suitable partnerships. Friedrich: Our industrial businesses are All in all, we are seeing a trend towards high- merely at the start of the digitization process. A variety of procedures need to be migrated ly specific, customized solutions. from analogue to digital. This will result in a t2m: The m2m landscape is characterized in massive increase in efficiency for the indusmost industries by relatively small companies. try, and with it significant business potential Do you expect this trend to continue, or is the for the extended telecommunications indusindustry about to see more mergers and acqui- try. Here too, mobile data traffic will play a very central role with a revenue growth sitions? rate of approx. 60% over the next five years Friedrich: In the short term, the m2m land- we expect the Global data market volume to scape is not likely to undergo consolidation. In reach US$ 400 billion in 2015. the early phases of the market development, the number of providers will ensure strong t2m: You commute between your offices in innovation and market development, includ- Dsseldorf and Stockholm. Can you please tell ing in niche segments. It is only when the us the differences you notice between the m2m market matures properly that larger compa- markets in Central Europe (Germany) and nies acquiring smaller ones will become Scandinavia (Sweden)? What do you attribute commonplace. Then larger companies will these differences to? do this because they want to obtain the skills necessary for quick success on the m2m Friedrich: Northern Europe is already somewhat further ahead in terms of development. market. The earlier maturity of the telecommunicat2m: The telecommunications industry is tions market coupled with greater openness reaching the limits of its capabilities within its to technical innovations have led to greater traditional business model. Do you see trends dynamism in Northern Europe, including in in the private client sector that might open up the m2m sector. It is possible that the size of this region has also helped to encourage a new areas of business? search for creative, i.e. m2m-based solutions Friedrich: The telecommunications industry for bringing prosperity to isolated parts of will certainly be unable to achieve any more the country. Countries such as Norway, that growth in the field of voice services. On the have only a very sparse population over large other hand, there are massive opportunities areas of their territories recognized the for growth in the data sector both through advantages of telemedicine very early on, simple data transport, which will continue to encouraged these initiatives, and are now

pioneers with regard to the use of m2m solutions in remote patient monitoring and remote diagnosis. The European Commission has launched its own project that will test and possibly introduce similar competitive healthcare services in the countries of Finland, Ireland, Norway, Sweden and the United Kingdom. <<

vita

Booz & Company Partner roman Friedrich specializes in strategic transformation in fixed-line, convergent, and mobile communications; sales and marketing; new company buildup support; program management; technology-based transformation; and wargaming. Based in Dsseldorf and Stockholm, Dr. Friedrichs geographic focus extends throughout northwest and continental Europe, where he is a recognized thought leader in telecommunications strategy, commercial strategies, and operations and performance improvement for communications and technology clients. He is leading the Communications, Media & Technology Practice of Booz & Company in Europe. Prior to joining the firm, he worked as a scientist in the field of theoretical elementary particle physics at the Gesellschaft fr Schwerionenforschung and the University of Tbingen. Dr. Friedrich earned a PhD in physics from University of Tbingen and a diploma from Technical University of Darmstadt.

104

TELITMarkET

TELIT2MARKET 06|11

MagnEti MarElli holiStiC ViSion For SuStainaBlE MoBility

paola Carrea, telematics Director lucia locuratolo, program Manager, Sustainable Mobility program, Magneti Marelli S.p.a.
>> Magneti Marelli is an international group, leader in design and production of advanced systems and components for the automotive industry, with headquarters in italy. Inside its mission as automotive equipment suppliers at the global level, Magneti Marelli aims to conjugate quality and competitive products, technology and flexibility, with the objective of making key technologies available at affordable prices for the end consumer. Magneti Marelli aims to enhance, within a constant innovation process, its expertise and electronics cross-competencies in order to develop intelligent systems and solutions that contribute to the mobility evolution heeding criteria of environmental sustainability, safety and quality of life inside vehicles. Magneti Marelli is working at international level within the intelligent transportation systems (ITS) space to help define a mobility ecosystem. Starting from its core competencies in electronics and automotive information technology, Marelli is promoting partnerships for an integrated development with the aim of offering a complete solution from hardware to services, and also developing competence in new business models that have to be associated to this ecosystem. Thanks to modern telematics and networking technologies and to the integration of the vehicle electronics systems with central infrastructures and service providers, the car itself becomes an interconnected sensor, part of an integrated and intelligent system able to improve safety and experience onboard and on the road while helping the environment. Marelli is focusing on the development of devices and solutions to help drivers with vehicle control and identification of best routes, to optimize commute times hence minimizing consumption and emissions (Eco and Green Navigation). That includes providing drivers with important information regarding traffic, parking and limited access areas, toll payments, and

TELIT2MARKET 06|11

TELITMarkET

105

To this end work still needs to be done on: Identifying ICT solutions that enable real time communication among vehicles and between vehicles and infrastructure (road side and central side); Sharing and promoting widespread initiatives in the various industries: from accident prevention that monitors driving style for the most risky subjects (young people for example) to the dynamic management of roads and urban centers for tolling, from the rationalization of drivers licenses to logistic and traffic flow improvement; Collaborating and sharing communications standards for platforms, both on and off board, with services vendors so that reliability and efficiency gains can help accelerate growth and adoption. Magneti Marelli is also part of the Italian TTS Board (Telematics, Transports and Safety), active in working groups coordinated by the Infrastructure and Transportation Ministry on the ITS Italian Action Plan. Thanks to the important experience in the sector acquired by collaborating with the main car makers the company coordinates The ITS applications for road safety and transport security (eCall, applications for preventive safety, information and reservation services for safe and secure parking places for trucks and commercial vehicles). <<

thE lEgiSlatiVE SCEnario anD rElatED opportunitiES

Telematics is becoming a native part of the vehicle given the increase in driver related legislation such as Rastreador in South America, eCall in Europe, and 911 in USA. Regulations like these will lead to a rationalization of on board systems (both AM and OE) based on key telematics technologies (wireless modules and tracking systems). In the international legislative scenario Brazil is the country currently with the most advanced regulations. According to these regulations, by the end of 2011 all imported or domestically produced vehicles will have to be fitted before sale, with a telematics device with GPS vehicle tracking and engine disabling functions in case of theft. In Europe the acknowledgment of the ITS Directive represents a key step in the evolution of intelligent transportation systems, as well as the first step to enable the definition of a coordinated and shared development strategy for this sector. Considering the technological aspect, Europe has invested heavily in the Galileo satellite system and most likely will push for its usage to EU member countries. For this reason eCall and Tolling systems could represent important factors to be taken into account for Galileos final deployment. Because of being actively involved in the above mentioned opportunities and for capitalizing on the expertise and experience amassed over the years, Magneti Marelli can be now recognized as leading supplier in the Telematics market.

vehicle behavior and remote diagnostics. But these systems also give drivers access to new insurance contract typologies, and in case of accidents, they can summon immediate assistance management thanks to automatic emergency call activation. Marelli is also working to develop specific solutions for the logistics and fleet management space. In Italy alone, 40 billion are lost due to logistic inefficiencies. On the subject of tolling systems, many European governments are proposing regulatory legislation for toll collection based on real kilometers driven: a solution based on GSM, GPS and DSRC technologies has been in use in Germany since 2005; this same solution was launched in Slovakia at beginning 2010; France is working on an EcoTaxe project for 2012 which targets heavy goods vehicles, but in some applications it will also target cars on the basis of km driven. The objective for the near future is to develop telematics platforms which are able to transform the connected vehicle into the cooperative vehicle extending its visual and temporal horizons further taking advantage of this vehicle-to-vehicle communication capability to implement advanced solutions in the area of preventive safety. Solutions developed by Magneti Marelli are both for the OE and After markets. Strategic objectives at Marelli include steering clear of international active initiatives causing fragmentation to Road Safety and Infomobility, and transforming competition into competitiveness inside the ITS value chain.

106

TELITMarkET

TELIT2MARKET 06|11

>> Since 2009 two hot topics in the field of economics and information technology (it) have arisen, named low-carbon economics and the internet of things (iot). although in two different fields, they are closely related. iot as a new informational means facilitates the reduction of energy consumption, conserving resources by improving efficiencies through smart control and management systems.
Urgency in developing a low-carbon economy Low-carbon economics is derived from the idea of sustainable development. It pivots on the reduction of high-carbon energy consumption and greenhouse gas emissions, through the application of technology innovation, system innovation, industrial restructuring, new energy development, and other means achieving socioeconomic development as well as ecological and environmental protection in a win-win economic development pattern. Embracing low-carbon economics is necessary if China is to maintain the quality and efficiency of economic growth and sustainable development. Last year, at the Copenhagen

China tElECoM
FaCilitatES loW-CarBon EConoMy through thE intErnEt oF thingS (iot)
you Wuyang Senior Engineer of China telecom Corporation, Beijing research institute

Jin DongBin Vice Chief Engineer at China telecom

TELIT2MARKET 06|11

TELITMarkET

107

Conference, the Chinese government promised to reduce emissions of greenhouse gases and to achieve this objective, new technologies and innovative management are very important. As one of the representatives of the telecommunications industry in China, China Telecom has consistently explored the role of IOT in low-carbon economics. IOT plays an important role IOT promotes low-carbon economics in three aspects: first by providing access to the digital and informational material world; second through the remote control of objects; and third through intelligent management of the material world. Through sensors, RFID and other IOT technologies it is possible to gain access to information anytime and anywhere, which greatly enriches the way people observe the world. It helps save both manpower and investment in equipment while improving efficiency. In addition, with the wide utilization of the internet and modern communication networks, it is possible to control objects without geographical boundaries and to reach any place where there is demand. This includes the integration and application of interaction between background computer systems and front-end digital terminals, telecommunications, and automatic control technology. Remote control is the subsequent measure after data collection. Applications in the area of remote control can be utilized for oil extraction machines, power facilities, remote mobile base stations, lighthouses, road infrastructure, agriculture, etc. Higher application levels of IOT promote the use of intelligent management wherein the management process adopts decision support methods, expert systems, simulations, identification technologies and other technologies to achieve the features characterizing intelligent management. Large amounts of complex data get analyzed and simulated through cloud computing or software technologies, resulting in intelligent solutions, automatic control and implementation.

Intelligent management improves the efficiency and accuracy of decision-making. It helps avoid resource waste and cost inefficiencies in the effort to achieve energy savings. For example, intelligent management is applied to intelligent transportation to predict traffic flow dynamics using that for route planning. Nine fields to achieve low-carbon economy The main thrust of IOT is the ubiquitous application of IT. Any object at any time and place can become, under human management, interconnected through internet connectivity and because of this ubiquity, IOT strongly supports the development of low-carbon economy. In the future, humanity will be able to effectively manage production while living more dynamically to develop a low-carbon economy by applying IOT technologies into fields of intelligent transportation, smart grid, smart building, smart home, intelligent environmental protection, intelligent agriculture and mobile e-commerce. Intelligent transportation achieving low-carbon traveling In order to enhance urban transportation systems it is important to apply IOT technologies in data collection, testing and other relevant fields. Typical applications in this field include
FiElD 1

traffic flow monitoring, electronic toll collection systems (ETC), vehicle monitoring, parking, and vehicle networking. Traffic flow monitoring can regularly collect and monitor vehicle speed, distance between vehicles, and other information in a specific region, so as to provide accurate real-time data for controlling traffic signals. Use of an ETC system can lead to reduction in exhaust emissions and improves traffic capacity at crossroads. Intelligent parking management systems help drivers determine the location of available parking spaces at their destination in real-time. Vehicle networking is the information system concept that uses the vehicle as a network node.
FiElD 2 Intelligent logistic system energy saving control China Telecom has developed a service platform called Logistics e-Pass. It utilizes wireless video monitoring, RFID and other IOT technologies to deliver services including vehicle location, video monitoring, and other functions which make logistics management more effective and efficient. FiElD 3 Intelligent building new means of building energy savings Integration of communication and sensor control through IOT allow water usage, waste and sewage discharge and other types of data to be gathered and transferred to comprehensive application platforms for analysis and statistics.

108

TELITMarkET
pollution, and radioactive waste. Combined with 3G, broadband and software technologies, massive data volumes can be transmitted and stored allowing for remote control and intelligent management. The Environmental Protection e-Pass, developed by China Telecom, has been adopted by Chinese environmental protection agencies. Its services include data collection and video monitoring of sources of pollution, environmental quality, nuclear radiation, and others. Data monitoring and video surveillance applications are then integrated to extend the governments environmental regulatory compliance verification capacity.
FiElD 7

TELIT2MARKET 06|11

track their thermal behavior, optimizing system cooling and improving system efficiency. Furthermore, cloud computing allows consolidation of computing and storage resources to greatly reduce the energy consumed by internet data center (IDC) rooms. For example, HP has consolidated 85% of its data centers into six worldwide data centers. With this initiative, HPs annual energy savings are equivalent to the yearly electricity consumption of the entire city of San Francisco. Low-carbon life energy saving in daily life In daily life, the application of RFID and sensor technologies based on IOT can foster the development of a wide range of low-carbon applications, such as mobile payments, mobile two-dimensional bar-codes and home gateways. Mobile m2m Solution is based on the combination of an RFID chip and the SIM/UIM card. It breaks the bottleneck where traditional cell phones can only be used for communications, greatly expanding the scope of their utilization, and turning them into real internet tools. The Mobile two-dimensional bar-code technology is that where an electronically generated two-dimensional bar-code is generated to be used by mobile phones. Shooting the code with the phone camera allows the code to be translated into information, such as the owner, a website, a price, a sales promotion etc. The above mentioned are a few typical applications of IOT. As IOT technologies become more mature and cost efficient, IOT usage becomes more wide-spread in lives and industry, contributing to further development of a low-carbon economy. <<
FiElD 9

Intelligent grid improving energy efficiency of electricity China Telecom has launched an Intelligent Grid system based on IOT. It is used for residential remote meter reading, load control at large power customers, and monitoring of distribution nodes. Intelligent agriculture reducing energy consumption in agricultural production The application of IOT in agriculture is mainly focused on greenhouse management, agricultural machinery management, grain storage, irrigation and, source tracing of agricultural products, with greenhouse management being one of the most important applications. As an important means of attaining highyield agriculture, greenhouse cultivation and greenhouse farming have flourished unprecedentedly in China. In the process of managing production, greenhouse farmers must adopt integrated environmental control strategies and understand the state of growth of their agricultural products. Achieving these requirements is essential for the creation of a suitable environment for the industrial production of highly efficient, high quality, and low consumption crops.
FiElD 6 FiElD 5

FiElD 4

Disaster prevention and mitigation reducing loss from disaster China Telecom and its partners have developed a geological and flood disaster monitoring and warning system based on IOT. Remote rainfall and live water levels at reservoirs and dams are monitored through both wired and wireless networks and sensor networks. By combining meteorological, hydrological and land information, this system can provide services including value forecasting for warnings, pre-disaster warning, relief security, and research and analysis after a disaster. The system is currently being used by the professional geological hazard monitoring department of the Ministry of Land and Resources of China. Green networks saving energy in the process of communications Sensor technologies and cloud computing play important roles along with other general methods in constructing of green networks. Intelligent sensors are built into servers to
FiElD 8

Intelligent environmental protection improving efficiency of supervision Intelligent environmental protection monitors objects in the water, land, and air through sensing facilities and satellites. Objects monitored include water sources, air, noise,

TELIT2MARKET 06|11

TELITMarkET

109

110

TELITMarkET

TELIT2MARKET 06|11

toWarDS intErnEt

EVEryWhErE
though far from it. With our increasing use of raw materials, need for new energy sources, transportation to link places that are inhabited, security needs and even environmental concerns, there is a rapidly growing range of m2m applications in such places needing to be connected. this is the realm of satellite m2m, which Beecham research has recently studied in-depth for the European Space agency.
There are two flavors of satellite systems Fixed Service Satellites (FSS) and Mobile Satellite Services (MSS). Both have m2m connections, but for very different applications. Nevertheless, today the key m2m market sectors currently addressed by satellite represent just a fraction of the terrestrial (cellular) m2m markets. As of today, the marketing for satellite based m2m activities is still not very intense among most satellite operators because they currently put greater emphasis on their core businesses of voice, broadcast, data backhaul and Internet traffic. This behavior results in a more limited market than that where all players were actively competing in m2m. According to Beecham Research figures, in total there was an installed base in the region of 2.5 Million m2m connections linked via satellite worldwide at end 2010. To put this in a wider context, satellite m2m communication services currently make up just 0.5 % of the entire revenue for satellite telecommunication services in 2010.

robin Duke-Woolley, CEo Beecham research ltd (www.beechamresearch.com)

>> With over 70% of the earths surface under water, and some 44% of the earths land mass uninhabited, there is a lot of places in the world with no or very patchy cellular coverage. this does not mean there are no m2m applications there

TELIT2MARKET 06|11

TELITMarkET
satellite operators. For example, Globalstars SPOT product range has been very successful in driving a low cost satellite solution into the consumer market. On the other hand, Iridiums recent launch of a smaller form factor satellite modem has gained a substantial order book in record time. As a result, growth in Iridiums m2m connections base has now dramatically overtaken growth in its traditional voice connections base. Depending on the satellite operator, current m2m connections growth rates vary from about 15% per annum to more than double that. In addition, all MSS operators are currently changing out their constellations and as a result will be able to support faster data rates more cost effectively. These growth rates compare well with growth in current cellular m2m connections. SCADA, Security/Surveillance and Tracking/ Tracing. This includes an increasing use on airplanes, for example for direct monitoring of jet engines while in flight. Thirdly and arising from the first two points there is now an increasing prospect of cost effective and practical Internet Everywhere m2m solutions incorporating both cellular and satellite coming to market over the next few years. The opportunity is for a completely integrated solution where an m2m platform makes the choice of whether to use cellular or satellite and where tariffs are transparent to this. If this were to happen, satellite m2m could truly become a growth opportunity for cellular m2m as we see much greater use of m2m overall for applications that need to incorporate the many less intensively inhabited regions of the world. It offers a way forward too for providing higher overall quality of service for connectivity in areas where this is currently problematic. In many ways this would also complement the growing benefit of integrated solutions incorporating both cellular and short range radio: it completes the wireless solution. The next few years promise to be interesting for cellular and satellite m2m technologies working together for the benefit of both. <<

111

So why should this be of interest to the cellular m2m market? Firstly, there are similarities between where satellite m2m is today and where cellular m2m was a few years ago: just entering a faster growth phase. Due to mass production, global standardization, intense competition and broad service portfolios, suppliers of m2m solutions based on cellular communication have rapidly reduced costs and form factors for many applications over the last few years. Most of these require only small amounts of data, emphasizing the use of 2G. Additionally the growing terrestrial global network coverage has extended the addressable market. Satellite m2m is of course potentially a direct competitor to cellular. Indeed there are growing numbers of cases where migration from cellular m2m to satellite m2m has occurred, particularly where roaming is involved with cellular but not with satellite. This also applies to applications where only very small packages of data are required to be transmitted. In most cases, though, the two are normally considered to be complementary based on geographic coverage. At present, growth in satellite m2m is being driven particularly by initiatives being taken by individual

Secondly, the applications addressed by satellite m2m are a subset of those addressed by cellular: there is a commonality in the application set. Satellite m2m connections are generally focused geographically in areas with no or poor terrestrial coverage. This is particularly the case for the maritime sector and areas with low population. As a consequence, satellite use is of major interest in the Americas, Asia PAC, Middle East and Africa, where often there is either no alternative technology available or where alternatives are weak in coverage and quality of service. However even in Europe, with its dense terrestrial network coverage, there is increasing use of satellite for m2m applications to infill where cellular coverage is poor or variable. In terms of the applications themselves, satellite m2m is particularly effective in the transportation and logistics sector, the utilities, mining and raw material production, and the security sector. Applications with the largest installed base are: Asset Monitoring, Metering, Point of Sale,

112

TELITMarkET

TELIT2MARKET 06|11

WhatS DriVing groWth in M2M For 2011 anD BEyonD?

Stefan lindvall, president, Connected Development
Markets like healthcare, connected homes and consumer products are now among the fastest growing verticals. In turn, related applications are shining a new light on the internet of things and driving increased visibility for m2m communications. Where the average consumer five years ago was just beginning to see the possibilities of cellular data communications, today that connectivity extends beyond their computers and phones into more and more aspects of their lives. Ron Westfall of Current Analysis recently wrote, the potential growth in the m2m market is now driving, increased resource investment and marketing attention of the major mobile carriers. (2) Having watched the carriers take notice and look toward m2m as a key element of their strategic plans, we agree with Westfall, while there remains work to be done, the growing focus from the carriers on m2m can only help drive adoption of the technology going forward. Regulatory and legislative concerns are also driving interest and adoption of m2m technology. Recent hot topics in the political world include smart grid and energy management technology, environmental concerns, healthcare and highway safety all of which can be addressed to some extent by implementing m2m technology. As a result, government funds are becoming available for m2m projects around the world.

>> When its your job to turn peoples wireless ideas into reality, you get to see a lot. innovation in the wireless device space is picking up as a much broader community becomes increasingly aware that connectivity can enable better business and better living. So what trends is driving growth? i like to look at it from two perspectives: technology and business trends. On the technology side, one thing with which we have been challenged several times as designers is the miniaturization of finished products. Thankfully, this has been supported by the continued miniaturization of key components including modules and even SIMs. Nevertheless, it presents unique design problems particularly when it comes to integrating antennas for mission-critical performance and reliability. For those seeking to bring small connected products to market,

we highly recommend looking for expert support for antenna design, particularly in light of the fact that antenna performance is a key component of required device certifications. The next trend creating an impact is the continued downward slope of component pricing across major component categories including modules, processors and memory. For years, analysts blamed slower-than-expected growth in the m2m industry on this very issue. Today, with costs coming down, we are starting to hit the sweet spot on bill of materials enabling attractive pricing on finished products in both traditional and emerging m2m verticals including the connected consumer space. Another trend on the technology side that we expect to continue through 2011 is an increased interest in standardization. Though ABI Research recently stated m2m markets will NOT achieve significant standardization in 2011 (1), they do note that a host of international standards organizations are working on setting standards with many projects expected to conclude this year. While we agree there will continue to be some road blocks, we are seeing increased concern for standardsbased development from the innovators bringing new m2m products to market and believe customer-driven demand will press the industry to overcome objections and begin adopting these standards. On the business side, we are seeing a maturing in m2m value propositions and business models which is leading to improved return on investment and, as a result, the emergence of new vertical market participation.

TELIT2MARKET 06|11

TELITMarkET

113

their products and establishing the grounds for ongoing customer relationships and for recurring revenues. Healthcare companies are enhancing patient quality of life. Car makers and auto insurers are making the highways safer. And, of course, major technology players are looking to complement existing portfolios and leverage customer relationships to expand into this hot new space. Berg Insight projects the total number of m2m connections to grow at a rate of 32 percent to reach nearly 300 million by 2015 (3). iSuppli predicts even faster growth of 52 percent between 2009 and 2014 (4). Beecham Research expects sales of embedded devices to exceed $250 billion by next year (5). By any measure, its clear that m2m is poised not only to grow tremendously, but indeed to change forever, for the better, the way we live and work. <<
1) Whats NOT Going to Happen in 2011, ABI Research, December 2010; 2) Westfall, Ron, m2m mobile: Will carriers rise to meet m2m ecosystems challenges?, Fierce Wireless, November 29, 2010, http://www.fiercewireless.com/story/m2mmobile-will-carriers-rise-meet-m2m-ecosystemchallenges/2010-11-29; 3) The Global Wireless m2m Market (3rd Edition), Berg Insight, December 2010; 4) Sideco, Francis, WWAN m2m Modules: Catalyst for an Industrial Revolution in the 21st Century, iSuppli, Q3 2010; 5) Carrozzo, Mike, Get Yourself Connected, Connected World, July/August 2010.

Connected Development: telit Competence Center

Connected Development has been named a Telit Competence Center, offering design, development and integration assistance for Telit customers for their excellence in: n established design department A with a successful track record roven experience in hardware, P software and mechanical design xperience with approvals and certiE fications n ability to design cost-effective, A reliable end solutions. Its their mission to leverage their expertise, experience and partnerships to provide comprehensive services that enable clients to bring innovations to market fast, manage risk and position themselves for success. www.connecteddev.com

In addition, the global economic downt urn of the past few years is forcing even the strongest organizations to seek efficiency wherever they can find it. What theyre finding is that wireless technology can save them both time and money, and in some cases, even open doors to new service offerings and related revenue streams. With m2m technology featuring more prominently in the news and consumer-related applications becoming more embedded in our everyday experience, many of the Fortune 500 are standing up and taking notice. Retailers are streamlining their supply chains. Equipment manufacturers are enhancing

CONNECTED DEVICES IN

FIND OUT WHAT IS HOT WITH

THE STATES.

Professionals read CONNECTED WORLD the go-to magazine on connected devices to learn about industries such as:
HEALTHCARE T R A N S P O R TAT I O N SECURITY UTILITIES M A N U FA C T U R I N G
CONNECTED WORLD educates business professionals on-the-go and in the ofce about the connected devices that can save their companies time and money and make their lives easier!

SUBSCRIBE today and receive a one-year subscription for only $44.97 You can subscribe ONLINE at or call us TOLL-FREE at
+1 888.454.2170.

www.connectedworldmag.com/Subscribe/intl.aspx

magazine

telit2mARKet 06|11

TELITDISTRIBUTION

115

Argentina > Australia > Austria > Belarus > Belgium > Bolivia > Bosnia Herzegovina > Brazil > Bulgaria > Canada > Chile > China > Columbia > Croatia > Cyprus > Czech Republic > Denmark > Ecuador > Estonia > Finland > France > Germany > Greece > Hungary > India > Indonesia > Iran > Iraq > Ireland > Israel > Italy > Jordan > Korea > Latvia > Lebanon > Lithuania > Luxemburg > Macedonia > Malaysia > Malta > Mexico > Montenegro > Netherlands > New Zealand > Norway > Paraguay > Peru > Philippines > Poland > Portugal > Romania > Russia > Saudi Arabia > Serbia > Singapore > Slovakia > Slovenia > South Africa > Spain > Sweden > Switzerland > Syria > Taiwan > Thailand > Turkey > Ukraine > United Arab Emirates > United Kingdom > United States > Uruguay > Vietnam

telit ARoUND tHe woRlD

For detailed information about our distributors, please > where to buy. visit

www.telit.com

116

TELITSaLES

telit2mARKet 06|11

S. Croft

Y. Ferhusoglu

TELIT'S SALES

A. Fan

P. Collins

A. Pronin

FoRCE
TiTLe
VP Global Sales VP Sales EMEA RSD Nordic and Baltic countries RSD Italy & Balkans RSD Turkey, Arab Middle East RSD Central Europe (Poland, Czech Republic, Slovakia, Hungary, Bulgaria, Romania) RSD United Kingdom Account Manager Country Sales Manager France and North Africa RSD Russia & CIS

N. Balj
J. Moore

M. Wagner

A. Wang

R e g ion
Telit Global Telit EMEA

Con TAC T Pe R S on
Felix Marchal, Felix.Marchal@ telit.com Carlos Perez Negrete, Carlos.Perez @ telit.com Mads Kring, Mads.Kring @ telit.com Nikola Balj, Nikola.Balj@ telit.com Yavuz Ferhusoglu, Yavuz.Ferhusoglu @ telit.com Artur Wrobel, Artur.Wrobel@ telit.com
M. Ueland
T. Lavie

H. Kim

A. Benino

A. Wrobel

P. Lentz

Philip Collins, Philip.Collins @ telit.com Steve Crofts, Steve.Crofts @ telit.com Emmanuel Maussion, Emmanuel.Maussion@ telit.com Alexander Pronin, Alexander.Pronin @ telit.com Siegfried Grossmann, Siegfried.Grossmann @ telit.com Nieves Blanco, Nieves.Blanco @ telit.com Pieter Lentz, Pieter.Lentz @ telit.com Mike Ueland, Mike.Ueland @ telit.com Mark Maresca, Mark.Maresca @ telit.com Mike Wagner, Mike.Wagner @ telit.com David Barczak, David.Barczak@ telit.com John Gillan, John.Gillan @ telit.com Jacki Moore, Jacki.Moore @ telit.com Marcos Kinzkowski, Marcos.Kinzkowski@ telit.com Ricardo Simon, Ricardo.Simon @ telit.com Artur Couto, Artur.Couto @ telit.com Anderson Benino, Anderson.Benino @ telit.com Gideon Rogovsky, Gideon.Rogovsky @ telit.com Shuki Yulzari, Shuki.Yulzari @ telit.com Tomer Lavie, Tomer.Lavie @ telit.com Yinon Raviv, Yinon.Raviv @ telit.com HoSang Kim, HoSang.Kim @ telit.com Ashish Gulati, Ashish.Gulati@ telit.com Allen Wang, Allen.Wang @ telit.com Sunman Liu, Sunman.Liu @ telit.com Allan Fan, Allan.Fan @ telit.com Chen Ming, Chen.Ming @ telit.com Dukjun Koh, Dukjun.Koh@ telit.com JK Noh, JKNoh@ telit.com Jihoon Kim, Jihoon.Kim @ telit.com Roger Bay, Roger.Bay @ telit.com GM = General Manager VP = Vice President
D. Barczak N. Blanco
F. Marchal

G. Rogovsky

J. Noh

H. Kim

RSD DACH (Germany, Austria and Switzerland) RSD Benelux and Iberia RSD Africa, Anz and NZ Telit VP & GM, Telit North America RSD Southeast RSD West & Canada RSD Midwest RSD Northeast & Business Development

J. Gillan

R. Simon

M. Maresca

North America

M. Kring

A. Couto

S. Gross

Channel Manager Telit Latin America General Manager Account Manager Account Manager

m ann

A . Gulati

Sales Manager Direct Channel Telit Israel CEO TWS Israel Country Sales Manager, Israel Account Management

R. Bay

E. Maussio

C. Perez C. Ming

Account Manager Telit APAC Director of Sales Asia Country Sales Manager, India Country Sales Manager, Taiwan

S. Yulzari
S. Liu

Account Sales Manager, S. China (GSM/GPRS) Account Sales Manager, S. China (UMTS/CDMA) Account Sales Manager, Central China Director of Sales, Korea

M. Kinzkowski

Sr. Sales Manager, Korea Sr. Sales Manager, Korea Key Accounts RSD SEA

Y. Raviv

D. Koh

Legend:

RSD = Regional Sales Director RSM = Regional Sales Manager

telit2mARKet 06|11

TELITSaLES

117

Two is beTTer Than one

WHEN TALKING ABoUT CUSToMER FoCUS
Felix Marchal, VP Global Sales
>> With the contribution from arriving Motorola m2m business, the combined new Telit will provide the best customer experience in the m2m industry. It is now well recognized that for Telit it is all about the quality of customer satisfaction. And by using, combining and enhancing the strengths of both entities, the integration of the Motorola m2m sales force and channelto-market will undoubtedly provide for the best buying experience ever. The Motorola team of greatly skilled and seasoned m2m experts will not only expand the Telit organization as needed to support the rapid market growth but will also complement well the existing knowledge base with market and product positioning expertise that was always targeted to be best-in-class. Another great benefit from this acquisition is how it allows us to take advantage of the combined indirect sales network which will enhance our ability to tackle the high degree of fragmentation in the m2m market which is compounded by Telits desire to listen equally to all its customers. Because of this fragmentation and diversified vertical markets, the new, improved Telit sales channels, both direct and indirect, become extremely valuable. Our indirect sales network plays a major role in Telits success with its members truly regarded as partners. The new combined valueadded distributor network will provide enhanced national geographic coverage to maximize customer reach and add technical expertise on Motorola products and services that will be integrated to the existing product portfolio. Since our goal of consistency and long-term product availability is the keystone of Telits strategy, the newly acquired Motorola m2m product portfolio will be continued and support improved from demand creation and demand fulfillment perspectives with the combination of all sales channels. Being entitled to market the complete product

portfolio, these valuable partners will be able to provide the right combination of technical expertise on combined Telit products further streamlining logistics, enhancing the operation of the supply chain. Now more than ever, Telits indirect network amasses the right mix of competencies to be a valuable competitive weapon. With Telits network of distributors focused on satisfying the needs of our small and medium sized customers, our global sales strategy would not be complete without a clear focus on servicing our existing and high-potential large direct accounts within targeted vertical markets. Customers count on Telit to provide key value through quality, continuity of supply, flexibility, extended support, total cost of ownership, customization, and scalability of m2m architecture. Additionally, Telit routinely works to address

customers needs beyond just the module. That because our ultimate goal is to be viewed as a partner and trusted advisor and we do that by focusing on three pillars of success: customer satisfaction, innovation leadership, and industrial greatness. As a result of being the most focused m2m player; understanding our customers business models; being able to successfully support our customers business cases; having our core values in investment protection, business scalability, ease of integration, and quality, which are all key to our customers; having best-in class marketing communications to support and raise our customers profiles in the market; and placing customer satisfaction as our #1 priority; Telit can provide you, our customer, with the competitive edge you need to succeed in your market segment and business. <<

118

TELITCOMPETENCE CENTER

telit2mARKet 06|11

TELIT CoMPETENCE CENTER

AmeRicAs emeA

BRAZil seVA engenharia eletronica sA Geraldo A. Souza Coordenador de Software Phone: +55 31 32 11 10 00 Fax: +55 31 32 11 10 10 www.seva.com.br

wireless solutions Grupo itech Douglas Malvar Ribas Phone: +55 11 33 500 200 R.224 Fax: +55 11 32 250 892 www.grupoitech.com.br

ARGeNtiNA, cHile, PARAGUAY, URUGUAY electrocomponentes s.a. Diego Miguel Zanazzo Vice President Phone: +54 11 43 75 33 66 Fax: +54 11 43 25 80 76 www.electrocomponentes.com

FiNlAND ionsign oy Kimmo Aho Managing Director Phone: +358 40 721 36 88 Fax: +358 2 822 00 98 www.ionsign.fi

itAlY Dem s.r.l. Ester Pescio Sales Manager Phone: +39 010 59 61 21 Fax: +39 010 59 61 234 www.dem2m.it

FRANce eRco & GeNeR Thierry Boulissiere Phone: +33 2 41 83 13 00 Fax: +33 2 41 67 19 20 www.ercogener.com

services for electronic manufacturing srl Roberto Zavatti Senior Design Manager Phone: +39 039 639 36 24 Fax: +39 039 63 95 015 www.semtechnologies.it

UsA

connected Development
Stefan Lindvall Phone: +1 919 349 30 47 Fax: + 1 919 678 14 88 www.connecteddev.com

spectrum Design solutions

Rod Landers Phone: +1 612 435 07 96 Fax: +1 612 435 07 36 www.spectrumdsi.com

tes electronic solutions Nick Walker Sales & Marketing Phone: +33 (0)1 64 53 14 01 Fax: +33 (0)1 69 32 22 95 www.tesbv.com

skytechnology srl Ing. Giampaolo Figini Business Developer Phone: +39 02 37 05 11 or +39 02 37 05 12 41 Fax: +39 02 41 56 786 www.skytechnology.it

Delta mobile systems

Shawn Cohee Phone: +1 847 884 67 50 x230 www.deltamobile.com

the morey corporation

Emad Isaac Chief Technology Officer Phone: +1 630 754 22 12 Fax: +1 630 754 23 00 www.moreycorp.com GeRmANY cetec Peter Gntzer Managing Director Phone: +49 89 67 34 60 61 Fax: +49 89 67 34 60 66 www.cetec.cc

Janus Remote communication

Dave Jahr Phone: +1 630 499 21 21 Fax: +1 630 851 50 40 www.janus-rc.com

Xirgo technologies, llc

Shawn Aleman Vice President, Business Development Phone: +1 805 426 52 43 Fax: +1-805 389 10 23 www.xirgotech.com

telit2mARKet 06|11

TELITCOMPETENCE CENTER

119

APAc

seRBiA innovation center | Faculty of electrical engineering | University of Belgrade iceF d.o.o. Dejan ivkovic Sales Manager Phone: +381 11 33 70 123 Fax: +381 11 33 70 123 www.icef.etf.rs

sPAiN DRAco systems Meritxell Gimeno Phone: +34 935 607 010 Fax: +34 935 607 029 www.dracosystems.net

UNiteD KiNGDom

A2e limited
Carl Hudson Business Development Manager Phone: +44 15 06 592 359 Fax: +44 15 06 592 230 www.a2etech.com

iNDiA connectm technology solutions Pvt. ltd. Achutha Jois Chief Evangelist Phone: +91 80 41 70 053 1/2/3 Fax: +91 80 41 70 053 1/2/3 www.connectm.com

sweDeN

the technology Partnership plc

Mathew Palmer Phone: +44 17 62 26 26 26 Fax: +44 17 63 26 15 82 www.ttp.com isRAel Gatetel David Ezer Phone: +972 54 766 57 54 Fax: +972 9 745 45 49 www.gatetel.com

Rubico consulting AB
mikroelektronika Nebojsa Matic Sales Manager Phone: + 381 11 366 0 600 Fax: + 381 11 366 0 601 www.mikroe.com Anders Larsson CTO Phone: +46 70 219 80 57 Fax: +46 920 750 10 www.rubico.com

wireless system integration AB

sloVeNiA University of ljubljana Andrej Stern Mobile Project Manager Phone: +386 31 625 892 Fax: +386 1 47 68 732 www.ltfe.org Jan-ke Lindqvist Phone: +46 70 55 54 917 Fax: +46 87 51 40 30 www.wsi.nu

UKRAiNe

comPeteNce ceNteR GloBAl

cetecom GmbH
Dipl.-Ing. Thomas Krause Phone: +49 20 54 95 19 248 Fax: +49 20 54 95 19 997 www.cetecom.com

DVA GRoUP
Kyryl Skyba Managing Director Phone: +380 50 44 37 456 Fax: +380 44 22 00 202 www.vdmais.kiev.ua

RFi Global services ltd.

Ashish Sikka Phone: +44 12 56 31 21 08 Fax: +44 12 56 31 20 01 www.rfi-global.com

For detailed information about Telits Competence Centers, please visit www.telit.com competence centers

120

TELITCOMPETENCE CENTER

telit2mARKet 06|11

TECHNoLoGY EVoLUTIoN AND THE CHALLENGES oF LTE MoDULE INTEGRATIoN

Stuart Thomas, RFI Global Services Ltd

>> With the drive towards always-on connectivity and the launch of commercial LTE networks starting to happen across the globe, system integrators are now looking towards LTE modems as the method of providing wireless high speed always-on connectivity. With the evolution of a new technology comes new technological challenges which have always been there with 2G and 3G technologies but become more complex with LTE. The four main areas of concern for system integrators of wireless devices are power supply, antenna design, USIM interface performance, and the application software driving the modem. The most challenging area out of these four is antenna design and with the large number of commercial frequency bands available globally this will present a major

challenge for products entering the global market as there will need to be hardware specific configurations for each region and/ or intended market. Figure 1 plots the number of frequency bands recognized by 3GPP that are commercially available or planned networks across the different technologies. With the wide range of operational frequencies specified for LTE, antenna hardware design and performance are going to be major challenges for system integrators using LTE modules and selling products in a global market which is divided in frequency bands.

# Frequency Bands / Technology Type

18 16 14 12 10 8 6 4 2 0 2G 3G LTE

Figure 1: Graph - the number of frequency bands per technology (January 2011)

telit2mARKet 06|11

TELITCOMPETENCE CENTER

121

Commercial LTE Frequency Bands

1475.9-1510.9

1495.9-1510.9

2300-2400

2570-2620 38

BS DL Freq (MHz)

Band

12

17

13

14

20

19

11

21

40

41

Figure 2: Frequency Band Allocation (January 2011)

MEASUREMENT Radiated Spurious Emissions Over the Air Antenna Performance

SPECIFICATIoN (LTE SPECIFIC) 3 GPP T S36.124 3 GPP T S37.976 and CTIA Over the Air Performance Test Specification

Table 1: Radiated Spurious Emissions and Over the Air Antenna Performance Specifications for LTE

Figure 2 below shows these frequency bands (as of January 2011). The two key measurements that are closely related to the antenna design are Radiated Spurious Emissions (RSE) and Over the Air Antenna Performance (Commonly known as OTA). Both of these characteristics are now being fully defined by organizations such as 3GPP and CTIA Wireless for LTE. The specific references are defined in Table 1. In the area of OTA there are some special considerations to be taken into account with respect to multiple antenna configurations and these specifications detail all the requirements for configurations such as SISO, SIMO, MISO and MIMO. The fact that multiple input

and/or output antenna configurations will be implemented brings additional challenges in their implementation such as achieving low envelope correlation between antennas, while within a small device, while achieving a large individual antenna mean effective gain. Measurement of multiple antenna configurations is going to be critical for successful deployment of LTE connected devices as they bring some major advantages, specifically the increase in the data rate. RFI as a specialist test and consultancy business is rapidly gearing up to provide these services and needed assessments enabling successful LTE device deployments. If you would like to discuss your requirements please contat us at: contactus@rfi-global.com <<

2620-2690 7

1805-1880

2495-2690

2110-2155

2110-2170

875-890

869-894

758-768

734-746

791-821

728-746

746-756

122

TELITPRESS

telit2mARKet 06|11

GLoBAL CoMMUNICATIoN
FoR A GLoBAL BRAND
Alexander Bufalino, VP Global Marketing at Telit Wireless Solutions
>> The core mission for the Telit Corporate Communications department is to establish a strong, reliable brand and implement targeted communication in support of the companys strategy, products, and services. Communication must create added value and this is the credo that Telit follows in its dialogue with customers, colleagues, share-holders and partners. The m2m market is undergoing rapid change and at the same time communication habits and structures are changing too. These developments have accelerated recently, especially in the wake of the economic crisis of 2008 and 2009. Telit needs to take account of these processes corporate strategy and communications need to evolve hand in hand. Strategy and communications hand in hand Telit responded to the uncertainty in the markets with a cross-media campaign, at the heart of which were video messages from Oozi Cats, Telits CEO. The take-away from these messages was that in these stormy times we are taking personal responsibility and have a solid strategy that protects the interests of all our stakeholders. This message was fully reflected in company actions that have followed since: Telit has invested more than ever, bucking the trend, becoming one of the few technology companies to emerge from the crisis stronger. Telit also continued this path in 2010 with its strategy fully reflected in its communication. Using targeted campaigns in eight languages, we have been able to establish ourselves at the international level as a

Funkschau; Germany; August 8, 2010; circulation 40,136; the future of m2m

wireless week; UsA; march 25, 2010; circulation 40,000: Presentation of new mHealth solution

telit2mARKet 06|11

TELITPRESS
platforms. These channels offer us an ideal opportunity to communicate directly with consumers of m2m technology and to factor their requirements and ideas more quickly and effectively into the development of our products. Youll find Telit on all the major platforms: on Twitter (www.telit.com/twitter), Facebook (www.telit.com/facebook), XING, LinkedIn, SlideShare, and YouTube. The value of our brand In just a few years, Telit became one of the worlds most well-respected strategic partners for companies that regard m2m as an important lever for their growth strategy. This development has been based on technological excellence; first-class service quality; and a focus on close, trusting, and long-term collaboration with customers and partners. Telit and its brand are strong proponents of these values. <<

123

strong brand and have successfully affirmed our role as a stable anchor in the m2m market. After the USA, Brazil, China, Korea, Italy, Germany, France, and South Africa, over the last year we steadily and successfully expanded our communication reach into the Eastern European and Russian markets. Direct dialogue our rule of thumb for communication selezione di elettronica; italy; June 23, 2010; Telits communication maxim is circulation 8,558 monthly; telit modules direct dialogue with our stakeholders dialogue that is professional, and analysis of the current and future possitrusting and most importantly on an equal bilities of m2m. footing. Just as with our products, we want to create added value with our communica- Alongside the more classical measures such tions: we want to provide an interpretation as articles, interviews and press releases, framework that facilitates an understanding we are stepping up our use of social media

SUCCESSFUL CoMMUNICATIoN THRoUGH ALL CHANNELS

Alexander Bufalino, VP Global Marketing, Telit Communication PLC and Christopher Intsiful, Senior Account Manager, Maisberger GmbH

>> Way to go Telit! Welcome to 2010

These were the words of a user who had a hardware question and asked it via the Telit_WS Twitter channel receiving an answer in a proverbial instant. A growing number of m2m players are using Twitter to engage us in a direct dialogue. For Telit, the micro-blogging service is a central element of its social media strategy. Therefore Telit not only provides a corporate Twitter channel in English but also channels in Russian, Taiwanese, and Korean.
Twitter has over 175 million users worldwide, making it increasingly more important for the B2B sector. In its digital halls, not only

private individuals but also companies, m2m experts, researchers and scientists can act as multipliers, helping achieve widespread dissemination of messages. The popularity of Twitter is but one piece of evidence of the irrefutable change in the communication landscape. Until now organizations would disseminate their news in a one-way direction just informing. Thanks to social media platforms and their new approach the one-way communication has become bidirectional. Users comment on topics, share their opinions, and exchange experiences among each other and

www.telit.com/twitter

www.telit.com/facebook

www.telit.com/linkedin

124

TELITPRESS
the companies. Going forward, to communicate efficiently with potential clients and partners it will not only be important to take part in online platforms but also to maintain the dialogue at eye level. This is a vital prerequisite for organizations to be viewed as opinion leaders in their industries. in English, Russian, Taiwanese, and Korean. With over 500 million users, Facebook is the worlds largest social media community. Since the majority of these users employ the platform primarily for personal interests, Telit is using this channel to explain the possibilities of m2m in a simple and straightforward manner, from a users perspective, placing the information in easy reach for a wide range of people. Telit is also launching surveys on Facebook looking to detect trends, stimulate debates, and foster new idea creation. There are no limits to the possibilities of the imagination. The topics range from intelligent washing machines that communicate wirelessly to the European eCall automated car emergency call system and beyond. Following suit are the business portals XING and LinkedIn both of which are quickly expanding into expressive branches of the social media network world. LinkedIn especially; with its membership of 75 million professionals represents a huge potential for establishing new and highly relevant business contacts. These business platforms are top-rate showrooms for the Telit brand. The aim in working these types of media is to establish business contacts more easily and quickly and to reach a pool of highly skilled individuals inside potential customers who will perceive the Telit brand in a positive light and be familiar with it as Telit reaches out and touches them for the first time through various marketing efforts. networking of channels is essential To ensure that the various channels are successful together, the different media need to be networked effectively. Together, they form a social media universe that helps bind users to Telit and provides them with specific information across all channels

telit2mARKet 06|11

and beyond. But in doing this, it is essential to be aware of regional and cultural differences. China, for example, is an important geography for Telit and Twitter is not a common platform there. Instead, the Chinese microblogging service t.sina and t.sohu are the channels of choice. Networked channels allow individual users to benefit from the expertise of the entire community, even if they are only using one information channel such as Twitter. The comprehensive integration of social mediabased communication into the companys website is also crucial for its success. The resulting network enables fans and followers to learn about the latest products, offers, and services from Telit. And they are just a click away from discussing their latest purchases on the social web with like-minded peers, obtaining advice from m2m experts or simply asking for support. Telit has from the start and continues to show that B2B companies can use social media channels successfully as long as its use and application are regarded as part of the overall communication strategy and are fully integrated into it. Only then will the full gamut of positive benefits contribute to the companys success. <<

And because it is essential that social media be fully integrated into the companys overall communication activities, Telit is not only providing its followers on Twitter with the latest news from the company, but is also serving up a wealth of in-depth information about m2m technology, infrastructure, and industry-specific solutions. By sharing messages, expertise, and actively getting involved in discussions, companies can position themselves as experts and thought leaders in the m2m space being perceived as partners by the community. This new way of communicating has developed so much that even support enquiries are now being sent and answered via Twitter. This creates an additional medium through which Telit is able to process questions from clients quickly, interactively, and in a straightforward manner perfectly in tune with the companys philosophy: to provide clients with first-class support and the best possible level of assistance through innovative technologies. Social media as an integral part of corporate communications The second pillar of Telits social media communication strategy are its Facebook presences

www.telit.com/youtube

www.slideshare.net/telitwireless

www.telit.com/xing

126

TELITPaRTNERSHIPS

telit2mARKet 06|11

DEUTSCHE TELEKoM LAUNCHES

INTERNATIoNAL M2M PARTNER PoRTAL

>> Deutsche Telekoms international m2m Competence Center bundles the activities and expertise of divisions from many different countries. This allows the company to work together with partners to offer comprehensive, innovative solutions around the world.

Jrgen Hase, Vice President M2M Competence Center

The forecasts are clear: Machine-to-Machine communication (m2m) will boom in the coming years posting double-digit growth. In m2m communication, end-user devices such as industrial robots, vehicles, pacemakers and containers automatically exchange information with each other or with a central monitoring office. m2m solutions lead to new services in many areas of business or make business processes more efficient. Companies can lower costs, increase efficiency and security, or even discover new uses for their products. New m2m applications will soon establish themselves in many different industries. The consulting group Detecon estimates that as many as 35 billion micro controllers are currently in use throughout the world to control machines. They are used in everything from industrial pumps to coffee machines. Every year, the tally grows by as much as 1 billion. And more than 300 million portable multimedia devices such as game consoles and digital picture frames are also sold every year every fifth one is already networked using Internet Protocol. According to

telit2mARKet 06|11

TELITPaRTNERSHIPS

127

estimates from market research firm Harbor Research, in 2010 about 500 million devices will be connected to each other. In the next five years, the experts expect annual growth of about 27 percent with the market reaching about 10.6 billion in 2011. Telekom: active around the world With more than 129 million cellular customers as well as 37 million fixed-line and 16 million broadband customers, Deutsche Telekom is one of the leading integrated telecommunications companies in the world. The company offers fixed-line, cellular, Internet, IPTV products and services for private customers, as well as information and communications technology (ICT) solutions for large and corporate customers. The company has operations in about 50 countries and employs more than 250,000 around the world. In 2009, Telekom had revenue of 64.6 billion and over half of it came from outside Germany. One of Telekoms goals is to develop and market new m2m applications together with partners for the B2B as well as the B2C

markets. In 2010 the company created the international m2m Competence Center to bundle and promote m2m activities with focus on cooperating with internal and external partners. Telekom m2m specialists work internationally and support national divisions in the different countries with the development of solutions which are viable internationally. They complement the domestic activities and also support them with expertise from international projects. All relevant information is gathered centrally, processed and made available to all countries national divisions. This makes local solutions and expertise available globally. Companies working together with the international m2m Competence Center of Deutsche Telekom also benefit on several levels. A central contact is designated and made available with international responsibility for all coordination and connections within Telekom. Partners also gain access to new markets outside their domestic market and companies that previously focused on a single country can rely on the centers expertise and support for international expansion projects.

Advantages our partners Partners profit from Telekoms international experience and can use our expertise to quickly and successfully complete global m2m projects. Also Partners have exclusive access to Telekoms m2m Partner and Sales Development. And Telekom also ensures these companies are in touch with each other. A solution partner in Telematics can, for instance, gain access to hardware manufacturers to our partner Telit, for example. Together with partners, Telekoms international m2m Competence Center can give the global machine-to-machine business an additional boost. Customers benefit from a shorter time-to-market and a broader portfolio of innovative products and solutions. If youre interested in a partnership with Deutsche Telekoms m2m Competence Center, please register on our m2m Partner Portal: www.telekom.com/m2m Contact: Jrgen Hase Vice President m2m Competence Center Internet: www.telekom.com/m2m

Wide range of application areas.

Entertainment Electronics Transport und Logistic Healthcare Energy

Vehicle Telematic Security Retail

telekoms aim is to address all vertical areas of m2m applications: from logistics and telematics; energy and commerce; to healthcare, security, and consumer electronics.
Ind. Automation

Public Sector

128

TELITPaRTNERSHIPS

telit2mARKet 06|11

M2M SoLUTIoN FACToRY SUCCESSFUL NETWoRKING WITH

DEUTSCHE TELEKoM
Thomas Pggel, Telekom Deutschland M2M Sales Development
2.3 million m2m SIM cards in use. In the next two years, this figure should more than double to 5 million. Application-specific m2m solutions m2m solutions are especially attractive because they create new income sources for companies while making devices and systems already in use more reliable and environmentally friendly. There are few standard m2m solutions most are developed to meet specific demands, making it vital for the various components and modules not only to conform to each other but also function together perfectly. In addition to connectivity through cellular networks, selection and integration of the most adequate m2m radio module(s) as well as the performance of software used in the devices and the target servers are crucial. >> To quickly and efficiently develop m2m The development of solutions usually takes several months from the initial idea to the delivery of a complete application. To quickly and efficiently develop solutions meeting complex needs, Deutsche Telekom created the m2m Solution Factory as a network of specialized companies spanning a good portion of the m2m value chain. The network currently includes Telekom Deutschland as a complete provider for connectivity, MATERNA GmbH (software company), and Telit; plus a number of integration partners. The network is continuously expanded to include more qualified partners. Customer advantages Companies benefit on a number of levels. Solution Factory m2m solutions can be quickly and easily implemented since the partners are experienced, work together and essentially develop turnkey solutions. The applications are also market-ready in little time, allowing companies to quickly step up their optimization efforts. Telekom Deutschland supports turnkey solutions with a number of highquality products such as the m2m Service Platform which allows software companies within the network to directly manage SIM cards using a software interface. Users can not only activate, monitor and suspend cards, they can also view detailed cellular call histories in real-time. This is a special advantage during service interruptions since the m2m Service Platform allows customers to quickly identify where the problem is, eventually avoiding the costs of an on-site repair visit. Network software companies can also develop individual product attributes based on the m2m Service Platforms new functionality, offering unique features for the entire solution that can then be directly transformed into benefits for the end-customer. For example: a construction equipment rental company can not only use m2m to gather operating information for improved maintenance planning, it can also keep tabs on the location of its equipment and temporarily disable it in case of unauthorized use. Access to all applications along the value chain with comprehensive software solutions The previous example illustrates how the m2m Service Platform can provide quick and easy access to all functions available on a cellular network. Customer-specific solutions developed by the Solution Factory network can not only monitor the devices themselves (m2m radio module and the software applications), it can also keep an eye on the network itself. Customers are no longer saddled with the cost of building and maintaining individual IT infrastructures. << Contact: Thomas Pggel Internet: www.telekom.com/m2m

solutions for companies with complex needs, Deutsche Telekom created the m2m Solution Factory to provide a network for horizontal solution providers.
Machine-to-Machine communication (m2m) is a small technological revolution that impacts our lives a little more each day. Intelligent and secure networking through cellular networks allows machines of every type from individual devices to complete systems to communicate with each other, and be monitored and maintained remotely worldwide. The advantages of m2m are becoming clearer in many aspects of daily life: driving will become safer, power consumption will become more transparent and easier to keep under control and monitoring our health will be simplified. Analysts see rapid growth in the m2m market in the coming years. According to the m2m Alliance, in Germany there are already

telit2mARKet 06|11

TELITPaRTNERSHIPS

129

SPRINT
Sprint Nextel

IS THE oNE TRUSTED PARTNER FoR M2M

>> open ecosystem, flexible Networks,

and proven Execution

According to ABI Research, over 79 million m2m devices are expected to be connected in North America by 2015.* That same year, the North American cellular m2m connectivity market is forecast to reach $6.6 billion.** To help innovators capitalize on this explosive market and move the m2m industry forward, Sprint has implemented several very impressive initiatives. Of greatest significance is Sprints unique, OPEN-ecosystem approach to helping companies rapidly develop and launch new m2m devices and applications. Sprint firmly believes that the key to m2m success hinges upon open standards, open applications and devices, and focusing on creative problem solving. Sprint has launched a number of innovative devices and m2m solutions, many of which feature fine Telit modules. In fact, Sprint is so passionate about this open philosophy they created a cutting edge m2m Collaboration Center to give innovators an optimal development environment. This facility brings together all the players necessary to launch innovative m2m ideas: application developers, device manufacturers, distributors, designers, and integrators. According to Danny Bowman, President of Sprints Integrated Solutions Group, the goal is simple. The Sprint Collaboration Center is all about bringing the right community members, and the right expertise to bear in a roll-up-your-sleeves workshop thats designed to get m2m ideas into market as quickly as possible. Another major step that Sprint has taken to advance the m2m industry is the Sprint Command Center, an online portal that allows businesses to control m2m provisioning, billing, device and service management all from one centralized and secure location. With Sprint Command Center, businesses can implement many automated or on-the-fly device management features for a single device or thousands of devices. Command Center also offers companies advanced m2m billing solutions and a range of policy enforcement tools designed to greatly enhance m2m management control. When it comes to the NETWORK, Sprints 4G technology delivers a fast, dependable experience even on a network with millions of users. Sprint 4G is an asset when it comes to tackling massive data usage and streaming video. In addition to bringing the first and ever-expanding 4G network, Sprint offers customers a dependable CDMA network, which enables companies to meet their individual data needs.*** Lastly, Sprint provides unrivaled EXECUTION with more than 10 years experience bringing m2m initiatives to market quickly and successfully. Sprint has a wide portfolio of solutions for a host of devices across a broad range of industry verticals including healthcare and wellness, public safety, sustainability, and connected transportation. Sprints commitment to an open development philosophy, a wide portfolio of networks, an ecosystem of partners and strength in bringing m2m products and solutions to market are just a portion of what makes the company such an attractive m2m partner. To learn more about Sprint and get details on how Sprint is helping companies develop and deploy tomorrows technology today, visit sprint.com/m2m. <<
* ABI Research, Dec/2010 ** ABI Research, 08/2010 *** First wireless 4G network from a national carrier. Sprint 4G is available in over 70 markets and counting. See sprint.com/4G for details.

130

TELITLIvINg

telit2mARKet 06|11

tReAt commUNicAtioN As A coRe PRoDUct!

>> Most companies would confidently

claim to have their product portfolio under control, regardless of whether they provide products or services. We believe, however, that most companies dont know their portfolio at all, which probably sounds rather odd, but its true.
First of all, lets think about what a product actually is. People would usually consider a product to be something a company manufactures, processes, or refines and then goes on to sell for a profit, thereby contributing to increase the corporate value. And in this respect, companies do indeed know their products quite well. After all, they have sales teams, product and service management, key account organizations, and they undertake market research, supply chain analysis, direct costing and much more. The departments involved in the product portfolio research and development, purchasing, production, sales make up a companys core functions. These departments also have the

most members sitting on the board. So, yes, companies do take their product portfolio seriously; in fact, theres nothing a company takes more seriously than its product portfolio. That is, if youre looking at a product from this traditional point of view. But you can also take another perspective and consider all that a company generates as output to be its product. From this perspective, a mechanical engineering companys portfolio would include machines, the waste water generated during the production process and even the apprentices under training. And, of course, communication. Particularly communication. Its an output that no company can avoid. From product to output From an economic and sociopolitical perspective, this does indeed make sense and is reflected in processes and structures for instance, when we talk about companies financial responsibilities for their CO 2

emissions or when we reward them for contributing to apprenticeship programs. And, of course, when communication crises develop into company crises and pose real threat to corporate value. Nowadays, it is essential that companies focus on their output. Long gone are the days when customers, employees, partners, NGOs, governments, the financial community and the media were only interested in a companys products in the traditional sense. When it comes to evaluating a company, even in economic terms, greater importance is now being attached to its entire output, especially to its communication. It is therefore high time that companies move from product management to output management. Essentially, this means that they need to manage all elements of their output portfolio proactively and professionally and view them as core functions that drive corporate value.

telit2mARKet 06|11

TELITLIvINg

131

Dr. Alexander Pschera, Managing Director of communication consulting firm Maisberger; Dimitrij Naumov, Associate Director at Maisberger

A call for a new perspective on communication In terms of communication, this has been something of a rarity until now. This is demonstrated by the role given to communication in the average organization. According to a study by the University of Leipzig, Germanys leading institution for communication studies, one in two companies treats communication as a staff function, meaning that it is not considered as important as core corporate functions. As a result, communication is set apart from the logic of product management. Communication is mostly seen as support to the core business, not as an area that directly contributes to corporate value creation. However, it is hardly surprising that, in largely saturated and highly competitive markets characterized by a high degree of service complexity, a company has to sell stories and interpretations along with traditional products, if it is to convince stakeholders. But thats not to say that we can point the

finger at chief product officers or chief sales officers. In fact, PR departments are equally responsible for the situation companies find themselves in presently because even in PR, people are only slowly realizing that communication has to be viewed as a product. Communication markets become more and more competitive So what exactly do these insights mean for corporate communication? First and foremost, it is vital to subject the PR departments products stories, messages, patterns of interpretation to a process of professional product management. These forms of communication have to be designed, engineered, checked for quality and tested. They require target group-oriented planning and robust budgeting. They need a market price and their success has to be measured. Is the product selling? Or is it not doing so well? A companys communication products also require effective and efficient key account management. After

all, they are addressing a wide range of large or strategically important accounts. The competition that companies and organizations presently face is becoming increasingly more global and intense. And, thanks to the Web 2.0, this competition is now characterized by unique transparency and mobility factors, present in markets for goods, services, as well as communication. So far, only a few companies have evolved the traditional product orientation into this next stage: companies that have gone on to built a strong sociopolitical and therefore economic position as a result of professionally managing their entire output and in particular their communication. It would be very negligent indeed not to follow their example. So lets start treating communication as a core product! <<