2011intl Medicla Equipment

Laboratory Equipment
for the Life Sciences

INTERNATIONAL EDITION
Muscle Physiology Epithelial Physiology
page 2
page 18
Microdissecting, Microsurgery
page 30
Animal Surgery & Support

page 42
Biosensing
page 62
Amplifiers, Electrometers Stimulators
page 83
Scientific Instruments Heidelberg, a division of WPI, offers a comprehensive line of muscle physiology products
page 106
Glass, Holders, Electrodes

page 117
Laboratory Supplies
page 130
Micromanipulators Microscopes, Cameras Microforges, Pullers
page 144
page 160
page 174
Pumps, Microinjection Spectroscopy
page 181
page 205
Index
page 224
World Precision Instruments
2011
Expanding Your Reach

Check out WPI's Newest Research Tools
Muscle Physiology
SI-H Basic Muscle Tester, the basic tool for muscle research, is completely modular in design, allowing for the addition of a linear motor or laser diode. Page 5 Small Animal RFID Tagging system uses the world's smallest RFID tagsonly 1x6mm. It is easy to configure. Plus these RFID tags are read and writeable. Now, you can easily track an animal for its entire life! Page 60
Surgery Related Equipment

SI-H Muscle Tester MKB is a comprehensive instrument spanning the muscle physiology field, and it has many optional features. Page 7 MPM-7 offers portable and reliable multi-parameter monitoring of animals. Seven core parameters include ECG, heart rate, NIBP, pulse oximetry, respiration rate, apnea trends, temperatures and trace freeze simultaneously. Page 55
The SI-H Compact Landgendorff needs no glass columns. It has both Langendorff and working heart perfusion modes. Page 12
VSP1 Medical grade syringe pump offers exceptional accuracy and stability coupled with safety features that are crucial in the animal health care environment. Page 202
The SIH Vertical Tissue Baths are isolated tissue bath systems developed for in vitro investigation on isolated smooth, cardiac or skeletal muscle preparations. The feature low volume, calibrated chambers and a lifetime warranty on force transducers. Page 14
Microfluidics
Designed for control of fluids in the nanoliter and microliter ranges, the SA-MFCS eliminates the hysteresis, long equilibrium times and pulsing problems of other pumps in the low volume ranges. It's highly accurate with a short response time (40ms) and excellent stability. Page 204
The SI-H Langendorff system is designed as a perfusion system for isolated, small mammalian hearts. The system includes the stainless steel sink, a small reeling pump and specially designed two-way Teflon taps. A Neely system is also available. Page 10
Pipetters
Highly accurate Crystal Pipetters are available as single-channel, 8-channel and 12-channel, and also in sets. Repeating pipettes with a reservoir for dispensing multiple aliquots are also available. Page 191
Signal Conditioning Amplifier System

Install up to eight modular units in one convenient system. Units include stimulators, isolators, amplifiers, free radical analyzers and muscle physiology accessories. Page 94
Tools for Molecular Biology

l Electroporation l Electrophoresis l Centrifuges l Shakers l Vortex mixer l Hotplates l Stirrers See the new line of molecular biology tools online at www.wpiinc.com/newtools.
Animal Physiology
Analgesia Testing equipment for mice and rats includes Electronic VonFrey, Plethysmomoeter, Randal Selitto Paw Pressure meter, Grip Strength meter, Incremental Hot/Cold Plate, Incapacitance meter, Hot Plate meter, Plantar Test Apparatus and Tail Flick Test. Page44
Muscle Physiology . . . . . . . . . . . . . . . 2
Blood Pressure Measurement l Stereotaxic Instruments Animal Temperature Controller l Microprobe Thermometers
Epithelial Physiology . . . . . . . . . . . 18
Epithelial Voltohmmeter l TEER Measurement l Ussing System Perfusion System Glass Bottom Culture Dishes
Microdissecting, Microsurgery . . . . 30
Scissors l Tweezers l Ear Punches l Vessel Clips l Mouse Surgery Kit l Electrosurgical Unit l Cautery Instruments
Animal Surgery & Support . . . . . 42

EZ Systems l Analgesia l Stereotaxic l Monitoring
Biosensing . . . . . . . . . . . . . . . . . . . . . 62
Nitric Oxide Detection l Ion Selective Electrodes l Oxygen Detection l pH meters
Amplifiers, Electrometers . . . . . . . 83
Intracellular l Extracellular l Transducer Metal Microelectrodes l Voltage/Current Clamps .
Stimulators . . . . . . . . . . . . . . . . . . . . 106
Digital Stimulators l Multi-Channel l Linear Stimulus Isolator l High Current Isolator
Glass, Holders, Electrodes . . . . . . 117

Capillary Glass l Electrode Holders l Metal Microelectrodes l MicroFil Non-metallic Syringe Needles
Laboratory Supplies . . . . . . . . . . . 130

Adhesives l Cables & Connectors l Metal Wire l Luers & Fittings l Laboratory Bases, Rods, and Clamps
Micromanipulators, Stands . . . . 144

Manual & Motorized Micropositioners l Magnetic Stands l Tilting Base
Laboratory Equipment
Microscopes, Cameras . . . . . . . . . . 160

Surgical, Stereo, and Inverted Microscopes l Cameras l Illuminators l Heater Controller l Culture Dishes
Microforges, Pullers . . . . . . . . . . . . 174

Pullers l Bevelers l Microforges
Pumps, Microinjection . . . . . . . . . 181

Peristaltic, Syringe, and Pneumatic Pumps l Microprocessor Controlled Injector
2011
Spectroscopy . . . . . . . . . . . . . . . . . . 205
Spectrometers l Sample Cells l Light Sources l Fiber Optic Cables l Fiber Optic Dipping Probe
Index . . . . . . . . . . . . . . . . . . . . . . . . . . 224
Ordering Information, Terms & Conditions . . . . . . . . . . . . . . . 232
Front cover background image Copyright Dennis Kunkel Microscopy, Inc.
Muscle Physiology
M U SCLE PHYS IOLOGY Scientific Instruments Heidelberg, a World Precision Instruments company, offers a comprehensive line of muscle physiology products . Contact your local WPI office or distributor for more information .
Modular Systems for All Your Muscle Studies
Types of Studies
The SIH product line has solutions for cellular, tissue, and whole muscle studies, including skinned muscle fiber preparations . We also have an instrument for long-term culture/preservation of intact muscle . All common myomechanical studies in muscle can be performed, such as isometric and isotonic contractions, eccentric contractions in skeletal muscle and after-loaded contractions in cardiac muscle . In addition, optical techniques are available for measuring sarcomere spacing, intracellular calcium, and myosin ATPase activity concurrently with the mechanical studies . Automated force-pCa studies are possible, as are measurements of membrane potential and oxygen tension/consumption .
Features
SI-H systems are modular in design and easily expandable wherever your research or applications may take you . The foundations of the systems are indestructible, optical force transducer (KG series) and temperature-controlled tissue cuvette assemblies . The systems can be simple or sophisticated standalone systems . Also, there are systems that can be adapted to inverted microscopes for fiber or even single cell work . A linear motor expands the scope of mechanical studies . Optical components provide ultrastructure information on sarcomere spacing, calcium or ATPase activity in the muscle fiber . Most components are sold separately so you can customize your existing system or build your own research setup .
Overview of SI-H Research Platforms . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Basic Muscle Tester . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 KG Optical Force Transducers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 MKB Muscle Research System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 OPT Muscle Research System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Isolated Perfused Organ System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Langendorff Isolated Perfused Heart System . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Neely Isolated Working Heart System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Compact Langendorff . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Vertical Tissue Bath . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Biotester 5000 Biaxial Test System for Biomaterials . . . . . . . . . . . . . . . . . . . . 16 MicroSquisher Micro-Scale Compression System . . . . . . . . . . . . . . . . . . . . . . . 17 MechanoCulture Strainable Substrate for Culturing Cells . . . . . . . . . . . . . . . . 17
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office.
UK: Tel: 01438-880025 wpiuk@wpi-europe.com
Germany: Tel: 030-6188845 wpide@wpi-europe.com
China: Tel: 21 68885517 chinasales@china.wpiinc.com
SI-H Systems Offer Choices and Convenience

Intact muscle stripsThe Muscle Tester (MT) is the all-round system of choice for all mechanical studies on intact muscle (skeletal, cardiac, or smooth) that do not require simultaneous optical measurements . The muscle tester allows simultaneous recording of membrane potential and signals from other electrodes or sensors in the bath . The system can come with a complete muscle data recording and analysis system (DAS) or a hardware adapter (MACP) to connect to your own data acquisition system . Intact muscle strips and skinned muscle fibersIf you are planning to extend your research into the molecular mechanisms and biochemistry of force development on actinmyosin interaction or the study of ancillary proteins such as troponin or titin, then the MKB Muscle Research System is your choice . This is the most stable platform for advanced, precision and sensitive measurements . With the optional calcium gradient system (GRDM) and calcium photometry, you can perform very accurate force-pCA curves in very small volumes down to 500 L . The cuvette system can also be cooled to allow accurate Q10 studies while better preserving the sarcomere ultrastructure . If your research involves actual measurement of the ATPase activity via fluorescence or intracellular calcium in intact skeletal or cardiac muscle strips, trabeculae or papillary muscle, the OPT Muscle Research System is the platform of choice . This system offers an optimized light path design and special cuvettes for precision imaging and photometry in combination with the mechanical studies in both intact and skinned fibers . Both systems are stand-alone platforms with complete data acquisition and analysis (DAS) . Long term culture of muscle fibersThe Long-term Muscle Culture System (LTMT) allows you to keep intact muscle fibers from skeletal or cardiac muscle alive and working for up to one week . The system allows all the mechanical tests and calcium imaging to be performed on the muscle in a sterile, gassed, closed, controlled environment . Protein exchange, viral transduction and RNA interference studies on muscle are now possible in a cost-effective system . Application specialists can help you discuss what can and has been done with this system . Contact us for details and to discuss your application . Single muscle cell studiesThe combination of a very sensitive optical KG force transducer and a micro-piezo nanomotor makes studies on single muscle cells possible . In the Cell Tester, a dual remote controlled microtweezer system with special biocompatible coating allows cells to be grasped and manipulated as if they were large fibers or cell clusters . The system is meant to be integrated on two micromanipulators and an (inverted) compound research microscope . The pair of microtweezers or microplates with tip sizes down to 20m, are embedded in a pN-sensitive transducer on one side of the system and piezo-based nanomotor on the other that can be moved with 20nm precision . External computer control allows you to design length change protocols and to measure optical responses such as confocal calcium or other live cell functional markers . Contact us for details and to discuss your application . Accessorize all of our systemsThe KG force transducers with different ranges are inter-exchangeable among all platform and amplifiers . All cuvette systems are heat controlled to 34-40C or have a cooling option down to 5C or any temperature in between .
M U SCLE PHYS IOLOGY
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc .com Internet: www.wpiinc.com
Overview of SI-H Research Platforms
SI-H research platforms cover a broad range of muscle physiology experiments, from single cell platforms to whole organ perfusion systems . While the cost of a platform may vary dramatically depending on the options
chosen, this overview is designed to present the variety of options available . Our staff physiologists are available to discuss your specific needs and design a system with the options you need .
SI-MT Basic Muscle Tester Platform (choose from one of three cuvettes)
Part Number SI-MT-L SI-MT-S SI-MT-O The systems include: Base plate with force transducer holder, force transducer with tissue mounting supports and calibration stand, bridge amplifier with temperature control, microscope with mounts, cuvette with stand, oxygenation and vacuum systems, digital micrometer System Description Variations Optional Kits Muscle perturbation studies with linear motor Muscle tester long bath - For recording isometric contractions from Includes long cuvette an motor control units intact muscles, muscle fibers and muscle rings Sarcomere length detection Muscle tester short bath/recirculating - For recording isometric Small-volume cuvette with recirculation feature Includes short cuvette contractions from intact muscles, muscle fibers and muscle rings Data acquisition Field stimulation Muscle tester optical cuvette bath - For recording isometric Includes optical cuvette (with window) Linear motor action control panel contractions from intact muscles, muscle fibers and muscle rings
SI-MKB Standard Muscle Research Platforms with Micrometer

Part Number SI-MKB-OXY SI-MKB-WIND The systems include: Base plate with force transducer holder and microscope stand, cuvette table, cuvette and vacuum system, digital micrometer and stand, force transducer with tissue mounting supports, bridge amplifier with temperature control, microscope and stand System Description Variations Optional Kits System for intact muscles and fibers with heated cuvette, digital Data acquisition Includes standard cuvette micrometer Field stimulation Sarcomere length detection (SI-MKB-WIND System for intact muscles and fibers with heated optical cuvette (with Includes optical cuvette (with window) only) window), digital micrometer
SI-MKBM Standard Muscle Research Platforms with Linear Motor

Part Number SI-MKBM-OXY SI-MKBM-WIND SI-MKBM-LLCUV SI-MKBM-CUVA/B SI-MKBM-DUO SI-MKBM-TJUMP The systems include: Base plate with force transducer holder and microscope stand, cuvette table, cuvette and vacuum system, motor holder, force transducer with tissue mounting supports, bridge amplifier with temperature control, microscope and stand, linear motor, anti-oscillation unit and stand, motor control unit System Description Variations Optional Kits Myomechanical study of intact muscles and fibers with heated cuvette, Includes the standard cuvette linear motor Optical study of intact muscles and fibers with heated optical cuvette (with window) for sarcomere length studies System for intact or skinned fibers in a laser level cuvette with linear motor System for skinned fibers in multiple vessels with linear motor Includes optical cuvette (with window) Includes the laser level cuvette Includes Teflon cuvette inserts and a circulating water bath Data acquisition Field stimulation Sarcomere length detection (SI-MKBM-WIND only) pCa-Force Measurements with Automated Gradient method (Si-MKBM-LLCUV only)
Semi-rapid system for temperature jump studies of intact muscles and Includes a Peltier cooling circuit fibers, with 2 cuvettes (1 heated, 1 cooled) and linear motor Rapid System for Skinned Fibers at Different Temperatures with Linear Includes a Peltier cooling circuit Motor (Rapid, < 250ms temperature jumps)
SI-MB Tissue / Organ Bath Systems

Part Number SI-MB4 SI-MB8 The systems include: Base plate and frame, tissue chamber assemblies, buffer reservoir assemblies, single plane manipulators, tissue holders and vascular ring hooks, force transducers and bridge amplifiers System Description Variations Optional Kits Data acquisition 4 Chamber Modular Tissue Bath System Circulating water bath 8 Chamber Modular Tissue Bath System System comprised of two SI-MB4 systems Stimulator
SI-LANG Isolated Perfused Organ Systems

Part Number SI-LANGWH The systems, except for the SI-LANGC, include: Table with base plate, shelf, sink, consule, perfusion buffer column, glass overflow tube, Teflon tap valve, , pressure sensor holders (2), oxygenation bubbler set, oxygenation pressure equalizer set, peristaltic pumps (2), circulating water bath, pressure transducer cables, latex balloons System Description Variations Optional Kits Includes heart suspension unit, heart chamber, Unipolar or bipolar manipulator lung column, elastic chambers (2), cannulas, Perfused Working Heart (Langendorff Neely) afterload regulation adapter, basic analog flow Temperature probe meter Monopolar action potential sensor Langendorff Isolated Perfused Heart, Retrograde perfusion, single Includes heart suspension unit, heart chamber, a Data acquisition buffer column heater, spindle syringe (cannula, tube, syringe) Inline flow sensor and meter Includes heart suspension unit, heart chamber, a Langendorff Isolated Perfused Heart System, dual buffer column Pressure transducer and temp probe amplifier heater, spindle syringe (cannula, tube, syringe) Force transducer and amplifier Includes Compact system with constant pressure Biopotential amplifier Compact Langendorff & Isolated Heart System, compact buffer controller and temperature controller, peristaltic reservoirs pumps, pressure transducer with cables, latex balloons. Includes temperature controller Stimulator Data acquisition Inline flow sensor and meter Perfusion Bath for liver of mesentery China: Tel: 21 68885517 chinasales@china.wpiinc.com
SI-LANG1 SI-LANG2
SI-LANGC
SI-IOPKIDNEY
Isolated Perfused Organ (Kidney) System
Basic Muscle Tester

The Muscle Tester is a convenient platform for all standard mechanical experiments on intact muscle preparations. The system can be equipped with any one of five different KG optical force transducers over ranges that are as high as 02N and sensitivities as low as to 1N. Transducers come with interchangeable tissue holders designed for general or specific applications on skeletal, cardiac or smooth muscle, with or without tendons attached. The bridge amplifier (SI-BAM21LC) has integrated heat control for one of three possible perfusion cuvettes. The basic system can be used for isometric force measurement with direct point stimulation of the muscle through the transducer and mounting supports. Field stimulation is also possible. A very fast linear motor (SI-MOTTEST) can be added to replace the standard digital micrometer. When the motor is used in combination with one of the available motor control units, various studies can be performed on muscles that include: l l l l l l l l l l Isotonic contractions Constant load Force-velocity Isometric contractions Length-tension Slack test Quick stretch-release Constant velocity Afterload Vibrations (sinusoidal/muscle stiffness).
Modular Flexible Expandable
The Muscle Tester can be equipped with a complete data acquisition and analysis package (SI-DAS) for muscle physiology and mechanics. Alternatively, a hardware control device (SI-MACP) allows you to perform all tests while recording the data on your own data acquisition system. The Muscle Tester can also be equipped with either of two laser based detectors for determining sarcomere spacing (SI-SARCSCR or SISARCCAM). The MT system is a stable platform for conducting mechanical muscle studies. It is a complete turnkey system with a modular design that is constructed with corrosion-free materials (stainless steel, anodized aluminum, plastic).
Key Experiments
l Measure isotonic force and the effects of constant load l Measure Isometric force and myomechanical properties l Analyze twitch kinetics and determine parameters like time to peak, half-maximal velocities, Starling curves l Control stretch and release velocities to perform slack, quick stretch-release, constant velocity, and eccentric contraction tests l Measure afterloaded contractions from cardiac muscles l Conduct vibrational studies to simulate unloaded muscle shortening l Determine sarcomere length and spacing using a laserbased system
SI-MT-L SI-MT-S SI-MT-O
Muscle Tester Long cuvette Muscle Tester short cuvette Muscle Tester cuvette with optical Window
System includes: Base platform, transducer holder, digital micrometer, peristaltic pump, one KG force transducer, a set of tissue mounting supports, bridge amplifier, temperature controller, binocular scope, oxygenation/ vacuum system and choice of a long (L), short (s) or optical (o) cuvette with a window (for use with the laser-detection system)
OPTIOnaL COMPOnEnTS SI-MOTTEST Linear motor with power amplifier SI-aOSU Anti-oscillation unit (eliminates resonance frequency from measurement) SI-LCU Length control unit for slack test, quick stretch/release, constant velocity SI-COLU constant load unit, isotonic contractions SI-ErG ergometer unit for after loaded contractions (e.g., heart muscle) SI-VIBU Vibration Unit (vibration, stiffness and sinusoidal studies) SI-DaS Data acquisition/analysis system (controls stimulator and all length devices) SI-MaCP Motor Action control panel (motor control when using your own DAQ) SI-SarCSCr Laser based sarcomere spacing, manual SI-SarCCaM Laser based sarcomere spacing with linear camera, electronic >250Hz
MUSCLE TESTEr SPECIfICaTIOnS

Force MoTor MIcroscope 0-10, 20, 50, 500mN, 2N 7mm range, 200m/s speed 1.5N pull force indefinitely, 100N for 20ms 4.5-45x (specify objective) Binocular or Trinocular scope
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
KG Optical Force Transducers
lifetime warranty
A force transducer series with a range and sensitivity from the pN to tens of newton range Nearly insensitive to temperature and light Extremely linear Virtually indestructible with normal use Different transducer bodies can be exchanged and set and zeroed to the same bridge amplifier at the touch of a button. After a simple calibration with an appropriate weight, the system is ready for use.
SI-TM10
TrAnSdUCEr SPECIFICATIOnS Unloaded transducer without tissue mounting support

Force range SI-KG2 SI-KG2A SI-KG4 SI-KG4A SI-KG7 SI-KG7A SI-KG7B SI-KG20 SI-KGxx 0-2 n 0-0.5 n 0-50 mn 0-20 mn 0-5 mn 0-5 mn 0-10 mn 0-0.2 n range 0-200 g 0-50 g 0-5 g 0-2 g 0-0.5 g 0-0.5 g 0-1.0 g 0-20 g noise 250 n 300 n 15 n 4 n 0.2 n 0.4 n 1 n 80 n 0.5 1 10 5 1.5 1.2 kHz 1.2 kHz 250 Hz 500 Hz 550 Hz 590 Hz SI-TM9 Compliance (nm/mn) 150 resonance Frequency 1.3 kHz SI-TM7
SI-TM11
SI-TM2
contact us for specialty transducers with different ranges.
Mounting Supports include a choice of hooks, baskets, tweezers for general purpose, skeletal (with/without tendon), smooth muscle and cardiac muscle (papillary/trabeculae) fibers. Contact wpI for a list of current supports.
Optical Force Transducer Amplifier

BAM21-LC SPECIFICATIOnS
Input ConfIgurAtIon gAIn output ImpeDAnCe power output rAnge Current to voltage converter 1x, 2x, 5x, 10x Switch selectable 100 W 12 VDC at 3 A (wall adaptor) 0-10 V
SI-BAM21-LC optical transducer Amplifier, Single Channel mt/mKB/opt/mB/LAng
The BAM21-LC is also available as a module for the new Signal Conditioning Amplifier System see page 94.
MKB Muscle Research System

The MKB is the standard muscle research system designed for use primarily on intact living muscle preparations. The system combines the versatility of the sensitive KG optical transducer series with a solid platform on which mechanical and optical measurements can be performed. The MKB system can also be used for skinned muscle fiber preparations held at different temperatures or concentrations of buffers for various periods of time. The MKB platform can be equipped to span nearly the entire muscle physiology field and its wide range of applications that include quickly moving intact or skinned fibers between different solutions or temperatures. It can be equipped with a single optical device, like a photometer or a laser diode, and a linear motor and controller. Like the MT and the OPT systems, the MKB system MKB is complete turnkey system with a modular design that is constructed with corrosion-free materials (stainless steel, anodized aluminum, plastic). MKB systems include: Base platform, transducer holder, motor holder, cuvette table, cuvette(s), microscope holder, and vacuum system. (Does not include: transducer, bridge amplifier, microscope, temperature controller, linear motor, motor control unit, or data recording system). FOR INTaCT MUSCLE PREPaRaTIONS SI-MKBM-OXY System with Heated Cuvette & Motor SI-MKBM-WIND System with Heated, Optical Cuvette & Motor SI-MKBM-DUO System with Two Cuvettes (one heated, one cooled) & Motor SI-MKB-OXY System with Heated Cuvette & Micrometers SI-MKB-WIND System with Heated, Optical Cuvette & Micrometers FOR SKINNED MUSCLE FIBER PREPaRaTIONS SI-MKBM-CUVa/B System with multiple heated cuvette wells & Motor SI-MKBM-TJUMP System with multiple cuvette wells at three different temperatures & Motor SI-MKBM-LLCUV System with laser leveled cuvette for sensitive force measurements or calcium gradients & Motor
KEY EXPERIMENTS
l l l l l l l l l l Measure intact muscle responses to electrical stimulation, including tetanizing frequencies. Measure myomechanical properties of contracting and relaxing muscle strips. Measure isotonic force and the effects of constant load Measure and analyze twitch amplitude and kinetics, including: time to peak, half maximal contraction and relaxation times and velocities, starling curves, and diastolic force development. Control stretch and release velocities to perform slack, quick stretchrelease, constant velocity, and eccentric contraction tests Measure afterloaded contractions from cardiac muscles Conduct vibrational studies to simulate unloaded muscle shortening Conduct quick temperature-change experiments on skinned and instact muscle fibers Determine sarcomere length using laser diode diffraction as muscle force is also being measured. Conduct force-pCA studies and acquire background information with a automated calcium gradient maker (GRDM).These determinations can be combined with calcium measurement.
MKB systems use some of the same components that are used on MT systems: Linear motor with power amplifier (SI-MOTTEST); anti-oscillation unit (SI-AOSU); motor control units (LSI-CU, SI-COLU, SI-ERG, SI-VIBU); laser-based sarcomere spacing unit (SI-SARCSCR, SI-SARCCAM); data acquisition unit and software (SI-DAS & SI-MUSCLEDATA); motor action control panel (SI-MACP).
Optical Measurements from Muscles using SI-H Research Systems

Sarcomere Length and Spacing
Two options, SARCSCR or SARCCAM: Use either with MT, MKB, or OPT muscle systems on intact muscle fibers Use either with MKB or OPT muscle systems on skinned muscle fibers . Use either with any system while myomechnical parameters are measured . Use either with MKB or OPT system while doing calcium imaging . SARCSCR system uses a screen to display and measure the diffraction pattern of the light . SARCCAM system uses a linear diode array detector and a calibrated controller to detect the laser diffraction pattern . SARCCAM with optional PICO unit stores and records the Gaussian distribution of sarcomere lengths . Pico unit recommended when measuring changes in calcium concentration at temperatures above 5C .
ATPase Activity
Used on skinned muscle fibers . Measures the increase in ATPase activity by measuring the decrease in fluorescence of NADH with a photometer . NADH is a component involved in the binding and release of crossbridges in the myofibrils . ATPase activity system includes: the UV light source; photometer; and a cuvette of the appropriate size for the skinned fibers being examined . Optional automatic gradient maker for conducting pCa-ATPase and pCa-force studies can be added to the system .
OPT Muscle Research System

The OPT Muscle Research System is primarily designed for advanced optical measurements on intact and skinned muscle fibers under precise mechanical control . The system has excellent mechanical stability and can be equipped with multiple optical devices, like photometers and laser diodes, and linear motors and ultra-sensitive force transducers . The system is also versatile enough to be used for intact muscle studies . It is recommended that this system be placed on a vibration isolation table or very stable platform . The OPT system is a complete turnkey system with a modular design that is constructed with corrosion-free materials (stainless steel, anodized aluminum, plastic) .
Intracellular Calcium Concentration

Used on intact muscle fibers . Measures the change in the intracellular calcium concentration in muscle fibers that occurs when the sarcoplasmic reticulum releases calcium that is required for the binding of myosin and actin in myofibrils . SIH calcium imaging system compensates for the concentration and distribution of dye in the cells . Uses quickly (<75us) alternating wavelengths of incident light . Can easily be adapted for use on ZEISS or OLYMPUS inverted microscopes .
For information on system configurations and pricing, please contact our staff physiologists .
Isolated Perfused Organ System

l Internal heater/controller for the organ bath l Supplementary thermostat in the organ bath l Constant oxygenation of the buffer
Perfusion Chamber
Each perfusion chamber has an organ holder, water bath, heater, vaporizer, perfusion inlet and outlet, thermosensor port, supplementary thermostat, mesh organ fastener, acrylic lid, and blood vessels and ureter ports .
Optional Accessories
The following accessories may be added to complete your system: Pressure transducer Temperature probe Bridge amplifier Flow sensor and monitor Ball-mounted stimulating and recording electrodes Data acquisition system Stimulator Peristaltic pump Circulating water bath Liver/gut perfusion chamber
Perfusion Column Circulating Pump
The perfusion chamber, the most critical part of the system, has autonomic thermoregulation. The system is equipped with a kidney chamber. A liver/mesenteric bed chamber is optional.
Glass Tube (Set hydrostatic pressure/overflow) Perfusion Pump 2-Way Teflon Stopcock
A Constant Pressure Mode B Constant Flow Mode
The Isolated Perfused Organ (IPO) system is designed as a perfusion system for isolated, small mammalian organs like the kidney, liver or mesenteric bed. The SI-IPOKIDNEY system is designed for in vitro investigations of the perfused kidney of small laboratory animals like mice, rats, hamsters, guinea pigs and rabbits . An optional perfusion chamber for liver and mesenteric bed (gut) is also available . During experiments, the artery of the organ is cannulated and perfused with a buffer solutions using either constant pressure or constant flow mode . Then, you can measure the changes in the perfusion pressure . If desired, the effluents can be collected for biochemical analysis .
Flow Meter Sensor 3-way Stopcock Pressure Transducer
Gas Tank
Perfusion Reservoir Gas Pressure Thermostat Controller
Organ Bath
Heater
Features
l Constant flow and constant pressure modes l Can be equipped to measure perfusion pressure, arterial flow and buffer temperature l Perfusion pressure up to 120mmHg l Maintain buffer temperature with waterjacketed reservoir l Lubricant-free Teflon taps l External circulating water bath for the buffer reservoir ISOLATED PERFUSED ORGAN SYSTEM SI-IPOKIDNEY Isolated Perfused Organ (Kidney) System
Included: Heated tissue bath Table with base plate Console Perfusion buffer column Glass overflow tube Pressure sensor holder Oxygenation bubbler set Oxygenation pressure equalizer set Silicone tubing set, cables, accessories Peristaltic pumps (2) Circulating water bath Pressure transducer with cable
Requires two channels of Bridge/Transducer amplification OPTIONAL COMPONENTS SI-LF-05-01-IPO Alternate Tissue Bath for Liver or Mesenteric Bed
Langendorff
Isolated perfused heart system
The SI-LANG1 and SI-LANG2 isolated perfused heart systems were developed for in vitro investigations of the hearts of small animals according to the methods originated by Oscar Langendorff . The system can be configured easily to perform many of the common methods used to study isolated hearts . Supplementary devices, like a special ECG sensor or a constant flow/pressure device, can easily be added to the system .
Features
l Retrograde perfusion of isolated hearts from mouse, rat, guinea pig, hamster and rabbit l Measurements in constant pressure or constant flow mode on the same device l Equipped with two columns for using different buffers l Capable of recording aortic pressures as high as 120mmHg l Equipped for measuring left ventricular pressure (LVP) l Ports in the system are available for measuring pressure, flow, temperature and surface potentials, and for the infusion or injection of drugs l Continuous filling of buffer columns with use of a pump l Continuous oxygenation of buffers l Water-jacketed system for precise temperature control
The Langendorff system is designed as a perfusion system for isolated, small mammalian hearts. Some special features of this system include the stainless steel sink, the small reeling pump and specially designed two-way Teflon taps.
LANGENDORF SPECIFICATIONS
WIDTH LENGTH HEIGHT WEIGHT 600 mm 800 mm 2550 mm 80 kg
LANGENDORF SYSTEMS SI-LANG1 Langendorf Isolated Perfused Heart System, Single Buffer Column SI-LANG2 Langendorf Isolated Perfused Heart System, Dual Buffer Column Included: Table with base plate, shelf, sink Console Perfusion buffer column Glass overflow tube Teflon tap set Heart suspension unit Heart chamber Spindle syringe Pressure sensor holders (2) Oxygenation bubbler set Oxygenation pressure equalizer set Latex pressure balloons for left ventricular pressure (LVP) catheter PeriStar Pro 2-channel peristaltic pumps (2) Circulating water bath Pressure transducers with cables (2) Requires two channels of Bridge/Transducer amplification OPTIONAL COMPONENTS SI-SEN12AM4E-U Manipulator with Removable Head (Unipolar) SI-SEN12AM4E-B Manipulator with Removable Head (Bipolar) SI-SEN07RTH2 Buffer Temperature Sensor SI-SEN13MAP Monopolar Action Potential Sensor
Germany: Tel: 030-6188845 wpide@wpi-europe.com China: Tel: 21 68885517 chinasales@china.wpiinc.com
10
Neely
Isolated working heart system
The SI-LANGWH isolated working heart system was developed for in vitro measurements of the mechanical activity and work performed by hearts from small animals according to the methods devised by J . R . Neely, et al. This system is designed with a combination of features from both the classic Langendorff (non-working) and the Neely (working) systems .
Features
l For use on small mammalian hearts (mouse, rat, guinea pig, hamster and rabbit) l Working (Neely) and non-working (Langendorff) options in the same device l Control of the left ventricular diastolic pressure (LVDP), coronary flow and cardiac output by variation of the left atrial filling pressure and the hydrostatic pressure in the aorta l Measurement of the heart rate, atrial and ventricular pressure and cardiac output l Ports for drug administration l Pacing of the heart is possible l Special ECG sensor available l Tissue easily removed for biochemical investigations
The Neely system is designed as a perfusion system for isolated, small mammalian hearts. Some special features of this system include the stainless steel sink, the small reeling pump and specially designed two-way Teflon taps.
NEELY SpEcificaTioNS
WIDTH LENGTH HEIGHT WEIGHT 600 mm 800 mm 2550 mm 80 kg
NEELY SYSTEM SI-LANGWH Langendorf Neely Perfused Working Heart System Included: Table with base plate, shelf, sink Console Perfusion buffer column Glass overflow tube Lung column Elastic chambers (2) Teflon tap valve Heart suspension unit w/cannulas Heart chamber Pressure sensor (2) Oxygenation bubbler set Oxygenation pressure equalizer set After load regulation adapter Basic analog flow meter PeriStar Pro 2-channel Peristaltic Pumps Circulating Water Bath Pressure Transducers with Cables (2) Requires two channels of Bridge/Transducer amplification OPTIONAL COMPONENTS SI-SEN12AM4E-U Manipulator with Removable Head (Unipolar) SI-SEN12AM4E-B Manipulator with Removable Head (Bipolar) SI-SEN07RTH2 Buffer Temperature Sensor SI-SEN13MAP Monopolar Action Potential Sensor
11

Patent Pending . U .S . and international patent applications filed .
Compact Langendorff
Miniature system for isolated, perfused heart/ischemia reperfusion studies
The Compact Langendorff system was developed for in vitro investigations of the hearts of small animals in constant pressure and/or flow modes . Even though the system occupies a small amount of bench space, it contains all the features of non-working (Langendorff) and working perfusion systems in a single, compact, thermostatically-controlled unit . The system contains four perfusate reservoirs that can store 500mL of preheated and oxygenated buffer each . Through a system of valves, the reservoirs can be connected to create one large (2L), two medium (1L each) or four small (500 mL) volumes . This flexibility allows you to test different doses of a drug consecutively, or combinations of drugs concurrently . 12
The system also has a unique heart suspension module that permits easy attachment of the heart to the system, as well as the concise placement of the heart within a 12-lead muscle action potential (MAP) sensor . The integrated temperature control system lets you set the temperature in 0 .1 C degrees increments . Also, heat transfer between the device and the surrounding air is very low, establishing a stable environment for the heart preparations .
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. Germany: Tel: 030-6188845 wpide@wpi-europe.com China: Tel: 21 68885517 chinasales@china.wpiinc.com
Features
l Fluid columns are replaced by electronically adjusted flow control to keep the pressure at desired values from 0500mmHg l Langendorff and working heart perfusion modes l Real-time calcium imaging ready l Compact, all-in-one unit thermostatically controlled to 0 .1C degree l Four 500mL saline reservoirs which can easily be connected to create 2L and 1L volumes l Special heart suspension module
l Muscle action potential (MAP) sensors sized for mouse, rat, guinea-pig and rabbit hearts l Capability to measure the following parameters: muscle action potentials (MAP), left ventricular pressure (LVP), perfusion pressure, coronary flow, buffer temperature, heart rate (HR), ECG, surface potentials, muscular tone and force with forcedisplacement method l Capability of pacing and stimulation can be added
Real Time Calcium Imaging

If youre interested in calcium imaging, you no longer need a dedicated room to accommodate the 2 .5m height of the standard Langendorff with columns . This ingenious Langendorff system was engineered using a pressure clamp apparatus to replace the bulky columns so that the entire system is small enough to fit into a dark box for imaging . Everything you need to begin calcium imaging is available now through SI-Heidelberg .
COMPACT LANGENDORF SYSTEM SI-LANGC Compact Langendorf Working Heart System Included: Reservoirs, taps, central heater, heart suspension unit, oxygenation system Constant Pressure Controller Temperature Controller Latex pressure balloons for left ventricular pressure (LVP) catheter PeriStar Pro 2-channel high output Peristaltic Pumps (2) Pressure transducers with cables (2) for aortic and left ventricular/atrial pressures Requires two channels of Bridge/Transducer amplification OPTIONAL COMPONENTS SI-SEN12AM4E-U Manipulator with Removable Head (Unipolar) SI-SEN12AM4E-B Manipulator with Removable Head (Bipolar) SI-SEN07RTH2 Buffer Temperature Sensor SI-SEN13MAP Monopolar Action Potential Sensor
13
Vertical Tissue Bath

Multi-chamber tissue bath system
The SI-MB4 vertical tissue bath is shown with all four channels.
The SI-MB4 and SI-MB8 isolated tissue bath systems were developed for in vitro investigation on isolated smooth, cardiac or skeletal muscle preparations. The SIH vertical tissue bath systems offers easy control of the inflow and outflow of buffer, oxygenation and stimulation. Simple tissue installation, calibration of the chamber volume and temperature maintenance are also important features. High quality, calibrated tissue bath chambers with fitted tissue holders allow for low bath volumes. Sensitive, optical-based force transducers come with a LIFETIME warranty. Removable tissue holders ensure ease of tissue mounting and installation into the chambers.
features
Unique optical force transducers with LIFETIME warranty Test tissue strips or rings 5, 10 and 20mL calibrated chamber volumes Oxygen delivery and control integrated into each chamber bath Field (or point) stimulation electrodes built into each tissue holder Water jacketed reservoirs with built-in oxygenators
SYSTEM SPECIfICaTIOnS
SI-MB4 500mm 1000mm 1050mm 30kg SI-MB8 500mm 2000mm 1050mm 60kg Width Length Height Weight
BaTH SPECIfICaTIOnS
5mL 10mL 20mL Height* 65mm 65mm 65mm ID 14mm 18mm 20mm
*Inside height is measured between the outflow port at the bottom and the overflow port at the top.
Oxygenation frit may be easily moved while tissue and holder are in the bath, to prevent bubbles from impacting the tissue.
14
Tissue Baths
Tissue baths come as small as 5mL, for your most delicate applications . All the SI-H tissue baths are precisely calibrated, so that when your tissue holder is installed, you can accurately calculate your solution concentration .
Oxygenation
SI-H re-engineered the standard oxygen frit (shown below) to avoid the disturbances to the tissue sample that tiny bubbles can cause . The repositionable SI-H frit is installed on a small wire attached to the tissue mounts . You can choose the depth and direction of the bubble stream that will cause the least disruption to your tissue . Because the frit is a removable part, it can be easily replaced without the need to order a new tissue bath .
Tissue Holders
All tissue holders are made of Teflon to prevent the contamination of the tissue buffer by trace metals . The tissue holders are designed to: l Tissue mounts for strips with field and point stimulation and ring with field stimulation are included with all systems l Allows for the attachment of the tissue on the holder before it is positioned in the chamber . l Effectively oxygenate the buffer in the vicinity of the tissue . l Position the field (or point) electrodes for efficient stimulation . l Permit easy calibration of the chamber volume . Two tissue holder styles are available for testing tissue . l SI-OHO2Ftissue strips with field stimulation . This can also be used with the included tissue mounts for tissue rings . l SI-OHO2Ptissue strips with point stimulation
The mounting for each tissue bath provides solid support as well as ports for oxygenation control and fluid handling.
SI-OHO2F
SI-OHO2P
Tissue holders are designed for simple and accurate preparation mounting. As the tissue holder slides into the tissue bath, its size significantly lowers the volume of liquid in the tissue bath. Tissue mounts for vascular rings (SI-OVO2F) can be used with either holder. Upon request, custom electrode shapes and positions can be manufactured. VERTICAL TISSUE BATH SI-MB4 4-Chamber Vertical Tissue Bath SI-MB8 8-Chamber Vertical Tissue Bath OPTIONAL COMPONENTS 503843 Water Bath, Circulating (110 V) 503844 Water Bath, Circulating (220 V) LAB-TRAX-4 4-Channel Data Acquisition System WPI-118 High Performance Digital Data Recorder
15
BioTester 5000
Biaxial Test System for Biomaterials
The BioTester5000 offers you a complete system for testing small biological specimens and analyzing the test results . Skin, ligaments, blood vessels, heart valves, sclera, membranes, scaffolds BioTester5000 can examine any planar biological or replacement tissue . Easy to use, yet powerful image tracking and analysis software delivers synchronized data, image and video management . Data can be exported to spreadsheets or analysis software . l Quick and easy sample mounting of test samples as small as 5mm x 5mm . l High Resolution (integrated) CCD camera provides synchronized video tracking for live images (up to 60 frames/sec) and real-time analysis l Image tracking and analysis software included . l Precision measurement of small samples (3mm-50mm square) l Uniaxial or biaxial tension tests of planar tissues l Multi-modal cyclic, simple and relaxation testing l Simple USB interface offers a quick connect to a control computer with the included image and marker tracking software . l User-friendly, comprehensive software package offers live data graphing and imaging to confirm the quality of the data collected .
Sample Mounting
The unique tungsten BioRakes (shown at right) easily pierce the toughest and most delicate soft tissue samples and provide distributed attachment sites across the geometry of the sample for uniform attachment and deformation across the edge of the sample . The sharp rakes will not damage fragile samples .
Software
The software features a user-friendly interface with live data graphing and imaging . The menu-driven setup offers a virtually limitless number of test stages and duration combinations . Previously used tests and templates can be easily edited for quick test designs . Live test status and data graphing provides real-time data monitoring . Analysis data can be easily exported to spreadsheets or other scientific modeling software .
BIOTESTER 5000 SPECIFICATIONS

FORCE CAPACITY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .500, 100, 2500, 5000 mN, 10 N, 23 N FORCE RESOLUTION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . >0 .02% of full scale FORCE ACCURACY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .0 .2% of full scale SPATIAL RESOLUTION (ACTUATOR) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . >0 .1 m SPATIAL ACCURACY (ACTUATOR) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 m SPATIAL RESOLUTION (IMAGE ANALYSIS) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 pixel FORCE DATA RATE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .100 Hz IMAGE RATE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1280x960 - 15 Hz 1024x768 - 30 Hz 640x480 - 60 Hz DEFORMATION RATE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 mm/s (17 mm/S optional)
Image analysis software is provided with the BioTester5000 to deliver synchronized data, image and video management . Image features are easily tracked and synchronized to measured data and export to spreadsheets or other scientific analysis software . Images are available as JPG or AVI files for presentation and import into other image processing applications . 16
CS-BIOTESTER5000 CS-BIOTESTER5000
Biaxial Biomaterial Tester Uniaxial Biomaterial Tester
MicroSquisher
Micro-Scale Compression System
Cell Aggregate Compression
The interface tensions that exist play an important role in the organization of cells within aggregates . These properties can be determined by analyzing the force-time curve and test images from a parallel plate compression test .
glass plate
The MicroSquisher is designed to perform compression testing on specimens between 50 and 2000m with force resolutions as small as 0 .05 N . Forces are determined from the deflection of a flexible cantilever beam to which one compression plate is attached . Displacement control is achieved by manipulating the base of that beam using a motorized piezo stage . The specimen can be tested in ambient air or in a temperature-controlled fluid bath . An integrated camera system allows synchronized imaging at up to 5Hz .
cell aggregate (250m diameter) glass plate
Micro-Scale Material Characterization

The MicroSquisher can be used to determine the compressive stress-strain properties of a variety of materials (hydrogels, small tissue samples, etc .) with peak forces ranging from 1N to 1mN . The device can perform displacement-controlled compression and stress relaxation testing .
The MicroSquisher image analysis module quantifies the aggregate profile, allowing cellcell and cell-medium interface tensions to be calculated .
MICROSQUISHER SPECIFICATIONS
SPECIMEN SIZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502000 M FORCE RESOLUTION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . <0 .05 N SAMPLING RATE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Up to 5 Hz
CS-MICROSQUISHER
Micro-Scale Compression System
MechanoCulture
Strainable Substrate for Culturing Cells
The MechanoCulture system was developed to allow researchers to culture cells on flat, strainable silicone membranes . Uniform strains up to 25% are possible and up to six, 20mmdiameter wells can be stretched simultaneously using a single, inexpensive base unit .
Base Unit
The MechanoCulture base unit has eight synchronous motor-driven pins that move radially so as to stretch a specially designed silicone membrane that includes a 20mm-diameter by 5mm deep well with cover plate . The Base Unit is 110mm X 130mm X 70mm and it can stretch up to 6 membranes at one time . Strain rates ranging from 10% per second to 0 .01% per hour can be specified as can peak equi-biaxial strains ranging from 1% to 25% . Tests can be as simple as a single stretch cycle or they can be so complex and long that they take weeks to run .
The base unit posts move radially to stretch a silicone membrane from 125%.
disconnected from its power source without losing track of its position in the protocol .
Carrier
A special carrier allows membranes to be removed from the MechanoCulture base whenever it is paused or stopped . Thus, cultured cells can be observed and imaged on an inverted microscope in their original or deformed state . The system is designed to be scalable and cost effective . Each base unit operates independently so that different strain-time protocols can be run simultaneously . Individual base units can be moved from one incubator to another or from one lab to another, thus providing maximum flexibility .
Computer Control
The base unit is programmed using a graphical user interface (GUI) that runs on a PC and a USB cable . Once it is programmed, it can be disconnected from the PC and transferred to an incubator where it is connected to a 12V power supply . A run/ pause button is used to initiate, pause and stop the test . An LED display indicates the state of the unit, including the number of cycles remaining in the original protocol . The base unit can be stopped and
The MechanoCulture Base Unit has three silicone membranes
CS-MECHANOCULTURE
Strainable Substrate for Culturing Cells
17
Epithelial Physiology
TEER Measurement Systems
EVOM2 Epithelial Voltohmmeter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 REMS Automated Tissue Resistance Measuring System . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 REMS Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Electrodes for Epithelial Cells
EPITH ELIAL PHYS IOLOGY
STX2 Replacement Chopstick Electrode Set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 STX3 Adjustable Tip Spread Chopstick Electrode Set . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Electrodes for Endothelial Cells ENDOHM-6 Synthetic Cell, 6mm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 ENDOHM-12 Synthetic Cell, 12mm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 ENDOHM-24SNAP Synthetic Cell for Snapwell . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 STX100 for Falcon HTS Multiwell Insert System & Corning Costar HTS Transwell-24 . . . 20 Positive Test Kits for TEER Measurement Meters and Electrodes CaliCell-12 12mm Calibration Cell for Endohm 6/12 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 CaliCell-24 30mm Calibration Cell for Endohm 24 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20
Voltage / Current Clamps

EVC4000 Four-Channel Voltage Clamp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 DVC-1000 Two-Channel Voltage Clamp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25
Ussing Systems
Ussing System Large Reservoir . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 Ussing System Small Reservoir . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 Ussing Chambers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 Electrodes for Ussing System EK1 Ussing Electrodes Kit (2 voltage, 2 current) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 EKC Extra Ussing Current Electrode (red) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 EKV Extra Ussing Voltage electrode (blue) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Heating Circulators
Julabo Circulating Bath . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Inside Back Cover
Perfusion Systems
MPS-2 Multichannel Perfusion System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .201
Tissue Slicers
NVSL Manual Vibroslice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 NVSLM1 Motorized Vibroslice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 Peltier Temperature Controller for Vibroslice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
Accessories
Rodent Brain Matrices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 FluoroDish Sterile Culture Dishes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .171
18
Trans Epithelial Electric Resistance (TEER) Measurements

During the last two decades TEER measurements have become universally established as the most convenient, reliable and non-destructive method to evaluate and monitor the growth of epithelial tissue cultures in vitro. The confluence of the cellular monolayer is quickly determined by a sharp increase in TEER. Recently there has been a significant surge of interest in introducing a combined electrode for resistance measurements in the Millipore 96-well PAMPA (parallel artificial membrane permeability assay) plate. TEER measurement technology, which was first introduced by WPI in the mid-1980s, has since been perfected and expanded to include a range of TEER related manual and automatic instrumentation.
EVOM
Epithelial Voltohmmeter
Manual TEER measurements of epithelial cells in 6-, 12-, and 24-well plates Electrically isolated meter that plugs into a standard outlet for continual readout without push buttons Compatible with Endohm chambers STX2 manual electrodes and test electrode included with every meter
The EVOM was the first instrument designed specifically to perform routine Trans Epithelial Electrical Resistance (TEER) measurement in tissue culture research . EVOM2 is the next generation, redesigned for ease of use . The EVOM2 not only qualitatively measures cell monolayer health, but also quantitatively measures cellular confluence . The unique electronic circuit of the EVOM2 and the included STX2 electrode detect the confluence of the cellular monolayer . When combined with WPIs Endohm chamber, the EVOM2 can also be used to perform more accurate quantitative measurements or lower resistance measurements like trans endothelial electrical resistance measurements . The isolated power source of the EVOM2 was specifically designed to avoid adverse effects on tissue and the formation of electrode metal deposits, even when it is plugged into a standard wall outlet . Now, the EVOM2 is always on when you need it . In addition, its rechargeable battery allows up to 10 hours of mobile use . The four and a half digit readout provides a range of 1-9,999 . The included test electrode lets you calibrate the resistance measurements for an accurate reading every time, and the voltage meter never needs calibration . An analog BNC output is standard with the EVOM2, providing an output port for recording data or remote display of the EVOM2 output . EVOM2 comes complete with the popular STX2 chopstick electrodes, 4mm wide and 1mm thick . Each stick of the electrode pair contains a silver/silver-chloride pellet for measuring voltage and a silver electrode for passing current . The small size of each electrode is designed to facilitate placement of the electrodes into a variety of standard cell culture wells .
EVOM2 SPECIFICATIONS
MEMBRANE VOLTAgE RANgE RESOLUTION RESISTANCE RANgE RESISTANCE RESOLUTION AC SqUARE WAVE CURRENT POWER 200 mV 0 .1 mV 0 to 9999 1 10 A nominal at 12 .5 Hz Internal rechargeable 6V NiMH 2200 mAH battery with external 12 VDC supply for recharging 10 hours 1-10 V (1 mV/ohm) 19 x 11 x 6 cm (7 .25 x 4 .25 x 2 .30) 1 .4 kg (3 lb) RJ-11connector (telephone style) External 10-38C (50-100F ) 0-90% non-condensing relative humidity
STX2
STX3
NOMINAL BATTERy RUN TIME BNC OUTPUT DIMENSIONS WEIgHT ELECTRODE CONNECTION TEST RESISTOR ENVIRONMENTAL RANgE
EVOM2 Epithelial Tissue Voltohmmeter (includes STX2 electrode set) REPLACEMENTS AND ACCESSORIES STX2 Replacement Chopstick Electrode Set STX3 Adjustable Tip Spread Chopstick Electrode Set 3993 Electrode Adapter (for electrodes with 2 mm pins) 503540 4-Way Switchbox & Interface Cable 91736 Replacement Battery, Rechargeable NiMH
19
TEER measurements in High Throughput
STX100
Series Electrodes
Designed for 24-well HTS plate (Corning Costar and BD Falcon) and with 96-well plates (Millipore and BD Falcon) Improved accuracy down to 5 Ohm Sterilized with EtO, alcohol or bactericide
With the development of a High Throughput Screening (HTS) protocol for faster drug discovery, a new line of cell culture filter plates have been introduced by several major cell culture insert manufacturers . These HTS plates normally have either 24 or 96 individual cell culture inserts bonded together as one plate so that it can be handled by a robot apparatus . In response to these developments, WPI has developed an automatic REMS system and a manual electrode, STX100, for TEER measurements using HTS plates . STX100s design is based on the same reliable design principle as the universally used STX2 electrode, with several important modifications . The size of the electrode tip has been reduced to 1 .5 mm to facilitate positioning through the narrower slit of the HTS plate . The STX100 electrode itself is constructed using a stronger material for higher durability and maximum usage applications . The bottom section of the electrode is shaped to fit neatly into the keyhole shaped filter well . This enables the STX100 electrode to produce increased accuracy and reproducibility of TEER readings (5) compared to the standard STX2 . Several versions of STX100 are available, designed to fit the Corning Costar 24-well HTS plate, the Falcon 24 well HTS plate, and the Millipore
Multiscreen CaCo 96-well plate . Measurement can be directly performed when the HTS plate is in either a common or divided tray, reducing the possibility of contamination as well as mechanical damage to the cultured cells . STX100C STX100F STX100M STX100C96 OPTIONAL 13685 13347 2851 500184 STX100 for Corning Costar HTS Transwell-24 STX100 for Falcon HTS Multiwell Insert System STX100 for Millipore MultiscreenTM CaCo 96-Well Plate STX100 for Corning HTS 96-Well Plate ACCESSORIES Modular Cable, 7 ft Chart Recorder Adapter Standard BNC Cable, 52 Standard BNC Cable, 10 ft (3m)
CaliCell
Cell culture cups with synthetic membrane for testing STX electrodes, Endohm and Ussing chambers
It takes a long time and a lot of work to grow a batch of cells, so you will want to make certain that your test apparatus is functioning properly . The CaliCellTM provides a quick and positive way to test STX electrodes, EVOMs, Endohm, and Ussing chamber . The CaliCellTM is a major improvement in TEER electrode calibration . Its membrane makes use of our unique electric current constriction technology to produce resistance readings comparable to those obtained with real cell cultures . The CaliCellTM does not have to be refrigerated, and can be cleaned and sterilized with alcohol . Readings will not drift over time as long as the unit is kept in good physical condition . CALICELL-12 CALICELL-24 12 mm Calibration Cell for Endohm-6/Endohm-12 24 mm Calibration Cell for Endohm-24
20
Screening (HTS) cell culture filter plates
Also for use with Millicell ERS-2
Endohm
For TEER measurement of endothelial cell cultures in individual cups

Compatible with EVOM2 Improved accuracy of 1-2 Ohm Accommodates 6mm, 12mm, 24mm cups and Costar Snapwell cup Sterilized with EtO, alcohol or a bactericide
held STX2 electrodes) to less than 5 . With Endohms fixed electrode geometry, variation of readings on a given sample is reduced from 10-30 with STX2 electrodes (depending on the experience of the user) to 1-2 . Compared with other resistance measurement methods, Endohm with EVOM2 offers a much more convenient and economic solution to leaky tissue measurement . Because of the uniform density of the AC square wave current from EVOM2, errors owing to electrode polarization or membrane capacitance are largely eliminated . Endohm together with EVOM2 offers the most accurate and economical endothelial ohmmeter now available . To date, cups from Costar, Millipore, ICN Biomedicals, and Falcon have been tested . Endohm chambers may be sterilized with EtO, alcohol or a bactericide (also see: Cidex, Microsurgery section); not autoclavable .
Using WPIs EVOM2 resistance meter, Endohm chambers provide reproducible resistance measurements of endothelial tissue in culture cups . Transfer cups from their culture wells to the Endohm chamber for measurement rather than using hand-held electrodes . The chamber and the cap each contain a pair of concentric electrodes: a voltage-sensing silver/silver chloride pellet in the center plus an annular current electrode . The height of the top electrode can be adjusted to fit cell culture cups of different ENDOHM-6 Endohm for 6 mm culture cup (24 wells per plate) manufacture . Endohms symmetrically apposing circular disc ENDOHM-12 Endohm for 12 mm culture cup (12 wells per plate) electrodes, situated above and beneath the membrane, allow ENDOHM-24SNAP Endohm for 24 mm & Costar Snapwell cup (6 wells per plate) a more uniform current density to flow across the membrane Requires EVOM2, EVOM or EVOMX to operate than with STX2 electrodes . The background resistance of a 53330-01 Replacement Endohm Cable blank insert is reduced from 150 (when using WPIs hand-
21
Automated TEER Measuring System
The REMS AutoSampler automates measurements of electrical resistance of transepithelial, transendothelial or Caco-2 cell membranes being grown to confluence on microporous filters of high throughput screening (HTS) 24- and 96-well microplates . It is a PC-controlled, tissue resistance measurement system that offers reproducibility, accuracy, flexibility and ease-of-operation for this kind of measurement . Automated measurement of tissue resistance in cell culture microplates provides the important advantages of speed, precision, decreased opportunity for contamination and the instant availability of measured resistance data on a computer . These measurements are useful in applications such as drug bioavailability studies and studies on the mechanisms of drug transport . The main components of the REMS AutoSampler include: the robotic sampler that moves the electrode over each well of the microplate, the electrode which is located on the robotic arm, a base plate for the 24- and 96-well tray, a Windows-based data acquisition card, the REMS interface unit and the REMS software to operate the system on a Windows-based computer . The REMS AutoSampler automates TEER measurements previously made with WPIs EVOM Epithelial Voltohmmeter . Automated tissue resistance measurements up to 20 k can
be performed on 24- or 96-well HTS microplates . Microplates presently supported include the Corning Costar HTS Transwell-24, Falcon HTS Multiwell insert systems, and Millipore Multiscreen CaCo 96-well plate . The REMS AutoSampler is designed to facilitate integration with other robotic systems . Special locating bars are installed on the REMS base platform that allow other system robots to place an HTS tray into a precise location on the REMS base . The REMS AutoSampler will automatically measure and record tissue resistance from a user-specified matrix of culture wells on the microplate . According to the specified sequence, the robotic arm moves over the identified wells taking TEER measurements . By means of a x-y-z locating system, the electrode-containing arm is positioned precisely and reproducibly over each well . The ability of the REMS AutoSampler to reproducibly and precisely locate the electrode results in highly reproducible TEER measurements . TEER measurements are stored in the computer as the electrode moves from one well to the next . The Windowsbased software provides user-friendly features to acquire, display and store the tissue resistance measurements . The REMS electrode is very compact and robust in design . Each of two rod-shaped probes, 1 .5 mm in diameter, consists of a pair
22
REMS AUTOSAMPLER SPECIFICATIONS

of electrodes: one electrode for injecting current and the other for measuring the voltage . The use of two pairs of electrodes eliminates the error caused by the electrode-liquid interface . To take a measurement, the robot inserts one probe into the center of the filter well and the other into the opening slot of the 24or 96-well plate . The use of AC current to measure resistance provides several advantages over DC current, including: Absence of offset voltages on measurements; There is a zero net current being passed through the membrane and, therefore, it is not adversely affected by a current charge; No electrochemical deposition of electrode metal .
MEMBRANE RESISTANCE RANgE AC SqUARE WAVE CURRENT ELECTRODE POSITIONINg ELECTRODE PERFORMANCE ELECTRODE ARM SPEED TyPICAL MEASUREMENT TIME 24-WELL SCAN PATTERN LINE VOLTAgE DIMENSIONS WEIgHT 0 to 2000 and 0 to 20 k +/- 20 A @ 12 .5 Hz Resolution in X, y and Z: +/- 1 mm Repeatability in X, y and Z: +/- 0 .25 mm X- and y-axis: 250 mm/sec Z-axis: 247 .3 mm/sec 1 min, 10 sec Choice of any well pattern sampling User specified: 100/120 V or 220/240 V 53 .5 43 .7 37 .1 cm (21332 17316 1458 in .) 24 kg (52 lb)
The REMS AutoSampler also features a rinse and calibration check station . If occasional rinsing of the REMS Automated Tissue Resistance Measuring System REMS electrode is required it may be sent Includes robot sampler, base plate, data acquisition board; computer, display, to a rinse station by pressing the rinse keyboard, mouse; software for Windows XP or Vista; and electrode for either station button on the menu bar . ACCESSORIES
REMS-24 REMS-96 Replacement REMS STX Electrode for 24-well HTS Plate Replacement REMS STX Electrode for MilliporeTM 96-well Plate Contact WPI for detailed information.
24-well plate (Corning Costar HTS Transwell-24 or Falcon HTS Multiwell) or 96-well plate (Millipore Multiscreen CaCo) SPECIFY WHEN ORDERING.
Give your HTS system the ability to perform REMS TEER measurements
WPIs REMS TEER measurement system is also available in a fully customizable package that does not include the robot . The REMS-KIT is designed to enable manufacturers and users of robotic and HTS systems to incorporate TEER measurement capability into their own automated protocols . Essentially the REMS-KIT provides the same TEER measuring system as the REMS but without the robot positioner . Control over TEER measurement is accomplished using the DDE protocol . Virtually any Windows-compatible programming language that uses the DDE protocol (including LabView and Visual Basic) can be used . The REMS-KIT is designed for use with Corning Costar HTS Transwell-24, Falcon HTS Multiwell Insert System and Millipore MultiscreenTM CaCo 96-well plates . The system includes the following components: REMS TEER electrode with 5-ft cable Dummy TEER electrode for training robot REMS TEER measurement electrode interface unit Windows PCI A/D data acquisition card Interface software using the DDE protocol Instruction Manual
REMS KIT SPECIFICATIONS

Resistance range . . . . . . . . . . . . . . . . . 0 to 20 k Ohms Time for each measurement . . . . . . . . 1 to 2 .5 seconds REMS KIT includes one electrode which fits either the Corning Costar 24-well microplate, the Falcon 24-well microplate, or the Millipore Multiscreen CaCo 96-well microplate.
REMS-KIT
REMS Kit for Corning Costar HTS Transwell-24 or Falcon HTS Multiwell Insert System
23
Multi-Channel Voltage / Current Clamp EVC4000

EVC4000-4 (complete four-channel system)
More channels and a wider range of voltage clamp commands than WPIs classic DVC-1000. The superior design of the cartridge electrodes makes 100-volt current excursion unnecessary, so this safe, low-voltage system is easier to adjust and use.
EVC4000 employs the voltage clamp technique to monitor membrane permeability as a function of membrane voltage or applied chemicals . When combined with WPIs patented EKC and EKV cartridge electrodes, EVC4000 can efficiently voltage or current clamp up to four sample membranes simultaneously using safe moderate voltages on the current wire leads . The superior design of the cartridge electrodes makes 100volt current excursion unnecessary, so this safe, low-voltage system is easier to adjust and use . Extremely stable and accurate, each module, with its companion preamplifier, can operate independently in one of three different modes: Voltage Clamp (VC), Current Clamp (CC), or Open Circuit Potential (PD) measurement . EVC4000 can be controlled from the front panel of the instrument or from computer generated commands applied at the rear panel of the instrument . A feature unique to EVC4000 is an electronic potentiostat in the preamplifier box that maintains the serosal electrode invariant potential at zero relative to system ground . The preamplifier apparatus actively maintains one surface of the test membrane close to ground potential under all operating conditions .
EVC4000 SPECIFICATIONS
PREAMPLIFIER Input Resistance Input Leakage Current Maximum Input Voltage VOLTAgE CLAMP Panel Display Clamp Voltage / External Input Range of Voltage Electrodes Max . Clamp Voltage Fluid Resistance Compensation CURRENT CLAMP Panel Display Maximum Clamp Current Current Clamp Output DISPLAy RESOLUTION Voltage Current DIMENSIONS SHIPPINg WEIgHT (EVC4000-4) 1012 Ohms 100 pA, max . 15 volts 200 mV 0 .1 mV 100 mV per Volt 32 Volts 100 mV 0 to 1000 Ohms 999 A 1 A 1 milliampere 1 A / mV 0 .1 mV 1 A 18 .25 x 7 .2 x 9 .6 in . (46 x 18 x 24 cm) 26 lb (12 kg)
References
W. K. MacNaughton (2000) Role of constitutive cyclooxygenase-2 in prostaglandin-dependent secretion in mouse colon in vitro . Journal of Pharmacology and experimental Therapeutics 293, 2, 539-544
EVC4000-4 EVC4000-3 EVC4000-2 EVC4000-1
4-Channel Voltage Clamp & preamps (shown above) 3-Channel Voltage Clamp & preamps 2-Channel Voltage Clamp & preamps 1-Channel Voltage Clamp & preamp Specify line voltage
OPTIONAL ACCESSORIES SYS-EVC4000 Replacement Voltage Clamp & EVC3 Preamplifier EVC3 Replacement Preamplifier Module EK1 Ussing Electrode Kit (2 voltage, 2 current) EKV Extra Ussing Voltage Electrode (each) EKC Extra Ussing Current Electrode (each) 2851 BNC Cable 3845 Post Mounting Kit for Preamp (see page 91)
24
Two-Channel Voltage / Current Clamp

DVC-1000
The FIRST and still the most popular, with thousands of users around the world!
WPIs DVC-1000 Two-Channel Voltage/Current Clamp is well-known and widely used for studying epithelial tissues . Each DVC-1000 consists of two separate clamp instruments, one for clamping a control tissue, another for clamping a test tissue . This dual clamp technique lets you monitor changes in membrane permeability as a function of voltage or applied chemical agents . Either clamp unit operates in five modes . Voltage clamp: Clamps the tissue voltage to a given level and displays the current required to maintain that level . Amplify: Shows the potential difference between the two voltage electrodes . Current clamp: Lets you deliver a constant current between the two current electrodes while simultaneously monitoring voltage changes at the tissue . Timer: Functions in either current clamp or voltage clamp experiments, letting you cycle automatically between zero clamp and a preset clamp level . Remote: Allows you to control clamp operation from a computer or other logic level source . Small preamplifiers (included) which mount close to the chamber let you connect to voltage and current electrodes without long cables or agar bridges . DVC-1000 also features a unique 100 V power supply capable of delivering up to 1 mA of clamp current . Each clamp lets you correct for input offset voltages and fluid resistance error . SYS-DVC1000 Voltage/Current Clamp Includes two DVC3 preamps and one DVC2 dummy membrane. Specify line voltage OPTIONAL ACCESSORIES DVC2 Replacement Dummy Membrane DVC3 Replacement Preamplifier 2935 Rack Mount Kit EK1 Ussing Electrode Kit (2 voltage, 2 current) EKC Extra Ussing Current Electrode (red) (each) EKV Extra Ussing Voltage Electrode (blue) (each) 3485 Post Mounting Kit for Preamp (see page 91)
DVC-1000 SPECIFICATIONS
PROBES INPUT IMPEDANCE LEAKAgE CURRENT MAXIMUM INPUT VOLTAgE VOLTAgE CLAMP CLAMP VOLTAgE RANgE: SET CLAMP POT EXTERNAL COMMAND COMMAND FACTOR MAX . CLAMP CURRENT CURRENT CLAMP CLAMP CURRENT RANgE: SET CLAMP POT EXTERNAL COMMAND COMMAND FACTOR COMPLIANCE INPUT OFFSET RANgE FLUID RESISTANCE COMPENSATION RANgE TEST CURRENT OUTPUT RESISTANCE TIMER RANgE LCD METER TyPE MAX . READINg POWER REqUIREMENTS DIMENSIONS SHIPPINg WEIgHT 1012 100 pA max 10 V
100 mV 1 V 10 mV/mV 1 mA
1 mA 1 mA 1 mV/A 100 V 130 mV 0-1000 10 A to 180 A adjustable 100 500 ms to 500 s each side 312 digits with Noiselok 2000 A, 200 mV 95-135 V or 220-240 V, 50/60 Hz 17 x 8 .75 x 9 .5 in . (43 x 22 x 24 cm) 21 lb (9 .5 kg)
25
Ussing System
For electrophysiological investigation of epithelial transport
Direct connect low-resistance electrodes Simplified operation, easy to control temperature and clean after use Luer type leak-free attachment of tubing and electrodes Recessed electrode ports to avoid air bubble formation Secure membrane holding by sharp stainless steel pins or O-ring Specialized chamber adapts cell culture insert (Costar Snapwell) for monolayer cell culture Chambers with rectangular openings for tubular tissues from small animals
Glass cir u a ion c l t reservoir #5210
Ussing Chamber
WPIs Ussing System offers researchers a quick, effective means of making low-resistance electrical connections to the Ussing chamber without need of long agar bridges or Calomel half-cells . Ag/AgCl halfcells screw into short tubes which plug firmly into place in the chambers luer ports . These direct-connect electrodes eliminate the inconvenience and expense of Calomel half-cells in open liquids . The System includes one Ussing Chamber (eight sizes available), Support Stand, Electrode Kit, glass Circulation Reservoir (two sizes available), and a Tubing start-up kit (25 feet of 0 .375-in . tubing, 10 feet of 0 .156-in . tubing, plus four male luer fittings, two compressor clamps, one y-connector, and one clip) . Sixteen possible system configurations are listed at right . Components are also available separately . (Preamplifier in photo not included .)
Complete Ussing System in ludes stand, glass res r oir, electrodes, c e v Ussing chamber and tubing (EVC3 preamp and post mounting kit not in lud dsee page 27). c e
Ussing Chambers
WPIs classical Ussing Chambers are well established perfusion chambers that are easy to operate, easy to control temperature, and easy to clean after use . Hundreds of them are used daily by scientists in the field . Ussing Chambers are machined from solid acrylic with eight entry ports for fluid lines, electrodes, or agar bridges . For easy, leak-free attachment of tubing and electrodes, all eight ports are luer type . The four ports for voltage and current electrodes are recessed to prevent formation of air bubbles in the chamber . The fluid compartments in each side of the chamber are separated by the epithelial membrane being studied . Sharp stainless steel pins on one side of the chamber hold the membrane in position and mate with holes in the opposite chamber interface . (In the CHM4, tissue is held by an O-ring instead of pins .) The CHM5 chamber adapts the Costar Snapwell, a cell culture insert for monolayer cell culture, into WPIs classical epithelial voltage clamp system . Until now, classical Ussing Chambers have not been widely used for monolayer cell culture inserts because most inserts have a very deep profile, limiting good fluid perfusion at the surface of the membrane and limiting voltage electrodes from measuring the potential close to the surface of the membrane . CHM5 solves these problems: Perfusion fluid is introduced into the chamber at an angle so that it will flow directly to the surface of the membrane . The voltage electrode is also inserted into the chamber at an angle so as to reduce the distance between the surface of the membrane and the electrode . 26
Two small chambers with rectangular openings are designed for tubular tissue from small animals such as the mouse intestinal tract membrane (CHM6) and rat intestinal tract membrane (CHM7) . The rectangular opening more closely matches the shape of the tissue than would a circular opening, significantly increasing the membrane area available for testing . The larger membrane area increases the transport rate of low permeability chemicals; it also reduces the electrical resistance of the system for easier current clamping .
Optional Drains
Drains may be added to Ussing chambers to allow quick and complete evacuation of radioactive or toxic substances . To have drains added at the time of order, add a D to the part number (such as USS1LD); $100 will be added to the cost of the chamber or system you order .
Cartridge Electrodes
The Electrode Kit contains four voltage/current electrodes, plus four luer-tipped cartridges . Electrodes are threaded and screw securely into the end of each cartridge . The luer tip then plugs securely into the luer openings of the chamber . The cable from each electrode terminates with a 2 mm pin which may be plugged into voltage/current clamps such as WPIs EKV and EKC DVC1000 or EVC-4000 . Cartridge Elec rodes t The miniature electrode-gel cartridge is a small plastic tube with a male luer tip identical to those at the tip of hypodermic syringes . The tube may be filled with different gel materials; agar is commonly used but other gel materials may also be satisfactory .
U.S. Patent No. 4,912,060
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. UK: Tel: 01438-880025 wpiuk@wpi-europe.com Germany: Tel: 030-6188845 wpide@wpi-europe.com China: Tel: 21 68885517 chinasales@china.wpiinc.com
CHM8 Chamber
Clear acrylic chambers let you see Voltage your experiment in progress . . . Suture quality pins minimize tissue damage
Fluid out Electrode Fluid in Current Current Electrode Electrode
CHM8
0.5 mm pins
CHM2 CHM1
12 mm 17 mm 9 mm 12 mm
Reservoir openings and pins
4 mm 5.5 mm
CHM4 CHM3
4 mm 13.5 mm 18.5 mm 6 mm
CHM5
Optional drain Optional drain for hazardous for hazardous material also material also available available
5 mm
7 mm
14.5 mm 16.5 mm
30 mm 32 mm
Assembled chambers are 101.6 mm (4 in.) long.
CHM1 (Medium) Reservoir Opening Half-Chamber Volume Pin Circle Diameter 12 mm 1 .0 mL 17 mm
CHM2 (Small) 9 mm 0 .75 mL 12 mm
CHM3 (Large) 13 .5 mm 1 .2 mL 18 .5 mm
CHM4 (Extra Small) 4 mm 0 .5 mL 6 mm*
CHM5 (Snap) 12 mm 1 .7 mL N/A
CHM6 (Rect ., Small) 5 x 14 .5 mm 0 .8 mL 7 x 16 .5 mm
CHM7 (Rect ., Large) 7 x 30 mm 5 .5 mL 9 x 32 mm
CHM8 (Extra Small) 4 mm 0 .5 mL 5 .5 mm
*O-ring diam.
Circulation Reservoirs
Hand-blown borosilicate glass, with jacketed chambers for temperature control . Available in two sizes #5210 holds 20 mL per side, and #5362 (at left) holds 10 mL per side (useful when expensive chemicals are involved) . Reservoir condenser caps prevent air bubbles and turbulence in fluid reser voirs .
Water Bath
The Julabo circulating bath (see inside back cover) is ideal for controlling temperatures of external systems . With a powerful 15L/min flow rate, the pump provides optimum heat exchange . The tap water cooling feature is standard with a range of 20-100C . The bath opening is 15cm x 15cm x 15cm and can hold 34 .5L of liquid .
USSING SYSTEMS, LARGE RESERVOIR USS1L Medium Chamber, Stand, Reservoir, Electrodes, Tubing USS2L Small Chamber, Stand, Reservoir, Electrodes, Tubing USS3L Large Chamber, Stand, Reservoir, Electrodes, Tubing USS4L Extra Small Chamber, Stand, Reservoir, Electrodes, Tubing USS5L Snap Chamber, Stand, Reservoir, Electrodes, Tubing USS6L Small Rectangular Chamber, Stand, Reservoir, Electrodes, Tubing USS7L Large Rectangular Chamber, Stand, Reservoir, Electrodes, Tubing USS8L Extra Small Chamber, Stand, Reservoir, Electrodes, Tubing USSING SYSTEMS, SMALL RESERVOIR USS1S Medium Chamber, Stand, Reservoir, Electrodes, Tubing USS2S Small Chamber, Stand, Reservoir, Electrodes, Tubing USS3S Large Chamber, Stand, Reservoir, Electrodes, Tubing USS4S Extra Small Chamber, Stand, Reservoir, Electrodes, Tubing USS5S Snap Chamber, Stand, Reservoir, Electrodes, Tubing USS6S Small Rectangular Chamber, Stand, Reservoir, Electrodes, Tubing USS7S Large Rectangular Chamber, Stand, Reservoir, Electrodes, Tubing USS8S Extra Small Chamber, Stand, Reservoir, Electrodes, Tubing
* Add EVC4000 at reduced price when buying Ussing System with equivalent number of channels
EVC4000-1 EVC4000-2 EVC4000-3 EVC4000-4
1-Channel Voltage Clamp & Preamps 2-Channel Voltage Clamp & Preamps 3-Channel Voltage Clamp & Preamps 4-Channel Voltage Clamp & Preamps
System components also available separately: xxxxD Drain option (add D to part number of chamber or system) CHM1 Medium Chamber CHM2 Small Chamber CHM3 Large Chamber CHM4 Extra Small Chamber with O-Ring Seal CHM5 Snap Chamber (fits Costar Snapwell cups) CHM6 Small Rectangular Chamber CHM7 Large Rectangular Chamber CHM8 Extra Small Chamber with Mounting Pins EK1 Ussing Electrode Kit (2 voltage, 2 current) EKC Extra Ussing Current Electrode (red) (each) EKV Extra Ussing Voltage Electrode (blue) (each) 5210 Large Glass Circulation Reservoir, (20 mL per side) 5233 Replacement Condenser for 5210 5362 Small Glass Circulation Reservoir, (10 mL per side) 5361 Replacement Condenser for 5362 3955 EKV Cartridges, 35 mm (pkg of 12) 3960 EKC Cartridges, 58 mm (pkg of 12) 3669 Tubing Kit (flexible hose and luer fittings) 3579-20 Replacement luer fittings for tubing connections (pkg of 20) 5153 Support Stand 3845 Post Mounting Kit for Preamp (see page 91)
7 mm
9 mm
Guide Pins
Alignment Dots
12 mm
Luer ports allow easy fitting of fluid lines and electrodes
CHM6
CHM7
27
An economical, easy-to-use precision microtome for preparing live tissue sections for physiological, pharmacological and biochemical research
Blade speed up to 4500 rpm Sensitive parts sealed to avoid damage from spillage
Removable molded top cover for easy maintenance
NVSL (manual)
Advance speed as low as 0.07 mm/sec
Model NVSL offers a manual advance for positioning the specimen holder and bath chamber . Sample positioning on Model NVSLM1 is motorized . Other features include independent, removable specimen holder and bath chamber, variable advance speed and hands-free operation via a footswitch .
Blade angle variable through 90 degrees from horizontal to vertical
NVSL & NVSLM1 SPECIFICATIONS

SECTION THICKNESS MINIMUM MAXIMUM STEP SIZE CHAMBER DIMENSIONS VOLUME 20 m (fixed tissue) 50 m (fresh tissue) 700 m 5 m 218 314 114 in . (55 82 31 mm) 8 .5 cu . in . (140 mL) 0 .07 to 1 .6 mm/s (NVSLM1) (continuously variable) 4 mm/s (NVSLM1) 60 to 4500 rpm 1 mm (approx .) 95-135 V, 50/60 Hz, or 220-240 V, 50/60 Hz 19 lb (8 .6 kg)
NVSLM1 (motorized)
BATH ADVANCE SPEED
REVERSE SPEED VIBRATION SPEED AMPLITUDE POWER SHIPPINg WEIgHT
Vibroslice uses a vibrating blade to slice tissues without the trauma produced by other methods . Live brain or other tissues can be cut into slices 50- to 700-microns thick . Fixed tissues can be cut down to 20-micron slices (these need not be embedded or frozen) . Particularly useful for improving the access for certain histological reagents (e .g ., during processing for horseradish peroxidase) . The blade has a lateral displacement of about 1 mm, and its oscillating frequency may be varied between 60 and 4500 rpm . This allows you to achieve clean cuts in tissues of different mechanical consistencies .
SYS-NVSL SYS-NVSLM1
Manual Vibroslice Motorized Vibroslice Specify line voltage OPTIONAL ACCESSORIES VSLM1H Spare Specimen Holder VSLM1C Spare Bath Chamber 5450 Replacement Belts for NVSL (2) 5451 Replacement Belts for NVSLM1 (4) BLADES Blades, Single Edge (100) 7600 Temperature Controller, Standard Power 7600S Temperature Controller, High Performance 503566 Footswitch for NVSLM1 See adhesives, in Lab Supplies section. See Cidex, in Microsurgery section.
28
Tissue Bath Coolers for Vibroslice

A
thermoelectric elements in the base of the tissue bath. These act as energy transfer units so that heat is drawn off through the heat exchanger and removed by tap water flow. The unit uses P.I.D. (proportional integral derivative) temperature control to take the bath temperature to within 0.5C at the point of measurement. The temperature feedback thermistor is located in the bath floor and software calculates an offset automatically. B Immediate cooling of the tissue prevents anoxia by lowering the oxygen demand. Once removed from the animal tissue should be immediately place in cooled saline or sucrose buffer before mounting in the tissue bath. (See adhesives, pages 132-134.)
MODEL 7600 SPECIFICATIONS

DIsPlay ResOluTIOn: 0.1 C TemP. aCCuRaCy: +/- 1 C +8C to 0C TemPeRaTuRe Range: (Note that the actual temperatures achievable will be dependent upon the solutions used and local temperature conditions) VOlTage RequIRemenTs: 230V 50Hz or 115V 60Hz POweR RaTIng: 60w InleT Fuse RaTIng: 2a
Once removed from the animal, tissue must be immediately cooled to lower the oxygen demand and prevent anoxia. Holding the tissue close to 4C must continue throughout the slicing procedure. This can be done with passive cooling where a known amount of ice is used to maintain the cooled a.c.s.f. or with an electronically controlled Tissue Bath Cooler. The control unit supplies power to the Peltier
7600 7600S
Controller & standard Tissue Bath Cooler (A) Controller & autoclavable Tissue Bath Cooler (B)
Rodent Brain Matrices

wPI offers one of the largest selections of brain matrices available. made of acrylic, or stainless steel, these matrices are sturdy and can be heated, chilled, autoclaved (stainless steel only), scrubbed and stand up to rigorous daily use. Coronal matrices have the additional feature of a mid-line sagittal cut to facilitate splitting of the left and right hemispheres. sections can be as fine as 1-mm. The olfactory/ spinal/notch is cut into each matrix.
A B
E
BRAIN MATRICES Order # RBMA-200C RBMA-200S RBMA-300C RBMA-300S RBMA-600C RBMA-600S RBMS-200C RBMS-200S RBMS-300C RBMS-300S RBMS-600C RBMS-600S Subject adult mouse, 40-75g adult mouse, 40-75g Rat, 175-300g Rat, 175-300g Rat, 300g-600g Rat, 300g-600g adult mouse adult mouse Rat, 175-300g Rat, 175-300g Rat, 300g-600g Rat, 300g-600g Material acrylic acrylic acrylic acrylic acrylic acrylic Stainless Steel Stainless Steel Stainless Steel Stainless Steel Stainless Steel Stainless Steel Section Coronal sagittal Coronal sagittal Coronal sagittal Coronal sagittal Coronal sagittal Coronal sagittal A 3.18 3.18 4.7 4.76 4.76 4.76 3.18 3.18 4.76 4.76 4.76 4.76 B 11.1 11.1 15.9 15.9 19.8 19.8 11.1 11.1 15.9 15.9 19.8 19.8 C 8.73 8.73 12.7 12.7 14.7 14.7 8.73 8.73 12.7 12.7 14.7 14.7 D 19.1 19.1 36.6 36.6 36.6 36.6 19.1 19.1 36.6 36.6 36.6 36.6 E 12.2 12.2 23.8 23.8 24.7 24.7 12.2 12.2 23.8 23.8 24.7 24.7 Cavity Depth 7.4 7.4 7.61 10.91 10.91 10.91 7.4 7.4 7.61 7.61 10.91 10.91 Weight 0.5 lb 0.5 lb 0.5 lb 0.5 lb 0.5 lb 0.5 lb 1.0 lb 1.0 lb 1.0 lb. 1.0 lb 1.0 lb 1.0 lb
29
Surgical & Microdissection Tools

The instruments shown in this section are a sampling of the most popular tools from WPI. For a complete look at the hundreds of other items availble, see the new 88-page catalog or shop securely online at www.wpiinc.com. Forceps & Tweezers
Forceps by Dumont . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 Economy Fine Tweezers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32
MICRODISSECTION, MICROSURGERY
Forceps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33
Scissors
Vannas & Other Spring Scissors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Ring Scissors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35
Needle Holders
Needle Holders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .36
Clips & Clamps

Reflex Clips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Bulldog Clamps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37
Retractors, Knives, & Cutters

Wire Retractors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Scalpel Blades & Handles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Ear Punches & Ear Tags . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
Surgical Accessories
Student Dissecting Kit . . . . . . . . . . . . . . . . . . . . . . . . . S U .RG I C . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 . . . . . . . . . . .
Fine too ls for ve
Mouse Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
Rodent Guillotine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . teri . ar y . su .rger .y . an . . .U M E N .T . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 . . n . . . . . . R . . . . . . . . . . OmniDrill35 Micro Drill System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ar .ch . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 . . Binocular Loupes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40
d biomed ical re se
Al I N ST
Instrument Care
INTERNA TIONAL EDITION
Instrument Portfolio . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 Sterilizing Trays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Dry Sterilizer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .41
The instruments shown in this section includes a sampling of the most popular tools. For a complete look at the
30
2010
World P recision Instrum en
ts
hundreds of other items availble, see the new 88page catalog request your copy today!
Forceps by Dumont
Dumont #3 Material: Length: Tips: Stainless steel 12 cm (4 .75 in .) 0 .20 x 0 . .12 mm tips
For material information and instrument purchase guidance visit www.wpiinc.com
1:1
503235 . . . . . . . . . . . . . . . US$50 Dumont #5 Material: Dumostar, non-magnetic, non-corrosive stainless steel 11 cm long (4 .75 in .) Length: Tips: 0 .025 x 0 .015 mm 500085 . . . . . . . . . . . . . . . US$71 Dumont #5 Material: Length: Tips: Stainless steel 11 cm (4 .3 in .) 0 .025 x 0 .005 mm
Tip Profile:
Finest tips available
501985 . . . . . . . . . . . . . . . US$72 Dumont #5 Material: Length: Tips: Dumostar, non-magnetic, non-corrosive 11 cm (4 .3 in .) 0 .1 x 0 .06 mm Tips Tip Profile: 500233 . . . . . . . . . . . . . . . US$46
1:1
1:1
Dumont #5 Material: Length: Tips: Dumoxel, non-magnetic stainless steel 11 cm (4 .3 in .) 0 .1 x 0 .06 mm tips Tip Profile: 14098 . . . . . . . . . . . . . . . . US$32 Dumont #5 Material: Length: Tips: Stainless steel 11 cm (4 .3 in .) 0 .10 x 0 .06 mm
ST MO AR! UL
POP
1:1
500342 . . . . . . . . . . . . . . . US$30 Dumont #5 Material: Stainless steel, Biology Length: 11 cm (4 .3 in .) Tips: 0 .05 x 0 .01 mm tips 500341 . . . . . . . . . . . . . . .
US$
Tip Profile:
1:1
36
Tip Profile:
1:1
Dumont #5 Material: Length: Tips: Stainless steel, Medical Biology 11 cm (4 .3 in .) 0 .05 x 0 .01 mm Tip Profile:
1:1
14095 . . . . . . . . . . . . . . . . US$43
Dumont #5 Material: Length: Tips: Stainless steel, Medical Biology, bent at 45 11 cm (4 .3 in .) Tip Profile: 0 .05 x 0 .01 mm
US$
14101 . . . . . . . . . . . . . . . .
47
1:1
31
Dumont #5 Material: Length: Tips: Titanium 11 cm (4 .3 in .) 0 .1 x 0 .06 mm

US$
14096 . . . . . . . . . . . . . . . .
40
Tip Profile:
1:1
Dumont #55 Material: Length: Tips: Stainless Steel, Biology 11 cm (4 .3 in .) 0 .05 x 0 .01 mm
US$
14099 . . . . . . . . . . . . . . . . Dumont #5B
36
Tip Profile:
1:1
Material: Length: Tips:
Stainless steel, Biology, bent at 45 11 cm (44 .3 in .) 0 .05 x 0 .01 mm Tip Profile: 500234 . . . . . . . . . . . . . . . US$41
1:1
Dumont #7 Material: Length: Tips: Stainless steel 12 cm (4 .75 in .) 0 .17 x 0 .1 mm
14097 . . . . . . . . . . . . . . . . US$34
Tip Profile:
1:1
Economy Fine Tweezers

Made of quality stainless steel, these tweezers are useful for general dissections where ultrafine tips are not necessary . Economically priced per package of 6, they are affordable enough for everyone to have their own instruments .
All tweezers on this page are sold in packages of 6

Economy Tweezer Style 3 Material: Length: Tips: Stainless Steel 11 cm (4 .3 in .) 0 .20 x 0 .40 mm
501976-6 . . . . . . . . . . . . . US$49 501976 . . . . . . . . . . . . . . . US$12
1:1
1:1
501979-6 . . . . . . . . . . . . . US$49 501979 . . . . . . . . . . . . . . . US$12
1:1
501981-6 . . . . . . . . . . . . . US$49 501981 . . . . . . . . . . . . . . . US$12
32
Forceps
Iris Forceps, serrated Stainless steel 10 cm (4 in .) long, straight 0 .8 mm tips Standard 15914 . . . . . . . . . . . .
US$
Tip Profile:
German 20 15914-G . . . . . . . . . . .
US$
36
1:1
Iris Forceps, serrated Stainless steel 10 cm (4 in .) long, curved 0 .8 mm tips Standard 15915 . . . . . . . . . . . .
US$
Tip Profile:
German 22 15915-G . . . . . . . . . . . US$36 1:1
Adson Forceps, serrated Stainless steel 12 cm (4 .75 in .) long Standard German
Tip Profile: 35
1:1
14226 . . . . . . US$26 14226-G . . .

US$
Tip Profile:
1:1 Hartman Mosquito Hemostatic Forceps Stainless steel Standard 15920 15921 501705 501291 12 .5 cm (5 in .) long, straight . . . . . US$20 12 .5 cm (5 in .) long, curved . . . . . . US$22 9 cm (3 .5 in .) long, straight . . . . . . US$20 9 cm (3 .5 in .) long, curved . . . . . . . US$22 German 15920-G . . . . . . . . US$40 15921-G . . . . . . . . US$40 501705-G . . . . . . . US$40 501291-G . . . . . . . US$40
Tip Profile:
Kelly Hemostatic Forceps Stainless steel Standard 501241 Straight, 14 cm (5 .5 in .) long . . . . US$20 501288 Curved, 14 cm (5 .5 in .) long . . . . US$20 501714 Straight, 15 .5 cm (6 in .) long . . . . 501715 Curved, 15 .5 cm (6 in .) long . . . . .
US$ US$
German 501241-G . . . . . . . US$42 501288-G . . . . . . . US$42 501714-G . . . . . . . US$42 501715-G . . . . . . . US$42
Tip Profile:
24 24
1:1 Tip Profile:
33
Spring Scissors
Vannas Scissors, Super Fine, stainless steel Length: 8 cm Blades: straight 3 mm Tips: 0 .015 x 0 .015 mm Length: 8 cm Blades: curved 3 mm Tips: 0 .015 x 0 .015 mm 501778 . . US$215
These squeeze-handle micro scissors can be used ambidextrously .
Tip Profile:
Finest Tips in the World!

501839 . . US$239
1:1
Vannas Scissors, stainless steel
Length: Blades: Tips: Length: Blades: Tips:
8 .5 cm (3 .3 in .) straight 7mm 0 .025 x 0 .015 mm 8 .5 cm (3 .3 in .) curved 7mm 0 .025 x 0 .015 mm
500086 . . . . . . . . . .
US$
203
Tip Profile:
1:1
501232 . . . . . . . . . .
US$
210
Vannas Scissors Length: Blades: Tips: Standard 14003 . . . . . . . 125

$
8 cm (3 in .) straight 5 mm 0 .1 mm tips German 14003-G . . . . . . . 195

$
Tip Profile:
1:1
Vannas Scissors Length: Blades: Tips: Standard 14122 . . . . .

US$
8 cm (3 in .) curved, 5 mm 0 .1 mm tips German 155 14122-G . . . . . . . US$239
Tip Profile:
1:1
Vannas Scissors Length: Blades: Tips: Standard 500260 . . . . . US$167 8 cm (3 in .) 45 angled to side, 5 mm 0 .1 mm tips German 500260-G . . . . US$238
Tip Profile:
1:1
McPherson-Vannas Scissors Length: Blades: Tips: Length: Blades: Tips: 8 cm (3 in .) straight 5 mm 0 .1mm 8 cm (3 in .) curved 5 mm 0 .1mm
Tip Profile: Standard 14124 . . . . . . US$150 German 14124-G . .

US$
186
501234 . . . . . US$155
501234-G .
US$
239 1:1
Spring Scissors Length: Blades: Standard German Length: Blades: 12 cm (4 .75 in .) straight 12 mm extra fine and long 14125 . . . . . . . . US$162 14125-G . . . . . US$264 12 cm (4 .75 in .) curved 12 mm extra fine and long 14126 . . . . . . . . 34
US$
1:1 Tip Profile:
162
Mini-Dissecting Scissors, stainless steel 8 .5 cm (3 .3 in .) curved, sharp tips . . . . . .US$26 503666 503667 8 .5 cm (3 .3 in .) straight, sharp tips . . . . .US$26 503668 8 .5 cm (3 .3 in .) curved, blunt tips . . . . . .US$26 503669 8 .5 cm (3 .3 in .) straight, blunt tips . . . . . .US$26 Dissecting Scissors Standard 14393 14394 15922 15923 10 cm (4 in .) straight . . . . . 10 cm (4 in .) curved . . . . . 12 .5 cm (5 in .) straight . . . 12 .5 cm (5 in .) curved . . . . 22 US$ 22 US$ 22 US$ 22
US$
Tip Profile: 2 .2 cm 1:1
German 14393-G . . . . . . 14394-G . . . . . . 15922-G . . . . . . 15923-G . . . . . .
42 43 US$ 36 US$ 36
US$ US$
Tip Profile:
Iris Scissors, stainless steel Length: Blades: Standard 11 .5 cm (4 .5 in .) straight, Tungsten Carbide German
US$
Tip Profile: 2 .3 cm 1:1 Tip Profile:

US$
500216 . . . . . . Length: Blades:
53
500216-G . . . . . . US$107
11 .5 cm (4 .5 in .) curved, Tungsten Carbide

US$
500217 . . . . . .
53
500217-G . . . . .
107
Iris Scissors, stainless steel Length: 11 cm (4 .3 in .) Standard 501758 . . . . . . 501759 . . . . . .

US$
Blades: straight German 501758-G . . . . . . . . US$47 Blades: curved 501759-G . . . . . . . . US$47 2 .2 cm
Tip Profile:
26 26
Length: 11 cm (4 .3 in .)
US$
1:1
Mini-Iris Scissors 503670 503671 8 cm (3 .1 in .) straight, sharp tips . . . . 8 cm (3 .1 in .) curved, sharp tips . . . . 25 US$ 25
US$
Tip Profile:
Iris Scissors, SuperCut, stainless steel one edge micro serrated, one edge honed to the sharpness of a knife edge 10 cm (4 in .) Standard Straight Curved Straight Curved 14218 . . . . US$54 14219 . . . .
US$
German 14218-G . . 14219-G . .

US$ US$
80 82 2 .3 cm Tip Profile: Shown: 10 cm, straight
55
1:1
11 .5 cm (4 .5 in .) 503259 . . US$59 503260 . . US$65

S U RGIC Al IN ST Fine too ls for
veterina ry surger y and bio medic
RU M EN
al resear ch
TS
INTE RNAT IONAL EDITION
Hundreds more instruments available! Request your copy of the full-line catalog at www.wpiinc.com
2010
World Pr ecisio
n Instrum
ents
or call 866-606-1974 (toll-free in the U.S.)
35
Operating Scissors, stainless steel

11.5 cm (4.5 in.) Straight Standard 501753 Sharp/Blunt . . . . . . . . . . . 501754 Sharp/Sharp . . . . . . . . . . . 501743 Blunt/Blunt . . . . . . . . . . . . 11.5 cm (4.5 in.) Curved 501755 Sharp/Sharp . . . . . . . . . . . 501756 Sharp/Blunt . . . . . . . . . . . . 501757 Blunt/Blunt . . . . . . . . . . . .
US$ US$ US$ US$ US$ US$
German 20 20 20 20 20 20 501753-G . . . . . 501754-G . . . . . 501743-G . . . . . 501755-G . . . . . 501756-G . . . . . 501757-G . . . . .

US$ US$ US$
40 40 40 40 40 40 4 cm
US$ US$ US$
14 cm (5.5 in.) Curved 501220 Sharp/Sharp . . . . . . . . . . . 501221 Sharp/Blunt . . . . . . . . . . . . 501222 Blunt/Blunt . . . . . . . . . . . . 14 cm (5.5 in.) Straight 14192 Sharp/Blunt . . . . . . . . . . .
US$ US$ US$ US$ US$ US$
22 22 22 22 22 22
501220-G . . . . . 501221-G . . . . . 501222-G . . . . . 14192-G . . . . . . 501218-G . . . . . 501219-G . . . . .
US$ US$ US$
38 40 38 40 40 40
US$ US$ US$
501218 Sharp/Sharp . . . . . . . . . . . 501219 Blunt/Blunt . . . . . . . . . . . .
Tip Profiles:
Sharp/Blunt
14192
Sharp/Sharp
Blunt/Blunt 1:1
Needle Holders
Needle Holder 12 .5 cm (5 in .) long straight serrated jaws extra delicate Standard German 14109 . . . . . US$22 14109-G . . US$72
Tip Profile:
1:1
36
Clips and Clamps

Reflex Clip Applier 11 cm (4 .3 in .) long for 7 mm clips only 500343 . . . . . US$328 Reflex Clip Applier 11 cm (4 .3 in .) long for 9 mm clips only 500345 . . . . . US$328
Reflex Clip 7 mm for use with #500343 100/box, Stainless Steel, non-sterile 500344 . . . . . . US$67
Reflex Clip 9 mm for use with #500345 100/box, Stainless Steel, non-sterile 500346 . . . . . . US$67
Micro Bulldog Clamps
Retractors
14119-G Wire Retractors 5 cm (2 in .) long 10 x 5 mm blades 5 mm depth maximum spread 13 mm Standard German 14130 . . . . . . US$17 14130-G . . . US$25 14119 Curved serrated jaws Standard German 14119 . . . . . . US$32 32mm long, 12mm jaw 14119-G . . . US$55 38mm long, 9mm jaw
Scalpels, Knives, Blades and Handles

Scalpel Handle #3 13 cm (5 in .) long, stainless steel Standard German 500236 . . . . . . 500236-G . . . .
US$ US$
10 26 For Blades #10 ~ #15
Sterile stainless steel blades

10
All stainless steel scalpel blades are made by Feather, using a precise beveling technique to create the edges micron sharpness . They are the finest blades available. 500239 500240 Scalpel Blades #10, stainless steel, sterile (100 / box) Scalpel Blades #11, stainless steel, sterile (100 / box)
US$ US$
11
43 43
500353
Disposable Scalpel, No . 21, sterile, (10/box)
US$
12
37
Ear Punches and Ear Tags

1:1
Ear Punch 5 cm (2 in .) long, 2 mm diameter 500075 . . . . . .

US$
28
1:1
Ear Punch 10 cm (4 in .) long 2 mm diameter 1 mm diameter
500077 . . . . 500076 . . . .
US$ US$
58 58
Mouse Kit
Dumont #5 (#14098) Vannas Scissors (#14003) Iris Forceps, curved, serrated (#15915) Dissecting Scissors, straight 10cm (#14393) Wire Retractor (#14130) Needle Holder (#14109) Blunt Probe, 1.0 mm diameter (#501313) Order Number: MOUSEKIT Now includes storage case!
US$
US$
268 Value
179
Student Dissecting Kit

Includes: Dissecting Scissors, 4 .5 Dissecting Scissors, 4 Dressing Forceps, 5 .5 Micro Dressing Forceps, 4 #4 Knife Handle Straight Teasing Needle Angled Teasing Needle #22 Surgical Blade Canvas Roll-up 38
UK: Tel: 01438-880025 wpiuk@wpi-europe.com Germany: Tel: 030-6188845 wpide@wpi-europe.com
501336 501838
. . . . . . . . . . . . . . . . . . . US$23 Canvas Roll-up only . . US$12
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. China: Tel: 21 68885517 chinasales@china.wpiinc.com
Rodent Guillotine
Large, stable base Hardened blades for long service Ambidextrous configuration
DCAP
Guillotine for Rodents and other small animals US$ (opening 1 .5 x 1 .5 in .) 594 DCAP-M Guillotine for large rodents and other medium animals US$ (opening 2 .5 x 2 .5 in .) 990 US$ DCAP-l Guillotine for larger animals (opening 4 x 4) 1,434
The small animal guillotine has been completely redesigned for ease of use and extra added safety features . The blades are drawn together by magnetic force to ensure a clean and precise cut through very strong bones and skin . There is a large base for stability, long handle for extra leverage, spring action so the blades can not fall down unexpectedly, hardened stainless blades for endurance, simplified construction for easy maintenance . The fluoropolymer coated surface on the base makes cleaning easy . The guillotine is considered one of the most humane methods to dispense with a subject .
OmniDrill35
This line-powered micro drill will make easy work of grinding, finishing, cutting, and drilling bone, teeth, and other material . The high-torque 35,000 rpm (maximum) motor is quiet and has minimal vibration which reduces wear on the motor and provides greater comfort for the user . It also features a forward and reverse switch, E Type handpiece, and handpiece holder . The handpiece has a removable nose cone that can be cleaned and sterilized . It accepts 3/32 and 2 .33 mm bur shanks . Unlike battery-powered drills, this unit will maintain consistent power for the duration of use . The wide range of speeds allows the user to control the amount of heat generation . The following accessories are included with the Micro Drill System:
Qty 4 1 1 1 1 1 1 1 1 1 1 1 4 1 1 Description Abrading Tip, Rubber Abrading Tip, Stone Accessory Stand Ball Mill, Carbide, #1, .031 Diameter Ball Mill, Carbide, #2, .039 Diameter Ball Mill, Carbide, #3, .047 Diameter Ball Mill, Carbide, #4, .055 Diameter Ball Mill, Carbide, #5, .063 Diameter Ball Mill, Carbide, #6, .071 Diameter Ball Mill, Carbide, #7, .083 Diameter Ball Mill, Carbide, #1/4, .019 Diameter Ball Mill, Carbide, #1/2, .027 Diameter Cutoff Disk Mandrel, Screw Mandrel, Threaded
503598 503599
OmniDrill35 Micro Drill System, 110 V OmniDrill35 Micro Drill System, 220 V
US$ US$
839 839
Size Ball Diameter (mm)
1/4 0.5
1/2 0.7
1 0.8
2 1.0
3 1.2
4 1.4
5 1.6
6 1.8
7 2.1
8 2.3
OMNIDRIll35 SPECIFICATIONS
INPUT OUTPUT FUSE OPERATING SPEED RANGE DIMENSIONS WEIGHT 110V, 50/60 Hz 0-32 Vdc 1 amp 0-35,000RPM 178 x 114 x 89mm (7 x 4 .5 x 3 .5in .) 1 .7kg (3 .75lbs)
REPlACEMENT ACCESSORIES 501850 Abrading Tip, Rubber, pk of 20 501851 Abrading Tip, Stone, pk of 5 501852 Accessory Stand 501853 Ball Mill, Carbide, #1, .031 Diameter, pk of 5 501854 Ball Mill, Carbide, #2, .039 Diameter, pk of 5 501855 Ball Mill, Carbide, #3, .047 Diameter, pk of 5 501856 Ball Mill, Carbide, #4, .055 Diameter, pk of 5 501857 Ball Mill, Carbide, #5, .063 Diameter, pk of 5 501858 Ball Mill, Carbide, #6, .071 Diameter, pk of 5 501842 Ball Mill, Carbide, #7, .083 Diameter, pk of 5 501860 Ball Mill, Carbide, #1/4, .019 Diameter, pk of 5 501861 Ball Mill, Carbide, #1/2, .027 Diameter, pk of 5 501862 Cutoff Disk, pk of 20 501863 Mandrel, Screw, pk of 5 501864 Mandrel, Threaded, pk of 5 502237 Stereotaxic Holder for OmniDrill35 Microdrill
54 36 US$ 12 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 54 US$ 47 US$ 47 US$ 372
US$ US$
39
Binocular Loupes
High quality coated optics Mounted on spectacle frames Adjustable interpupillary distance Adjustable independent focus for each eye
500370 2 .5x Binocular Loupe
501331 4x Binocular Loupe
Gain control see clearly and accurately Unlimited uses, from surgical procedures to microcircuitry assembly
Priced so that everyone in the lab can have one!
BINOCUlAR lOUPES
PART # 500370 501331 PRISM POWER 2 .5x 4 .0x WORKING DISTANCE 35~50 cm 34 cm PRICE
US$ US$
420 714
Instrument Portfolio
Store your instruments in style . Elastic bands hold instruments in place against soft velveteen fabric . Portfolio folds in half and zips closed . Large portfolio holds up to 40 instruments, and the small portfolio holds up to 10 . 501319 Instrument Portfolio, Large 503294 Instrument Portfolio, Small
US$ US$
54 30
40
Sterilizing Trays
501729
Fine surgical instruments are too valuable not to protect . WPIs sterilizing trays help reduce damage from everyday use . With top quality structural Integrity, these trays are ideal for the handling and storage of all standard microdissection and surgical instruments . GEs ULTEM resin ensures product strength, structural integrity and extended life cycle .
See-through lids make it easy to locate the right instrument .

Suitable for all methods of sterilization (autoclave, steam, dry heat and chemical) . Unique grid design in base makes it easy to install the silicone finger mat required to protect the delicate instruments . 500252 500253 500254 501728 501729 500255 Sterilizer tray, 15 x 6 x 2 cm (6 x 2 .5 x 0 .75 in .), base, silicone mat, lid Sterilizer tray, 19 x 10 x 2 cm (7 .5 x 4 x 0 .75 in .), base, silicone mat, lid Sterilizer tray, 25 .5 x 15 x 2 cm (10 x 6 x 0 .75 in .), base, silicone mat, lid Sterilizer Tray, 25 .5 x 15 x 4 cm (10 x 6 x 1 .5 in .), base, insert tray, lid, 2 mats Sterilizer Tray for Knife 15 x 6 x 2 cm (6 x 2 .5 x 0 .75 in .), base, lid, 2 bars Silicone mat, 38 x 25 .5 cm (15 x 10 in .) 36 62 US$ 94 US$ 216 US$ 36 US$ 86
US$ US$
Dry Sterilizer
Sterilize your microdissecting and tissue culture instruments, thoroughly and conveniently, in seconds . No chemicals . No flames . No risk of burns . No disinfectant fluids . Glass beads heated to 260C kills all viruses, aerobic and anaerobic bacteria, yeasts and spores . (1 .5 mm lead-free glass beads included .)
GERMINATOR SPECIFICATIONS
O .D . I .D . WEIGHT 17 .1 x 13 .3 x 12 .9 cm (6 /4 x 5 /4 x 5 /16 in .)
3 1 1
5 .1 x 10 .2 cm (2 x 4 in .) 2 .3 kg (5 lb .)
US$ US$
14404 500121 14405
Dry Sterilizer (110 V) Dry Sterilizer (220 V) Extra Glass Beads
521 624 US$ 17
41
SMALL ANIMAL ANESThESIA
AN I MAL S U RGERY & S U PPORT
EZ-7000 Classic System

EZ Anesthesia is the system of choice for anesthetizing small animals, and it comes with a variety of choices. Animals to be anesthetized are placed in the acrylic induction chamber and the system delivers a precisely blended mixture of oxygen and isoflurane. An activated charcoal air filter canister at the top of the chamber releases safe, filtered air back into the room. A water-heated cage warmer or warming plate (ATC1000) is used to retain the animal body temperature while in the induction chamber. After the initial anesthetizing, the animal can be moved to the heated surgical water bed and positioned properly in the snugly fitted nosecone. A highly sensitive valve regulated by the animals breathing works with the nosecone to ensure non-rebreathing efficiency, and allow safe anesthesia for up to several hours. The breathing device also includes an air filter that releases safe, filtered air back into the room. EZ Systems include all necessary hardware components and connections. Oxygen and liquid Isoflurane are not supplied. These are required to operate the system. Each system comes with all necessary components and connections for immediate use, including:: l Oxygen regulator l Vaporizer Unit l One Induction Chamber (standard EZ-178) l One Breathing Device (standard EZ-103) l Case of charcoal filters Other available options include: l Heated Beds and Heating Pump l Additional Breathing Devices
EZ-FF9000 Fixed Flow System

The Fixed Flow System is our most advanced system and provides preset, fixed flow rates with no need for adjustment. The system offers five gas outlets, each with an individual ON/OFF switch. The system ensures consistent, precise gas flow when connected to any pressurized gas source higher than 7 psi. l Induction Chamber output is fixed at 1 Lpm l Four Breathing Circuit outputs are fixed at 0.5 Lpm This unit features an oxygen flush button that purges the induction chamber with pure oxygen, thereby protecting personnel from exposure to anesthesia gas when opening the chamber. A handle on the vaporizer makes the unit easy to safely transport. EZ-FF9000 Fixed Flow System
Features l Integrated turnkey solution for small animal anesthesia l Safe for surgical personnel, 90% below OSHA Isoflurane limit l Designed by veterinarians l Compact and portable l Time efficient and cost effective l Virtually stress-free for the animals l Easy to setup and use, simplifying the training of new staff and reducing the threat of human error l Speedy recovery time
EZ-7000 Classic System

The Classic System is the upgraded version of our original EZ-Anesthesia system. The new version has a reconfigured flow meter that is more user-friendly. The system offers five gas outlets that can supply a single induction chamber and four breather circuits simultaneously. The upgraded system also features an oxygen flush button that purges the induction chamber with pure oxygen, thereby protecting personnel from exposure to anesthesia gas when opening the chamber. A handle on the vaporizer makes the unit easy to safely transport. EZ-7000 Classic System
42
Components may not be as pictured.
EZ-B800 Basic System

The Basic System is designed for use with a single animal. It utilizes one output directly from the vaporizer into a Y-splitter which creates a dual feed that can be directed to the induction chamber or the breather circuit. This unit incorporates an oxygen flush system that purges the induction chamber with pure oxygen, thereby eliminating personnel exposure to anesthesia gas when opening the chamber. EZ-B800 Basic System
EZ-177 and EZ-178 Induction Chambers

These chambers incorporate a positive seal O-ring gasket for containment during use. EZ-177 EZ-178 Induction Chamber for Mouse 5L x 4.75W x 4.375 H Induction Chamber for Rat 9.75L x 4.75W x 4/375H
EZ-320 and EZ-330 Oxygen Regulators

Regulators are preset to 50 psi. l EZ-320 utilizes a CGA-540 connection for large H tanks. l EZ-330 utilizes a CGA-870 connection for small E tanks. EZ-320 EZ-330 Oxygen Regulator for large tanks Oxygen Regulator for small tanks
EZ-1130 Connection Kit

This kit is used for connecting additional components to the EZ-Anesthesia Systems. It includes 6 ft of clear PVC tubing with a quick-disconnect fitting. EZ-1130 Connection Kit
EZ-830 Ventilator Connection Kit

This kit is used to connect the SAR-830 ventilators with EZ-Anesthesia Systems. It includes all required components, pre-assembled for simple connection between the ventilator and the anesthesia system. EZ-830 Ventilator Connection Kit
EZ-340-XXXX Custom hose Assemblies

Custom built hose assemblies for wall or ceiling outputs specific to facility needs: Chemetron, Ohmeda, Schrader or DISS.
Euthanex Lids
The Euthanex Lid system has become an industry standard. Simply by removing the water bottle from the wire bar cage cover and placing the Euthanex Lid over the host cage, you are ready to perform euthanasia. You no longer need to transfer animals. The lids are available in five sizes to accommodate virtually all plastic cage sizes designed for small lab animals. These heavy duty stainless steel lids have a stem fitting for connection to the quick-disconnect fitting on the regulator hose from the regulator. A foam lid gasket ensures a good seal on the cage. Multiple lids may be used to treat several cages at once. EZ-20027 EZ-20028 EZ-20030 EZ-20032 EZ-20034 EZ-20029 Small Lid (13 x 9) Fits old-style mouse cages Small Lid (16 x 10) Fits new-style mouse cages Square Lid (13 x 13) Fits Thorn cages Medium Lid (20.5 x 11) Fits rat cages Large Lid (23 x 16.5) Fits guinea pig cages Lid Storage Bracket (wall-mounted,holds up to four lids)
Euthanex Gasket Kit

The gaskets seal and reduce noise levels when putting lid on cage. Gaskets are easy to remove and replace. Includes five replacement gaskets and adhesive strips for mounting. EZ-20027G EZ-20028G EZ-20030G EZ-20032G EZ-20034G Small Lid Gasket (13x9) Small Lid Gasket (16x9) Square Lid Gasket (13x13) Medium Lid Gasket (20.5x11) Large Lid Gasket (23x16.5)
Vaporizer Pole Mount

EZ-211 The E-28000 is a mounting option for the EZ-Anesthesia system, combining system portability with a small footprint. Constructed of Aluminum and Stainless Steel, it features a five leg base for maximum stability and an oxygen E tank mounting bracket. Anesthesia system must be purchased separately.
EZ-103
EZ-212
E-28000
Vaporizer Pole Mount
Mobile Workstations
EZ-107
Two mobile workstations, constructed of heavy-duty stainless steel with locking casters, integrate all your EZ-Anesthesia components into one portable unit. Open side shelves accommodate 20 lb. cylinders, and convenient 2" port holes allow for easy rigging of gas and electrical lines. Below the work surface of each mobile workstation is an open shelf and a locking cabinet. E-25000 provides a 42"x24" work surface and holds up to four cylinders. E-27000 has a 22"x21" work surface and holds up to two cylinders. These systems are easy to set up and provide maximum flexibility and mobility.
EZ-104A EZ-103A EZ-107A EZ-109 EZ-211 EZ-212
Versaflex Non-Rebreathing Unit Microflex Non-Rebreathing Unit Rat Stereotaxic Non-Rebreathing Unit Multi-Animal Non-Rebreathing Unit Mouse/Rat Thin-Line Heated Waterbed Mouse/Rat Standard Heated Waterbed
E-25000 E-27000
Mobile Workstation, 42" x 24" Top Mobile Workstation, 22" x 21" Top 43
ANALGESIA
Electronic von Frey Anesthesiometer
l Plug up to three probes into a single unit l LCD readout (Floating or last maximum/minimum) l Rigid tips up to 800 gm l Supertips 15 up to 65 gm l 1,000 gm probe available l Independence from temperature l Optional analog output cable for chart recorder l Pipette tips can be customized to any specification l Microprocessor electronics 0.1 gm plug-in probes
II-2390 II-2391 II-2392 II-2393 II-23931 II-2394 II-2395 II-2396 II-2397 II-2398 II-2399 II-2400 Electronic von Frey Anesthesiometer, rigid tips, 90 gram range Electronic von Frey Anesthesiometer, rigid tips, 800 gram range Electronic von Frey Anesthesiometer, rigid & 15 super tips, 90 gram range Electronic von Frey Anesthesiometer, rigid & 15 super tips, 800 gram range Electronic von Frey Anesthesiometer, custom rigid tips, 1000 gram range von Frey Probe, 90 gram range von Frey Probe, 800 gram range von Frey Probe, 1000 gram range MRI Probe Option (add to price of probe above) Limit Indicator Option (add to price of probe above) Cable for Limit Indicator (add to price of probe above) Analog Output Cable
To assess mechanical allodynia, which is a painful response to a light touch or pressure from a stimulus that is not normally painful, the Electronic von Frey Anesthesiometer was developed. The Electronic von Frey meter uses one of 15 different flexible von Frey hairs called SuperTips (or rigid tips up to 800 grams). Each hair, regardless of model chosen, is exactly 0.8 mm in diameter. This uniformity of design eliminates false readings and allows for comparison of test results. The Electronic von Frey can be used with chart recorders and analog/ digital converters, and it never needs calibrated. This system includes either a 90, 800 or 1,000 gram probe. Mesh stands are available in a variety of sizes for large group studies.
Trio
Get three test systems in one package with the Trio, featuring the Electronic von Frey, Plethysmometer and Randall Selitto Meters. Just like the Quattro package, the modular design allows these three test systems to communicate with the same electronic controller. The stand and sling for the Randall Selitto test are sold separately. II-2888 Trio 3-in-1 System
Quattro
This special package offers four tests, including Electronic von Frey, Plethysmometer, Randall Selitto and the Grip Strength Meter. You get all four test modules and the electronic controller that is interchangeable with all four systems. The electronic controller has up to three inputs, so you can perform up to four unique tests with only one electronic system. If you prefer, you may build your system and you grow. Because of the modular design of these four systems, you need to order only one complete system. Then, the modules for the other three tests, which integrate into the system, can be purchased separately, as needed. The stand and sling for the Randall Selitto test are sold separately. II-2889 Quattro 4-in-1 System
44
Plethysmometer (Paw Volume) Meter

l No wetting solution needed l One calibration/year l Battery-operated or line powered controller l One-year warranty
Test the effectiveness of anti-inflammatory agents and agents to reduce edemic conditions with the Plethysmometer. Simply insert the rat or mouse paw into water. A sensor in the water notes a pressure change when the paw is immersed. Pressure is calibrated in 0.1 milliliters and displays on the battery-powered monitor. The acrylic stand offers full visibility of the subject throughout the testing.
II-520MP Paw Volume Meter for Mouse & Rat
Randall Selitto Paw Pressure Meter

l Hands free operation with footswitch l Visible force limit indicator l Portable electronic display l Battery-operated or line powered controller l 3-oz. handheld probe with accuracy of 0.5% l No calibration required
The Randall Selitto Paw Pressure Meter for analgesia testing is digitally controlled. Use the handheld instrument to apply force to an animals extremity and get instantaneous, live readings. You can even view the last maximum force applied during the test. The new limit II-2500 indicator lets you select the maximum force limit, and then indicates with a warning light when the system reaches that limit. This unit comes with an acrylic stand to allow for easy viewing of the display. Stand and sling are sold separately.
Randall Selitto Paw Pressure Meter, 800 g pressure applicator
Grip Strength Meter

l Mouse and rat wire mesh grid plates included l Maximum force range is 2,000 gm (10% over range allowed). Higher ranges are available by special order. l 1 gram increment readings l Suction feet on the heavy, anodized base plate resist even large pulling forces l Battery-operated or line powered controller l One year warranty
Measure muscle hyperalgesia in rats and mice with the Grip Strength Meter, which gauges the forelimb grip force using a digital force transducer. Simply hold the animal by the tail and gently dangle it over the wire mesh plate until the animal grasps the plate with its forepaws. The force transducer, connected with the wire mesh plate, measures the strength of the animal at the time of the test. The batteryoperated, electronic control device calculates the II-2200 Grip Strength Meter for Mouse & Rat average of three measurements, and it holds the last maximum force in a peak and hold type readout until you reset it.
45
ANALGESIA
Incremental hot Cold Plate Analgesia Meter
l Heat or cool, from 0-70C l Ramping temperatures for threshold and latency results l Rapid increase or decrease in temperature l Precise programmable digital control l Printout of data l Temperature stability is 0.1C l Includes clear animal enclosure l Plate size 4 x 8 l Two-year warranty
This safe, humane device for rats and mice is used for latency and threshold-based nocicetption, ramping temperatures for 0-70C. Because this hot cold plate is incremental, it measures latencies of much more than just the strong narcotic agents, broadening dramatically the range of analgesia research with devices of this type. Microprocessor-controlled, the Incremental Hot Cold Plate can heat or cool in increments of 0.1C, at a rate of 1-10C per minute. With uniform heating and cooling and upper/lower cut-off limits, this device is II-PE34 predictable and safe. It can also function as a constant temperature plate with great stability (0.1C). As soon as a reaction is observed from the chosen paw, the unit reverses to the standby temperature.
Incremental Hot Cold Plate Analgesia Meter for Mouse & Rat
Incapacitance Meter for Mouse & Rat

l Precise programmable digital control l Start, stop and reset test from controllers front panel l 180-270 gram holder included (other sizes available) l Reaction detected automatically l Manual override of all timer functions l Alphanumeric readout l 5 to 999 seconds test period l Alphanumeric readout l All functions and parameters entered via key-pad l Two-year warranty
II-600MR Incapacitance Meter for Mouse & Rat
Test pain and inflammation in the hind limbs of mice, rats or birds with the Incapacitance Meter. It uses a technique called dual channel weight averaging, which tests both hind limbs. This gives you a clean, stress-free correlation of the paw pressure test. Conduct control and testing of the animal at the same time. Place the animal in the holder with its hind limbs resting on the two weight-averaging platform pads. The controller records the average weight (grams) over the test period as the animal shifts its weight from each pad
46
hot Plate Analgesia Meter

l Includes both mouse and rat enclosure l Temperature indicated in 0.1C increments l Holding accuracy is +/- 0.1C l Digitally controlled l Two-year warranty
Use the Hot Plate Analgesia meters for latency testing in rats and mice. Simply place the animals on a black anodized, aluminum plate (11 x 10.5 x 0.75, 275 x 263 x 15 mm) and set the plates surface temperature to the desired setpoint (up to 75C). The plate maintains a consistent temperature throughout the test. II-39 Hot Plate Analgesia Meter for Mouse & Rat
Plantar Test Apparatus/Tail Flick Test Analgesia Meter
l Includes three acrylic animal enclosures that each hold two rats or four mice l Precise programmable digital control l User-defined humane cutoff feature l Adjustable beam intensity in 1% increments up to 250C l Reaction is detected automatically
This unit, which is designed for testing narcotics and strong non-narcotic drugs, offers both Plantar (Hargreaves Method) and Tail Flick testing with a single unit. Either testing system is also available individually. In plantar mode, the visible light/heat source is directed at the paw or other desired body part, and in tail flick mode it is directed at the subjects tails. Test up to 12 mice or 6 rats simultaneously. If desired, other animals like cats and rabbits may also be used. Tests are simple to setup. The focused, radiant heat/light source creates a 4 x 6 mm intense spot. Because the light is visible, you know when the test starts and ends. The equipment is silent (no whining or clicking sounds) to avoid
l Alphanumeric readout l Manual override of all timer functions l All functions and parameters entered via key-pad l Heated glass option l Tail temperature monitor option (for use with the Tail Flick meter)
giving a more accurate reading. An optional tail temperature monitor can also be selected for use with the Tail Flick meter. This option actually preheats the tail before experimentation. Once the preset tail temperature is reached, the test and timer automatically begin. A glass stand is also available in two sizes for large group studies.
triggering an automatic response in conditioned animals. You can set a humane cutoff timer that automatically shuts off the heat if no response is observed during the designated time frame. When an animal is placed on cold glass, its reaction time may be slower. This unique system offers a heated glass option that prevents the glass enclosure from acting as a heat sink, II-336T
Combination Plantar/Tail Flick Meter, non-heated glass and tail temperature for mouse and rat II-336TG Combination Plantar/Tail Flick Meter, tail temperature and heated glass for mouse and rat II-390 Plantar Test Analgesia Meter, non-heated glass for mouse and rat II-390G Plantar Test Analgesia Meter, heated glass for mouse and rat 47
Animal Temperature Controller
l PID control for maximum temperature stability l Low noise DC heater l Dual temperature sensor inputs l Audible alarm protects the element from overheating
ATC1000 is a low noise heating system for maintaining animal body temperature during experimental procedures. The DC heater is extremely quiet in terms of electromagnetic radiation. This is essential in electrophysiological recordings which are very sensitive to electromagnetic interference. The controller uses proportional, integral, and derivative (PID) technology in adjusting the DC voltage output. Compared with switched on/off type controllers, PID controllers provide a much more precise and stable control of temperature. The PID approach is also more immune to the variation of the experimental conditions such as change in animal size and unexpected disturbances. The controller has dual temperature sensing inputs. One input is used to monitor and control the animal temperature. The other is used to monitor the temperature sensor in the heating pad to prevent the localized hot spots under animal. The auto tuning feature of the fuzzylogic PID controller is easy to use and the manual setting of parameters provides the extra control ability if need. The temperature resolution of the controller is 0.1 C. A rectal temperature probe has a 6-ft ultra-flexible shield cable and an RTD sensor. It makes convenient and precise animal temperature measurement. The metal heating plates (available separately) have built-in temperature sensors. Compatible with stereotaxic systems, the rigid, flat surface fits under the U-frame. Plates are washable with water and detergent.
ATC1000 SPECIFICATIONS
RESOLUTION .................................................... 0.1 C ACCURACY ........................................................ 0.3 C SENSOR ............................................................. RTD 2.0 mm x 25 mm MAxIMUM DC OUTPUT ................................ 27 V, 1A TEMPERATURE RANGE .................................. Up to 45 C POWER ............................................................... 90-240 V, 50-60 Hz DIMENSIONS ................................................... 45 x 30 x 7 cm WEIGHT.............................................................. 11 lb (5 kg)
ATC1000
Animal Temperature Controller
REQUIRED ACCESSORIES (select one sensor and one plate) 502195 Small Heating Plate with built-in RTD sensor, 10 x 15 cm 502196 Medium Heating Plate with built-in RTD sensor, 15 x 25 cm 502197 Rectal Temperature Probe, 2 mm shaft diam., 3.5 mm ball tip 503524 Mouse Probe, 1.8 mm shaft diam., 2.5 mm ball tip 503567 Mouse Adaptor Heating Plate with built-in RTD sensor, 4x15 cm (for 502063 Stereotaxic Adaptor)
48
VENTILATORS
CW-MRI-1
The CW-MRI-1 ventilator is a small animal ventilator designed for use in MRI and other highly magnetic field environments, though its use is not limited to those environments. It offers manual or remote operation of pneumatic, non-metalic valves. The CW-MRI-1 operates on the flow-time principle, dispensing a known airflow into the lungs for a set inspiratory time to generate desired tidal volumes. Three controlsrespiratory rate, inspiratory time and flow rateallow for accuracy and extraordinary flexibility over a wide range of volumes, breaths-per-minute and inspiration/expiration (I/E) ratios. The unit can be expanded to ventilate larger animals. A source of compressed air or helium is required for operating the pneumatic valves.
CW-SAR-830/AP
The CW-SAR-830/AP small animal ventilator operates in either a volume or pressurecycled mode, meaning that it dispenses a designated volume of air with each breath or it ventilates until a designated lung pressure is reached. Pressurecycled ventilation prevents hyper-inflation of small animal lungs. In volume mode, it dispenses a known airflow into the lungs for a set inspiratory time to generate the desire tidal volumes. In pressure mode, a built-in, solid-state transducer monitors airway pressure. Simply set the desired end-inspiratory pressure. This ventilator is compatible with inhalation anaesthetics and oxygen, and it may be expanded to ventilate larger animals.
Features
l Non-metalic, pneumatic valves l Wide tidal volume and rate range l Safe with oxygen and anesthesia l Internal air pump l Direct readout of volume and rate CW-MRI-1 Ventilator
Features
l Pressure or volume cylced l Wide tidal volume and rate range l Internal air pump l Safe with oxygen and anesthesia CW-SAR-830/AP Ventilator
VENTILATOR SPECIFICATIONS
CW-MRI-1
RESPIRATORY RATE RANGE TIDAL VOLUME RANGE INSPIRATION TIME RANGE INSPIRATION/ExPIRATION RANGE INTERNAL AIR PUMP CAPACITY INSPIRATORY FLOW RANGE PRESSURE CONTROL RANGE POWER DIMENSIONS 120/240V (switchable), 100VA 9x5.5x9 (23x14x23cm) 20-80% 4 LPM 50-1000 mL/min 0-1000 mL/min 0-50.0 cmH2O 120/240VAC, selectable 9x5.5x9 (23x14x23 cm) 5-150 breaths/min 0.1-30 mL
CW-SAR-830/AP
5-200 breaths/min 0.2-35 mL (using internal valves. External valve assemblies available for larger animals) 0-5.00 seconds
microCAPSTAR CO2 Analyzer
Features
l Use with Ventilated or unassisted animals l End-tidal peak or continuous CO2 readings l Low sample flow requirements, rapid response time l Simple one-gas calibration
CW-MICROCAPSTAR SPECIFICATIONS
MEASUREMENT RANGE 0-9.9% (0-76mmHg) CO2 75mS at 70mL/min through cell 150mS at 50mL/min sampling +5PSIg BNC 120VAC/220VAC switchable, 25VA 19x5.25x16, 49x13x41cm 10lb. (4.5kg)
microCAPSTAR extends CO2 monitoring to the realm of small animals. The advanced features, reliability and ease of operation make it the perfect companion to the CW-SAR-830/AP small animal ventilator. Featuring low sample requirements, rapid response time and long-term stability, this CO2 analyzer provides accurate end-tidal or continuous measurement of expired CO2. The LCD screen displays CO2 concentration (instantaneous ETCO2 in either percent or mmHg), respiratory rate measurements and trend plot of the end-tidal values. An adjustable ETCO2 alarm warns when end-tidal values fall out of the user-adjustable preset range. Built-in diagnostics warn of plugged sample tubing or other fault conditions.
RESPONSE TIME MAxIMUM SAMPLE CELL PRESSURE SIGNAL OUTPUTS POWER DIMENSIONS WEIGHT
CW-MICROCAPSTAR
CO2 Analyzer 49
Precision Stereotaxic Instruments for Small Animals

WPIs Precision Stereotaxic Instrument is built around the time-proven U-frame design concept, providing stability, and adaptability to most species. Precision alignment ensures accurate placement of electrodes, micropipettes, and other devices. It is ideal for researchers in need of a versatile, reliable instrument for stereotaxic procedures with small animals
l l l
5 mm linear movement per revolution on each axis Absolute lock at 90 (vertical) Entire frame is electrically continuous, ideal for Electrophysiology Accessories available for use with a wide variety of small animals
Versatility of positioning
The manipulator arm controls medio-lateral and vertical positioning via lead screws with 80 mm of travel. This allows the fastest positioning possible, consistent with lining up the scales easily at a given coordinate. The anteroposterior movement is controlled via a dovetail slide movement, with 80 mm of travel possible in each direction. A universal joint allows the investigator to change the angle of the probe up to 90 in either the antero-posterior or mediolateral planes. The locking mechanism will hold any angle position without drift or creep. It also provides an absolute lock at 90 vertical.
TAXIC-600 Stereotaxic Frame with UltraMicroPump Injection System
Easily read scales

All scales are oriented to be read easily from the open end of the U. This is the position from which most scientists prefer to work. The numerals on the scales are clear and easy to read. Precise alignment with facing vernier scales gives accurate resolution to 0.1 mm.
Convenient for electrophysiology

The entire Stereotaxic frame including the dovetails, manipulator arms and base are electrically continuous. Grounding of the entire frame including the base plate can be accomplished by connecting the provided grounding stud to earth. This is ideal for electrophysiological studies where the animal and surrounding structures need to be grounded to reduce electrical noise.
Above: 502600 Precision Sterewotaxic Frame. At right: 502603 Dual Manipulator Stereotaxic Frame.
502600 502650 502603 502653 TAXIC-600 TAXIC-650 TAXIC-603 TAXIC-653
Precision Stereotaxic Frame with 18Ear Bars Precision Stereotaxic Frame with 45Ear Bars Dual Manipulator Stereotaxic Frame with 18Ear Bars Dual Manipulator Stereotaxic Frame with 45Ear Bars Stereotaxic Frame with 18Ear Bars plus UMP3-1 System Stereotaxic Frame with 45Ear Bars plus UMP3-1 System Dual Manipulator Stereotaxic Frame with 18Ear Bars plus UMP3-1 System Dual Manipulator Stereotaxic Frame with 45Ear Bars plus UMP3-1 System
50
Digital Display Stereotaxic Instrument
All scales are oriented to be read easily from the open end of the U. This is the position from which most scientists prefer to work. The digital frame features compact linear position sensors powered by an SR44 battery cell thus avoiding major electromagnetic interference. The large, easy-to-read LCD display provides a digital readout to 0.0005/0.01mm resolution for all three axes and has higher precision and reproducibility than conventional verner scales. Built-in to the frame itself, the LCD display saves working space and avoids electromagnetic interference from connecting cables. Use the zero reset function anywhere along the 80 mm of travel to quick set a reference point and directly read the distance traveled. Chose metric
or English unit settings. The entire Stereotaxic frame including the dovetails, manipulator arms and base are electrically continuous. Grounding of the entire frame including the base plate can be 502900 502950 502903 502953 TAXIC-900 TAXIC-950 TAXIC-903 TAXIC-953 502157
accomplished by connecting the provided grounding stud to earth. This is ideal for electrophysiological studies where the animal and surrounding structures need to be grounded to reduce electrical noise.
Digital Stereotaxic Frame with 18 Ear Bars Digital Stereotaxic Frame with 45 Ear Bars Dual Manipulator Digital Stereotaxic Frame with 18 Ear Bars Dual Manipulator Digital Stereotaxic Frame with 45 Ear Bars Digital Stereotaxic Frame with 18 Ear Bars plus UMP3-1 System Digital Stereotaxic Frame with 45 Ear Bars plus UMP3-1 System Dual Manipulator Digital Stereotaxic Frame with 18 Ear Bars plus UMP3-1 System Dual Manipulator Digital Stereotaxic Frame with 45 Ear Bars plus UMP3-1 System Replacement Batteries for Digital Caliper & Digital Micrometer (package of 10)
51
Stereotaxic Accessories
ADAPTORS 502063 Mouse and Neonatal Rat Adaptor 502213 Platform, Gas Anesthesia, with mouse Mask (use with 502063) 502062 Mouse Adaptor 502204 Rat Adaptor with a pair of ear bars, 18 502226 Cat/Monkey Adaptor for 502600 series 502238 Spinal Adaptor for Rat 502060 Guinea Pig Adaptor for 502600 series 502241 Dog/Monkey Adaptor for Parallel Rail Stereotaxic instruments, with a pair of ear bars, 18 The WPI Mouse and Neonatal Rat Adaptor (502063) employs light, Delrin adjustable ear bars with tapered points on one end and thumbscrew on the other to facilitate surgery on mice and rat pups. Adjustable ear bars may be independently adjusted in height to level the skull. Laser engraved scales show the vertical positions of the ear bars. A tooth bar and nose clamp secures the nose. A well in the thick aluminum body may be filled with dry ice and alcohol for hypothermic anesthesia of neonatal animals. The adaptor clamps securely on the right side of the U frame of the stereotaxic instrument. When gas anesthesia is needed, a gas mask (502213) may be mounted on the adaptor.
502241
502063
502213
502238
502062
502204
52
502237
PROBE hOLDERS 502210 Probe Holder with corner clamp 502067 Probe Holder with side clamp 502070 Cannula Holder, opens to 3.4mm 502068 Large Probe Holder, 6.5-13mm opening 502237 Extra Large Holder for Microdrill (OMNIDRILL35) 502236 Microdialysis Probe Holder, 1.5mm hole 502244 Micrometer Adjustable Electrode Holder, 10 resolution, 25mm travel 502245 Manual Microsyringe Injection Holder, 10 resolution, 25mm travel
502068
502245
OmniDrill35 not included see page 41.
502070 502244
EAR BARS 502055 Ear Bars, Rat, 18, (pair) 502056 Ear Bars, Rat, 45, (pair) 502224 Ear Bars, Cat, 18, (pair) 502225 Ear Bars, Cat, 45, (pair) 502235 Ear Bars, Mouse, 60. Non-rupture, (pair) 502242 Ear Bars, Rat, Hollow. 1.5mm hole through for auditory stimulation
502235
502056
502225
502242
502054
502053
OThER ACCESSORIES 502053 Mask, Gas Anesthesia, Mouse 502054 Mask, Gas Anesthesia, Rat 502213 Platform, Gas Anesthesia, with mouse Mask (use with 502063) 502243 Adjustable Stage Platform for 502600 series, 2cm high 503598 Micro-Drill, 35K RMP, 110/220VAC, w/ a set of bits 503599 Micro-Drill, 35K RMP, 240VAC, w/ a set of bits 503567 Heating Plate for 502063, 4x15cm, 5mm thick, works with ATC1000
502243
53
Rail ment rallel stru Pa

axic In ls t Stereo Anima Large for
WPIs Parallel Rail Stereotaxic Frame systems are heavy-duty research instruments for large laboratory animals such as cats, monkeys, and dogs. The solid large frame and superior rigidity ensure the precise alignment of animals for Stereotaxic surgery, injection, and recording. The system can adopt up to four manipulators with 100-micron resolution on each axis. Each manipulator can smoothly moved to and locked at any location on both parallel rails in an arrange of 20 cm. Parallel Rail Stereotaxic Frame system for large animals include the Parallel Rail Frame, base plate, manipulator(s), Cat/Monkey or Dog adaptor, and swivel mount.
502227 502228 502229 502230 502231 502232 502233 502234
Stereotaxic Frame System with one manipulator for Cat and Monkey Stereotaxic Frame System with two manipulators for Cat and Monkey Stereotaxic Frame System with three manipulators for Cat and Monkey Stereotaxic Frame System with four manipulators for Cat and Monkey Stereotaxic Frame System with one manipulator for Dog Stereotaxic Frame System with two manipulators for Dog Stereotaxic Frame System with three manipulators for Dog Stereotaxic Frame System with four manipulators for Dog For more options and accessories, visit the website www.wpiinc.com
54
MPM-7
Multi-Parameter Monitor
WPIs MPM-7 Multi-Parameter Monitor offers portable, cost-effective, versatile and reliable multi-parameter monitoring in the animal market. Seven core parameters and options allow the monitor to be used standalone in small animal clinics and large veterinary facilities by connecting, wired or wireless, with a central monitoring system. The high-resolution color screen clearly displays time, alarms, ECG, Heart Rate, NIBP, Pulse Oximetry, Respiration Rate, Apnea Trends, Temperatures and Trace Freeze simultaneously. The operators can ceaselessly browse the data in the previous MPM-7 OPTIONAL 503601 503602 503603 503604 503605 503608 503610 Multi-Parameter Monitor ACCESSORIES ECG cable, 5 Leads, Defibrilator Protected NIBP Cuff and extension tube (for small and medium animals) NIBP Cuff (large animal) SpO2 ear clip probe and extension cable TEMP probe (Skin or rectal) Defi-protected ECG-cable, 5 Leads Thermal array recorder 240 hours and store 72 hours of data in memory. With optional internal thermal printer, 3 waveforms can be recorded. To cope with modern clinics equipped with many highpowered electronic instruments, the monitor is designed for protection from defibrillator and high-frequency electrosurgical generator when used on the same animal at the same time. In the event of an unexpected power shortage, a built-in rechargeable battery keeps the monitor continuously working for 2 hours and can be automatically and rapidly recharged. l High-resolution, 10.4 color TFT display; CRT can be connected simultaneously l ECG, SpO2, NIBP, RESP, TEMP, HR and PR l Optional Dual-IBP, Et-CO2, built-in thermal recorder, built-in battery l HRV and 13 kinds of arrhythmia analysis, S-T segment analysis l 300 seconds ECG waveforms review l Maximum 72-hour graphic and tabular trends of all parameters and 72-hour data records, 100 items alarm event records l Anti-high-frequency electrosurgical equipment l Display 9-channel waveform maximum in the screen l 7-channel ECG waveforms displayed in one screen simultaneously l Adjustable 3-level audible and visual alarms l Application to small size animal or middle size animal
55
Microprobe Thermometers
l Super Accuracy l Fast Response l Analog output signal l Multiple inputs l Differential Temperature Measurement BAT-10
Stand sold separately
BAT-12
A Microprobe Thermometer is the instrument of choice for biological and laboratory temperature measurements. These thermometers are very versatile, providing fast response, high accuracy and stability with digital display and analog signal for connection to a computer or recorder. With the wide selection of probes, the instruments can be used in almost any application. BAT-12 This thermometer has a sealed construction making it water, dust and fume resistant. The BAT-12 has a single microprobe input and a single range with the same high accuracy as the BAT-10. Comes complete with carrying case. The thermometers can be used with any Type T thermocouple. Select a temperature microprobe on the following page for your specific application. BAT-10 This is the most versatile thermometer available. The instrument has a wide temperature range and fast response with most microprobes. The BAT-10 accuracy is NIST traceable and in each of the two temperature ranges, the accuracy is the same as the resolution. There are three microprobe inputs, 1 and 2 can be selected as separate inputs while 2 and 3 will read the differential temperature measurement between the two. The instrument has automatic warnings for low battery or faulty probes on the digital display. The linearized analog output (LOP) signal allows ease of connection to a data acquisition system or recorder.
BAT-10R/LOP Multiple Input Type T Thermocouple Thermometer, rechargeable NiCad batteries and 110 VAC adapter (microprobes ordered separately) BAT-10R/LOP-220 Multiple Input Type T Thermocouple Thermometer, rechargeable NiCad batteries and 220 VAC adapter (microprobes ordered separately) BAT-12R Single Input Type T Thermocouple Thermometer, rechargeable NiCad batteries and 110 VAC adapter (microprobes ordered separately) BAT-12R-220 Single Input Type T Thermocouple Thermometer, rechargeable NiCad batteries and 220 VAC adapter (microprobes ordered separately) OPTIONAL ACCESSORIES EXT-6 Probe Extension Lead, 180 cm long SBT-5 Thermocouple Switch Box, 5 probe inputs on back with numbered push button switches on the front. Connects 5 microprobes to one BAT-12R 501608 Tripod Stand for BAT-12
MICROPROBE ThERMOMETER SPECIFICATIONS

BAT-10 TEMPERATURE RANGE & RESOLUTION DIFFERENTIAL TEMP. RANGE -200C to +400C, 1C resolution -100C to +199.9C, 0.1C resolution -19.99C to +19.99C Linearization centered at 40C 0.01C resolution 1C 1 least significant digit 0.1C 1 least significant digit 0.01C 1 least significant digit 1 least significant digit Conforms to NIST tables 312 Digit LCD Miniature, quick disconnect, copper-constantan Non-linearized set at 1.6 V, corresponding to temperature of 401C BAT-10: 4 alkaline C cells (life: 1000 hr) BAT-10R: 4 Ni-Cad C cells (rechargeable unit) Three Type T thermocouple inputs 15-45C 21.6 x 22.9 x 8.9 cm (8.5 x 9 x 3.5 in.) 1.6 kg (3.5 lb), including carrying case Follows NIST thermocouple tables within 1 digit 312 Digit LCD Miniature, quick disconnect, copper-constantan 10 mV per degree C BAT-12: 9V cell BAT-12R: 9V Ni-Cad with charger One Type T thermocouple input Auto-compensated to 0.1C from 0C to 50C 12.7 x 6.4 x 15.2 cm (5 x 2.5 x 6 in.) 1 kg (2 lb), including carrying case BAT-12 -100C to +199.9C, 0.1C resolution N/A
ACCURACY 1 Range 0.1 Range Diff. Range REPEATABILITY CALIBRATION CONFORMITY DISPLAY INPUT SOCKET ANALOG OUTPUT POWER SUPPLY / BATTERIES SENSORS AMBIENT OPERATING RANGE DIMENSIONS WEIGHT
0.1C 1 digit between 0-50C 0.1% 1 digit over full range
56
Temperature Probes
l Flexible Teflon microprobes are used for implantation in tissue, in spectrophotometer cuvettes, rectally in neonatal mice, in water baths, PCR thermal cyclers, etc. l Animal rectal temperatures during surgical procedures and pyrogen testing. l Skin temperature measurement during exercise physiology studies.
When precise temperature measurements are required, WPI can provide you with a very accurate monitor and thermocouple microprobes. WPI monitors have both resolution and accuracy of 0.1C in the 0-50C range and are traceable to NIST standards, whereas, other competitive electronic thermometers have
Probe Type Size Style Time Constant Isolated
an accuracy that is usually to 0.5C or worse. Furthermore, all our type T clinical probes are guaranteed accurate to 0.1C, due to our stringent wire standards. These are five times more accurate than competitive probes made with regular Special Limits wire.
Max. Temp.
Lead Length
Description
NEEDLE MICROPROBES Fast-response needle probes for instant readings in tissue, semisolids, liquids, very small specimens, powders and materials. Needle tip is sealed to ensure only stainless steel contacts specimen. MT-29/1 29 ga / 1 cm A 0.125 sec No 200c 5 ft 29 gauge approximately 0.013-in MT-29/2 29 ga / 2 cm A 0.125 sec No 200c 5 ft MT-29/3 29 ga / 3 cm A 0.125 sec No 200c 5 ft MT-29/5 29 ga / 5 cm A 0.125 sec No 200c 5 ft MT-26/2 26 ga / 2 cm A 0.1 sec No 200c 5 ft 26 gauge approximately 0.018-in MT-26/4 26 ga / 4 cm A 0.1 sec No 200c 5 ft MT-26/6 26 ga / 6 cm A 0.1 sec No 200c 5 ft MT-23/3 23 ga / 3 cm A 0.15 sec No 200c 5 ft 23 gauge approximately 0.125-in MT-23/5 23 ga / 5 cm A 0.15 sec No 200c 5 ft MT-23/8 23 ga / 8 cm A 0.15 sec No 200c 5 ft MT-4 29 ga / 1 cm A 0.025 sec No 200c 5 ft Similar to MT-29/1 but has a blunt tip. Good for instant skin and surface temperatures, liquids MT-D C 0.025 sec No 200c 5 ft Fast response surface probe (stainless steel for locating inflammation, arteries, etc. Also for dental use. MT-29/1B 29 ga / 1 cm B 0.015 sec No 150c 5 ft Insect Probe. Similar to MT-29/1 except sensor is welded into tip for maximum heat transfer. Other sizes made to special order. FLEXIBLE IMPLANTABLE PROBES Designed for high accuracy on extremely small specimens such as insects, seeds, etc. Maximum insertion depth 1/8". Totally sheathed in chemical resistant Teflon. Sensor Lead Diameter IT-14 0.050" dia D 0.3 sec Yes 150c 3 ft IT-18 0.025" dia D 0.1 sec Yes 150c 3 ft IT-18EXLONG 0.025 dia. D Yes 150c 5 ft IT-21 IT-23 0.016" dia 0.009" dia D E 0.08 sec 0.005 sec Yes Yes 150c 150c 1 ft 3 ft For ultra fast measurements and for use on micro-size specimens. Tissue implantable with 239a. Needle (supplied). Rather fragile. Teflon coated. As IT-18 sensor except bead exposed. Combines ultrafast reponse of IT-23 with sheath strength of IT-18. Rectal probe for rats typically for fast intermittent measurements. Smooth ball tip (0.125-in. dia.) with 1" long (0.59-in. dia) stainless steel shaft. Rectal probe for mice similar to RET-2 except tip diam. 0.063-in. and shaft 3/4-in. long (0.028-in. diam.) Workhorse probe for liquids, gases, semi-solids. Plastic handle with straight stainless steel shaft. Not good for surface temperatures. Like HT-1 except shaft length is 9-in. Plastic handle with welded stainless steel, immersible shaft used for surface temperatures of solids, liquids, gases and semisolids. Tip is 0.02-in. diam., at right angle to probe to facilitate surface measurement.
IT-1E
0.025" dia
0.005 sec
Yes
150c
3 ft
RECTAL PROBES RET-2 -
0.8 sec
No
125c
5 ft
RET-3
0.5 sec
No
125c
5 ft
GENERAL PURPOSE HT-1
0.5 sec
No
400c
5 ft
HT-2 BT-1
H I
0.5 sec 0.15 sec
No No
400c 240c
5 ft 5 ft
57
Blood Pressure Measurement for Rats and Mice
Systems shown here have been superseded by newer versions, but no information was available at press time. Contact WPI for up-to-date information.
Proprietary environmental control system and unique single tail cuff that allows animals to move their tails create minimal stress in the animal subjects
l Configurable for 1-24 animals l MRI systems available l Quick and accurate blood pressure measurement at temperatures as low as 32C
l Highly sensitive photoelectric sensor for blood pressure detection l Monitor, record, store or export real time systolic, diastolic, mean and heart rate with custom-designed software
Automatic Inflation Part # II-229M II-3M229SC II-6M229 II-12M229 Auto Inflation with Data Acquisition Software Part # II-229M31 II-3M229SC31 II-6M22931 II-12M22931 II-24M22931 Components include: Tail Cuff Sensors Rodent Restrainers Warming Chambers Tail Cuff Stand Amplifier (Manual or Auto Inflation) Cuff Pump, Automatic Scanner, Manual Accessory Package
Measuring blood pressure in mice Number of Manual Inflation and rats is tricky business. The key Animals is to minimize stress to the animal Part # that causes its vital signs to fluctuate. This unique system was designed to 1 II-29M produce accurate measures every time, 3 because animal stress is truly minimal. Two primary sources of stress include 6 thermostress and lack of creature 12 comforts. The proprietary environmental control system is set to a constant 32C, 24 the optimal temperature for taking blood pressure measurements for rats. If desired, the setpoint can be easily altered to meet the researchers needs. In addition the single tail cuff (instead of two cuffs) makes this a one-of-a-kind system. The single cuff design gives the test subjects unrestrained freedom of tail movement, making them more comfortable and reducing unnecessary stress.
58
Blood Pressure Monitor and Transducer

Monitors animal arterial or venous blood pressure Displays systolic, diastolic or average blood pressure
BP1 accepts WPIs BLPR blood pressure transducer (below) as well as other blood pressure transducers. An audio monitor provides a signal with variable pitch and amplitude, allowing you to hear changes in blood pressure. Digital LCD display provides average or peak signal values from 0 to 1999 mV. With an optional pressure gauge (not provided see PM015D/R, page 199), the user may calibrate the display to read mm Hg. Recorder output connector allows direct connection to a pen recorder, oscilloscope or computer via a data acquisition system.
SYS-BP1 ACCESSORIES BLPR2 BPCABLE2 503067 13024 13025 3491 500184 14036-15 KZ1101
Pressure Monitor (transducer & cable not included) Specify line voltage NEW Blood Pressure Transducer & Cable NEW Cable (12 ft) with DIN connector for BLPR2 BLPR2 Transducer without cable Single Rack Mount Kit Dual Rack Mount Kit Extension Cable, 5 ft BNCtoBNC Cable, 10 ft 4Way Luer Stopcock, Blue Tint (package of 15) Micro Cannula, 3 inch
BP1 SPECIFICATIONS
AMPLIFICATION BANDWIDTH, SMALL SIGNAL (3 dB) x1, x10, x100, variable (x5 to x1000) 300 kHz (x1) 30 kHz (x10) 3 kHz (x100) 0.3 kHz (x1000) 5 volts 2 mA 100 k || 0.01 F 10 V nominal, varies with load. 25 mA, maximum 0 to 1999 mV (calibrated in mm of Hg pressure when supplied with pressure gauge). Meter reads average value or peak (1 to 20 Hz). POWER DIMENSIONS SHIPPING WEIGHT 95135 V or 220240 V, 50/60 Hz 8.5 x 5.12 x 10 in. (21.6 x 13 x 25.44 cm) 11 lb (5 kg)
Note: BLPR2 is intended for animal research only and may not be used for human blood pressure measurement.
OUTPUT VOLTAGE SWING MAXIMUM OUTPUT CURRENT INPUT IMPEDANCE, EACH INPUT TRANSDUCER APPLIED VOLTS DIGITAL PANEL METER
BLOOD PRESSURE TRANSDUCER
BLPR2 SPECIFICATIONS
WORKING PRESSURE OVERPRESSURE EXCITATION VOLTAGE INPUT IMPEDANCE OUTPUT IMPEDANCE ISOLATION SENSITIVITY DYNAMIC RESPONSE EIGHT HOUR DRIFT MAXIMUM ERROR 50 to + 300 mm Hg 400 to +4000 mm Hg 110 VDC or RMS to 5 kHz 350 10% 300 10% < 5 A leakage at 120 VAC 5 V/V/mm Hg 100 Hz 1 mm Hg after 5 minute warmup Total combined effects of Sensitivity, Linearity, Hysteresis (at 25C and 5 V/V/mm Hg) do not exceed 2% or 1 mm Hg, whichever is greater. +15C to +40C 30C to +60C Not affected by light under 3000 ft/candles (32,000 lux) 1 lb
Stopcock #14036 included with BLPR2 BLPR2 can be used for the direct arterial and venous pressure mea surement in animal blood vessels. Supplied sterile, BLPR2 is accurate, linear and stable with temperature. May be sterilized cold with Cidex or a similar bactericide. BLPR2 is equipped with a twelvefoot cable and connector compatible with WPIs fourchannel signal conditioning unit, TBM4M Transbridge, and the singlechannel BP1 blood pressure monitor. Cable has moisture resistant locking connector. A continuous, uniform lumen eliminates places for bubbles to form and lodge. The clear fluid path is easy to inspect. Easy to mount slotted transducer body accepts Velcro strap. To facilitate setup and operation, a fourway stopcock that allows easy filling, flushing, and zeroing of the transducer is included. Typically, the stopcock is located between the transducer and the animal catheter where it can be used to quickly zero, flush, or debubble the transducer. 59
ENVIRONMENTAL Operating Temp. Range Storage Temp. Range Light Sensitivity SHIPPING WEIGHT
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel: 9413711003 Fax: 9413775428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
RFID Tagging
Radio frequency identification system for small animals
l The smallest RFID tags available on the market (1x6mm) l RFID tags are read and writeable in milliseconds l Easy to configure system l Ergonomic design l Safe for animals l Non-traumatic injection l Track animal for its entire life with a single RFID tag
These RFID tags, the smallest on the market, are ideal for quick identification of small animals like mice, rats, rabbits and guinea pigs. The tags are so tiny they can be implanted with minimal stress in small animals only a few days after birth using an ergonomic syringe with a needle diameter of 1.2mm (18 guage). Because these unique Bluetooth readers operate at 13.56 MHz, they can also be used to read and write to plastic RFID card which can be attached to cages or carried by lab personnel. This lets you use the same reader for identification of test subjects and for supplementing laboratory security. The Bluetooth RFID arm reader (above) and handheld reader (below) communicate with a computer up to 50m away.
READER SPECIFICATIONS
Handheld Reader WEIGHT SIZE OPERATING FREQUENCY POWER PERFORMANCE IDENTIFICATION OF TAG NUMBER DATA RETRIEVAL DATA WRITING BATTERY LIFE IN USE STANDBY LCD DISPLAY BLUETOOTH COMMUNICATION 300g 20x9.5x6cm 13.56MHz Internal Lithium battery < 6ms < 6ms < 50ms 8 hours up to 24 hours 2 lines/16 characters 50m Arm Reader 450g 15x10x5.5cm (arm box) 17.7x3.5cm (pen reader) 13.56MHz Internal Lithium battery < 6ms < 6ms < 50ms 8 hours up to 24 hours 2 lines/16 characters 50m
TRANSPONDER SPECIFICATIONS
SIZE WEIGHT OPERATING FREQUENCY NEEDLE SIZE 1mm diameter x 6mm long 7.15mg 13.56MHz 18 guage (1.2mm) 512 bits 10,000 times Glass 20C, 24 hour under 1m 20C, 100 hour 6, 14200Hz, 3 axis, 8H per axis 30g, 18ms, 3 axis, 1084 times 40C to 90C (+120C for total 100 hours) 40C to 85C
The tiny RFID transponder is loaded into a singleuse syringe designed for sterile, nontraumatic injection into small animals.
MEMORY REWRITEABLE BIOCOMPATIBLE TUBE CHEMICAL RESISTANCE WATER IMMERSION IP68 ALCOHOL, AMMONIAC...IMMERSION VIBRATION IEC 68.3.6 SHOCK IEC 68.2.27 STORAGE TEMPERATURE OPERATING TEMPERATURE
Not available for veterinary use.

LU-T02-100 LU-S05 LU-S06 LU-S09 LU-PRO LU-READER Pack of 100 Transponders Lab Bench Reader Hand Held Reader Arm Reader Software, Single Computer Interfaces Reader to Computer
60
Cannulae
Banaji Cannula Bullet-shaped tip, 6 ports for multi-directional irrigation, 25G 555835L. . . . . . . . . . . . . . . .US$29 Spatulated Cannula Flattened spatulated tip, 26G 555830L. . . . . . . . . . . . US$24
Gimber Fountain Cannula Bullet-shaped tip, 25G 555831L. . . . . . . . . . . . . . . US$24
Buratto Cannula One front and two side ports, 25G 555833L. . . . . . . . . . . US$24
Buratto Cannula One front and two side ports, 23G 555834L. . . . . . . . . . . . . . US$24
Vidaurriv Cannula Double-armed, 8irrigating ports, 25G 555836L. . . . . . . . . . . US$43
Lacrimal Cannula Curved with reinforced shaft, 10mm tip, 23G 555938A . . . . . . . . . . . . . . US$34
Posterior Capsule Polisher Front opening, gently curved, 25G 555920A . . . . . . . . . US$48
Micro Cannula
l 0.4mm O.D., 0.2mm I.D. tubing l Autoclavable l Biocompatible Perfluorocarbon tubing material
KZ1101 Micro Cannula, 3"
US$
96
This micro cannula is ideal for placement in the carotid or femoral artery of mice, rats, and other small animal blood vessels. It can be used with a pressure transducer (WPIS BLPR2) for blood pressure measurement, or in conjunction with a micro-syringe injection system (like WPIs UMPIII or MMP pumps). The incorporated standard female luer fitting makes connecting to existing experimental plumbing quick and easy. The cannula is provided with a contoured-tip stainless steel stylet (trocar) to facilitate placement using established techniques. A movable shoulder ring provides a tie-in point to prevent accidental removal. The cannula may be left in place for two hours or more, and with proper care and cleaning, may be re-used multiple times. Instructions for use included.
TurtleSkin FullCoverage
Entire Hand Protection Fingertip to Forearm
While no glove is puncture or cut proof, TurtleSkin FullCoverage gloves give you puncture and cut protection covering the entire hand. Surprisingly soft and comfortable, these gloves offer over 35 ounces of needle protection. 501888 501889 501890 501891 TurtleSkin Gloves, small, pair TurtleSkin Gloves, medium, pair TurtleSkin Gloves, large, pair TurtleSkin Gloves, extra large, pair 95 95 US$ 95 US$ 95
US$ US$
TurtleSkin is a registered trademark of Warwick Mills, Inc. Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
61
Sensor Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63
Free Radical Detection

Hydrogen Peroxide & Oxygen Sensor Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 ISO-HPO-2, ISO-HPO-100 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 APOLLO 1000 One-channel Free Radical Analyzer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 TBR4100 Free Radical Analyzer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 Multi-Port Measurement Chambers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
Nitric Oxide Detection

Nitric Oxide Sensor Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 ISO-NOP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 ISO-NOPNM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64
BIOS EN S I NG
ISO-NOPF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 ISO-NOP007, ISO-NOP30 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 ISO-NOP30-L, ISO-NOP70-L . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 NSA-3 NO Sensor Pre-Polarizer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 JUV ISO-NOP Rejuvenator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 SNAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 GSNO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71
Neurotransmitter Detection
Micro C Carbon Fiber Potentiostat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72 Carbon Fiber Microelectrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
Oxygen Detection
OxyMicro Fiber Optic Oxygen Sensors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 OxyMini Fiber Optic Oxygen Sensors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 FLOX Fluorescence-based Oxygen Sensor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75 ISO2 Dissolved Oxygen Meter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76
pH Meters and Electrodes

pHOptica Fiber Optic pH System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 Beetrode Micro pH Electrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 pH-Silver Low-noise combination pH electrode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 CALBUF Calcium Calibration Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 Dri-Ref Reference Electrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 Kwik-Tip Ion-selective Electrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 Liquid Ion Exchangers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 ProGuide electrode holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 JE671P pH meter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81
62
Sensors
MacRO SENSORS
SPEcIES
Order Number Price Available Diameters Response Time Detection Limit/Range Sensitivity Drift Temperature Dependent Physiological Interference Replacement Sleeves (pkg of 4) Filling Solution Start-up Kit 2 mm < 5 sec 1 nM 2 pA/nM None Yes None #5436 #7325 #5435 2 mm < 5 sec 2 mm < 10 sec 2 mm < 5 sec < 5nM 2 pA/nM Yes None #600016 #100084 #600015
Nitric Oxide ISO-NOP
Hydrogen Peroxide ISO-HPO-2
Oxygen ISO-OXY-2
Hydrogen Sulfide ISO-H2S-2
< 100nM to 100mM 0 .1%-100% 0 .02 pA/nM N/A < 1%/min 0 .1pA/min Yes None #600012 #100042 #600011 Yes None #5378 #7326 #5377
BIOS EN S I NG
MINI SENSORS
SPEcIES
Order Number Price Available Diameters Available Length Response Time Detection Limit/Range Sensitivity Drift Temperature Dependent Physiological Interference Microsensor Cable Available with Hypodermic Sheath
Nitric Oxide ISO-NOPF

(pkgof2) 100 & 200 m 4 mm < 5 sec 0 .2 nM 10pA/nM none slight
Hydrogen Peroxide ISO-HPO-100

(pkgof3) 100 m 4 mm < 5 sec < 10 nM-1mM 1 pA/nM 1 .0 pA/min slight Yes #91580 ISO-HPO-100H (pkgof3) ISO-HPO-100L (pkgof3)
sors iSen Min xide ngths the ic O e e Nitr stom L lengths, usx or ISOcu ing custom PF100-Cxxx with in the rder -NO 1mm
#91580 ISO-NOPFH Price (pkgof2) Available as L-shaped for tissue bath ISO-NOP70L Price (pkgof2)
ce SO no ra Whe mbers I and repla mple, fo hould be t nu 0-Cxx exa er s red r b par orde num 20 th . Fo OPF red leng the part s can be , 2mm, N m sor esi tip, the d e sensor C01 . Sen gths: 1m len 0ibl flex F20 custom NOP g ISO- followin mm . 5 he in t m or 4m mm, 3
MIcRO SENSORS for NO

Order Number Price Available Diameters Available Length Response Time Detection Limit/Range Sensitivity Drift Temperature Dependent Physiological Interference Cable
ISO-NOP30
(pkgof3) 30 m 0 .5 mm, 2 mm < 3 sec 1nM 1~4pA/nM none yes none #91580
ISO-NOP007
(pkgof3) 7 m 0 .1mm, 2 mm < 3 sec 0 .5 nM 1~4pA/nM none yes none #91580
ISO-NOPNM
(pkgof3) 100 nm 0 .2 mm < 3 sec 0 .5 nM 0 .5 pA/nM none some none #91580
63
Nitric Oxide Sensor Guide

All WPI NO sensors are 100% compatible with the ISO-NO Mark II (NOMK2), APOLLO 4000, APOLLO 1000, and the new TBR4100 Free Radical Analyzer.
APPLICATIONS SENSOR SENSOR DIAMETER RESPONSE TIME (with NOMK2) LOWEST DETECTION LIMIT TEMPERATURE SENSITIVITY DRIFT SENSITIVITY PHYSIOLOGICAL INTERFERENCE in vivo ISO-NOPF 100 & 200 m < 5 sec 0.2 nM some none 10 pA/nM none Cell Cultures, NO 2 , NO3, ISO-NOP 2 mm < 5 sec 1 nM yes none 2 pA/nM none Tissue Bath ISO-NOP30L 30 micron < 3 sec 1 nM yes none 1.4 pA/nM none Tissue Bath ISO-NOP70L 70 micron < 3 sec 1 nM yes none 1.4 pA/nM none Microvessels ISO-NOP30 30 micron < 3 sec 1 nM yes none 1.4 pA/nM none Microvessels ISO-NOP007 7 micron < 3 sec 0.5 nM yes none 1 pA/nM none Single Cell ISO-NOPNM 100 nm < 3 sec 0.5 nM some none 0.5 pA/nM none
Selectivity of WPIs NO sensors

The ideal NO sensor should be insensitive to other reactive species likely to be present within the measurement environment . The conventional Nafion coated carbon fiber NO sensor exhibits a large response to such species .
WPIs unique NO sensor technology utilizes a novel surface membrane which amplifies the response to NO while eliminating responses to a vast range of reactive species, including nitrite, absorbic acid, hydrogen peroxide, catecolamines, and much more .
BIOS EN S I NG
ISO-NOP The original nitric
NO and NO Detection 3 2 A simple change in experimental protocol will enable the ISO-NOP to be conveniently used for indirect rapid accurate determination of nitrite (NO ) and nitrate (NO ) concentration in 2 3 samples . Using this method a detection limit for NO or NO as low as 1 nM is routinely 2 3 possible .
AbdominalX-rayshowingtheappratusconsistingoftwocustomizedISO-NOPnitric oxideprobes,4-channelpHcatheter,and Teflonnasogastrictube.(CourtesyProf.K.E.L. McColl,UniversityDepartmentofMedicine andTherapeutics,WesternInfirmary,Glasgow, Scotland.)Iijima,K.,etal.Gastroenterology 2002:122:1248-1257.
oxide probe ideal for cell cultures, cell suspensions and many other applications
The ISO-NOP is a popular, robust and high performance sensor encased within a 2 mm diameter disposable stainless steel protective sleeve . The tip of the sleeve is covered with a NO-selective membrane . Replacement membrane sleeves can be purchased separately (WPI #5436) and require an internal electrolyte (WPI #7325) .
ISO-NOP 5435 5436 7325 7521 5399 7357
Replacement 2 mm shielded sensor and cable ISONOP Startup Kit (recommended with first purchase) Replacement Sleeve Kit for 2 mm sensor, pkg of 4 ISO-NO Electrolyte (10 mL) ISO-NO Electrolyte, CO2-insensitive (10 mL) T-Adapter Kit (pkg of 3) for ISO-NOP Nitrite Standard Solution, 1 gram/liter (100mL)
Current / pA
Current / pA
The worlds smallest nitric oxide NanoSensor, designed for measurement of NO at the cellular level.
Ag/AgCl Sensing Element WPI Membrane
ISO-NOPNM
100 nm
150 m
SchematicdrawingofthenewintegratedNOnanosensor.(USPatentPending)
making it indisputably thesmallestandmost sensitiveNOsensorintheworld! The ISO-NOPNM is based on a novel design in which an electrochemically activated composite graphite nanofibre is used as the NO-sensing element . The surface of the NanoSensor is then modified using a unique multi-layered NO-selective membrane . Figure at right illustrates the response of the ISO-NOPNM following successive additions of nanomolar concentrations of NO . The ultra-low noise of the ISO-NOPNM (0 .5 pA) enables a detection limit of just 0 .5 nM NO . The response time of ISO-NOPNM is less than 3 seconds . ISO-NOPNM 91580 SNaP50
800 600 400 200 0 0 300 600 900 1200

y = 0.5968x + 6.4967 R2 = 0.9973
Concentration / nM
Time / S
AmperometricresponseoftheNOnanosensor(ISONOPNM)tothesuccessiveadditionsof2nM,4nM,8 nMNOinto0.1MPBS(pH=7.4).
The ISO-NOPNM NanoSensor has a tip diameter of just 100 nm (0 .1 m) and a detection limit for NO of less than 0 .5 nM
100 nm NanoSensor, pkg of 3 (requires cable #91580) Microsensor Adapter Cable SNAP, 50 mg vial
64
Current (pA)
unique flexible NO sensor! Designed for arteries, microvessels, in vivo applications, and similar applications. ISO-NOPF electrodes are the newest addition to WPIs nitric oxide sensor family and are available in 100 m and 200 m diameters . Utlilzing the latest advances in nanotechnology and material science, scientists at WPIs Sensor Laboratory have created these completely flexible and virtually unbreakable NO sensors . The new sensors are based on a composite graphite NO-sensing element combined with a reference electrode . The surface of the sensor is then coated with a unique multi-layered NO-selective membrane .
ISO-NOPF
50 pA
Sensor Body 60 mm x < 2 mm diam. Ag/AgCl

10 sec 4 nM 2 nM 8 nM
flexible 100 m or 200 m
1 nM
5 mm 2 mm
Time (s)
ResponseofISO-NOPFtoNO. SchematicdrawingofISO-NOPF.
ISO-NOPF100 ISO-NOPF200 91580 SNaP50
100 m Flexible NO Sensor, pkg of 2 200 m Flexible NO Sensor, pkg of 2 Microsensor Adapter Cable SNAP, 50 mg vial
ISO-NOP007 ISO-NOP30 7 and 30 micron sensors with exceptional

performance ideal for tissues and microvessels The ISO-NOP007 and ISO-NOP30 have recently been improved in design and performance . The ISO-NOP007 has a tip diameter of just 7 microns and a length of 2 mm . The ISO-NOP30 has a tip diameter of 30
microns and is available in two different tip lengths (i.e., ISO-NOP3020 has tip length of 2 mm, ISO-NO3005 has tip length of 0 .5 mm) . The response of the ISO-NOP007 and ISO-NOP30 is linear over a wide dynamic concentration range of NO . The design of both electrodes is based on a single carbon fiber coated with WPIs NO-selective membrane . A detection limit of approximately 1 nM NO makes these electrodes ideal for use in tissues and microvessels .
BIOS EN S I NG
Current (pA)
300 pA
20 sec
1600
Sensor Body Ag/AgCl 60 mm x < 2 mm diam. 2 mm or 0.5 mm
Current / pA
1200
y = 1.3583x + 16.15 R2 = 0.9985
800
7 m or 30 m
400
0 0 300 600 900 1200
Concentration / nM
Time (s)
2 mm
SchematicdrawingofISO-NOP007andISONOP30.
Theresponseofa7mNOsensor(ISO-NOP007) tosuccessiveadditionsofNO(100nM).Insetshows thelinearityoftheresultingcalibrationplot.
ISO-NOP007 ISO-NOP3020 ISO-NOP3005 91580 SNaP50
7 m Nitric Oxide Sensor (pkg of 3) 30 m Sensor Tips (2 mm length), pkg of 3 (requires #91580) 30 m Sensor Tips (0 .5 mm fiber), pkg of 3 (requires #91580) Microsensor Adapter Cable SNAP, 50 mg vial
Simultaneousmeasurementofforce(toptrace)and changesofNOconcentration(lowertrace)in(A) theratsuperiormesentericarteryrelaxedwithACh and(B)asmallhumanarteryrelaxedwithAChand SNAP.Inthisarteryoxyhaemoglobin(oxyHb)partly reversedtheincreaseinNOconcentration,with onlyasmallchangeinforce.[U.Simonsen,et al ., J . Physiol .,1999,516:271-282.]
ProGuide
Novel electrode holder
Designed to hold WPI biosensors and any standard pH electrode, the unique ProGuide allows the positioning of an electrode in small sample volumes without the need for a micromanipulator . The smooth mechanism easily moves an electrode side-to-side or up and down while keeping it at a constant vertical angle . The ProGuide Plus comes with a micrometer positioner which allows fine adjustment of 0 .01mm in your samples . 47520 47510 47530 47540 ProGuide Positioner/Holder ProGuide Positioner/Holder with Base ProGuide Plus Positioner/Holder with Micrometer ProGuide Plus Positioner/Holder with Micrometer with Base
65
HYDROGEN PEROXIDE & OXYGEN SENSOR GuIDE

ISO-HPO-2 APPLICATION SENSOR DIAMETER RESPONSE TIME DETECTION LIMIT DRIFT SENSITIVITY PHYSIOLOGICAL INTERFERENCE Cell Cultures, etc . 2 .0 mm <5 SEC (90%) <100 nM to 100 mM <0 .1 pA/min 8 pA/M none ISO-HPO-100 100 micron <5 SEC (90%) <10 nM to 1 mM <1 .0 pA/min 1 pA/nM Contact WPI ISO-HPO-100-L 100 micron <5 SEC (90%) <10 nM to 1 mM <1 .0 pA/min 1 pA/nM Contact WPI ISO-OXY-2 Cell Cultures, etc . 2 .0 mm <10 SEC (90%) 0 .1 % to 100% <1%/min N/A none Tissue/Microvessels Tissue Bath
Hydrogen Peroxide Sensors

Hydrogen Peroxide is produced in biological systems by controlled pathways at low concentrations that impact on cell signaling . At higher concentrations inflammatory cells produce local intense amounts of this oxidant to kill pathogens . In the progress of human disease, uncontrolled formation of hydrogen peroxide from the mitochondrial respiratory chain and enzymes, such as xanthine oxidase, can occur (Prof . Victor Darley-Usmar, Univ . of Alabama, personal communication) . Despite the recognized importance of this oxidant in biology real-time measurements at low concentration have been difficult . The hydrogen peroxide sensors developed by WPI are designed to compliment existing high sensitivity fluorescent approaches with direct quantitative measurement in biological samples in the low nM range . Two hydrogen peroxide sensors are currently available . The ISOHPO-2 is a 2 .0 mm stainless steel sensor, with replaceable membrane sleeves (#600012) and an internal refillable electrolyte (#100042) . The sensor is designed for use in cell cultures ISO-HPO-2
and similar applications . The graph below Illustrates the linearity of response of the sensor following successive increases in hydrogen peroxide concentration in solution . The ISO-HPO-100 is a 100 micron tip diameter hydrogen peroxide
ISO-HPO-100 micro sensor designed for use in tissues and similar applications . The sensor design is based on a flexible activated carbon fiber sensing electrode coated with a proprietary membrane that enhances hydrogen peroxide detection . Both sensors incorporate WPIs proprietary combination electrode technology whereby the hydrogen peroxide sensing element and separate reference electrode are encased within a single Faradayshielded probe design . This design has been shown to enhance performance during measurements and minimizes overall sensor size . 600011 ISO-HPO-2 ISO-HPO-100 600012 100042 ISO-HPO Startup Kit (recommendedwithfirstpurchase) 2mm Shielded HPO Sensor & Cable 100 m HPO Sensor (requires #91580), pkg of 3 Replacement Sleeve Kit for ISO-HPO-2, pkg of 4 ISO-HPO-2 Electrolyte (10 mL)
BIOS EN S I NG
ISO-NOP30-L ISO-NOP70-L ISO-HPO-100-L ISO-NOPF200-L10

L-shaped sensors for tissue bath & cell culture studies
Oxygen Sensors
FORT-100 Transducer Micrometer Connect to Microsensor Cable #15810
The ISO-OXY-2 is a 2 .0 mm stainless steel sensor, with replaceable membrane sleeves (#5378) and an internal refillable electrolyte (#7326) . The sensor is similar in design to WPIs popular OXELP oxygen sensor (see page 55) . ISO-OXY-2 5377 5378 7326 2 mm Shielded Oxygen Sensor & Cable ISO-OXY Startup Kit (recommendedwithfirstpurchase) Replacement Electrode Sleeve Kit, pkg of 4 ISO2 Filling Solution (electrolyte)
The ISO-NOP30-L is a unique Held in microL-shaped nitric oxide sensor manipulator 3 mm designed specifically for use in carbon ber tissue bath studies and similar 10 mm applications (e.g., see WPIs MYOBATH) . The shape of the sensor has been engineered to facilitate Bath placement of the electrode within 10 mL the lumen of the tissue vessel under study . The ISO-NOP70-L is similar in construction to the ISO-NOP30 but with the advantage of having a flexible tip (70 m diameter) . The ISO-NOPF200-L10 is designed L-shapedNOsensorusedwithMyospecifically for cell culture studies . bath. ISO-NOP30-L NO Sensor, L-Shaped 30-micron (pkg of 3) ISO-NOP-70-L NO Sensor, L-Shaped 70-micron (pkg of 2) ISO-NOPF200-L10 NO Sensor, 200 m Flexible L-shaped (pkg of 2) ISO-HPO-100-L HPO Sensor, L-Shaped 100-micron (pkg of 2) 91580 Microsensor Adapter Cable
Temperature Sensor
The temperature sensor (#ISO-TEMP-2) is based on a 2 .0 mm tip diameter high quality miniature platinum RTD (Resistance Temperature Detector) electrode . This design has been shown to provide greater accuracy, stability and interchangeability during temperature measurements than traditional thermistor and thermocouple sensors . The ISO-TEMP-2 is included with the purchase of a system . ISO-TEMP-2 91580 2 mm Platinum RTD Temperature Sensor (requires #91580) Microsensor Adapter Cable
66
A p o l l o 10 0 0
one-channel Free Radical Analyzer
Separate inputs for temperature and amperometric or potentiometric (pH and other voltage sensors) provides versatility for a wider array of sensors. Poise voltage can be controlled by external command, allowing ramps, pulses, and techniques other than chronoamperometry, including cyclic voltammetry, differential pulse polarography or simply sweeping the poise voltage with a ramp to determine concentrations of endogenous species. Outputs for sensor current and poise voltage allow XY plots for polarography
BIOS EN S I NG
Easy-to-use
The Apollo 1000 is a single-channel, non-isolated free radical analyzer with extremely quiet analog outputs that allow easy integration into nearly any experimental setup from vessel relaxation studies in a tissue bath to complex in vivo experiments . The pathway of the sensor signal is straightforward . The Apollo 1000 converts the sensor current signal into a voltage at a user selectable gain passing it to an adjustable analog filter block, the signal is then buffered and sent to the output . WPI recommends collection of the signal with our Lab-Trax data acquisition interface and Data-Trax software . Pre-configured Data-Trax Setup files for the Apollo 1000 provide optimal settings for data collection and analysis, software adjustments can be made to all acquisition display or analysis options including smoothing and filter adjustments .
with DC poise voltages . When the Apollo 1000 is configured for these types of applications, it is preferable to present the data as an XY plot . Our Data-Trax v2 .0 software offers XY plotting and a variety of other mathematical functions . This versatility makes it well suited for analysis and display of electrochemical data .
Potentiometric input
In addition to its free radical sensor input, the Apollo1000 has a separate potentiometric input . This input has an impedance of 1015 ohms, making it capable of accepting pH electrodes directly without buffer amps . The Data-Trax software incorporates a linear multipoint calibration feature allowing the user to calibrate for linear sensors of any slope or for logarithmic responses such as those from ion selective electrodes .
APOLLO 1000 SPECIFICATIONS

POISE VOLTAGE Range: Digital resolution: Full Scale Ranges: Offset adjustment: Low pass Filters Notch Filter: Analog Output: Analog Output Max Current: 2V 62 .5V 1A, 100nA, 10nA, 5nA 10 nA poise and range dependent F0: 40 Hz 1st order; F1: 40 Hz 4th order; F2: 4 Hz 4th order; F3: 0 .4 Hz 4th order Twin T Active Notch Filter @ 0 .2Hz 4V = Selected Range Filters off: +5mA / -12mA, Any filter on: 50mA VOLTAGE AMPLIFIER Range: Input Impedance Filters: Analog output Analog output max current: Power Supply Internal Batteries: Estimated Operating time: External AC Adapter: Max Charging Time: 10x 1 .2V 1300mAh 120 Hours + 12V AC @ 1 Amp 234 minutes (controlled internally) 2V 1015 F0: 30 kHz 1st order; F1: 40 Hz 4th order; F2: 4 Hz 4th order; F3: 0 .4 Hz 4th order x 2 Amplification Filters off: 15mA, Any filter on: 50mA
accommodates a wide variety of amperometric sensors

When performing free radical measurement, using amperometry, noise levels are directly related to detection limit . If you are looking at Nitric Oxide from low current output sensors it will be necessary to reduce bandwidth (resulting in lower rise time) to reduce noise . Lower noise reduces the risk that small currents from lower sensitivity sensors could be masked . In species like oxygen or others where output currents are larger and additional noise is not an issue, the Apollo 1000 has the ability to increase the bandwidth of higher current signals for better response .
TRANSIMPEDANCE AMPLIFIER, CURRENT
Poise Voltage control

The Apollo 1000 has a poise (polarization) voltage range of 0V~ 2V . In addition, the Apollo 1000 can allow the poise voltage to be driven by an external signal . The split supply (+ and - voltages) together with the external command allow cyclic voltammetry, differential pulse polarography and a host of other electro-chemical techniques not possible
aPOLLO1000 1-Channel Free Radical Analyzer System Includesmeter,onesensor(specify),temperaturesensorandstart-upkit INST-aPOLLO Installation and Training LaB-TRaX-4 4-Channel Data Acquisition System See sensors on pages 63-66.
67
Four-channel Free Radical analyzer
BIOS EN S I NG
l Real-time detection using electrochemical microsensors. l Integrated system includes one temperature sensor, your choice of two additional sensors, and a start-up kit. l Measure up to four different species in the same preparation or simultaneous measurement in four different preparations. l Current measurement range from 300 fA to 10 A (four ranges) permits wide dynamic range for detection. l Wide bandwidth allows recording of fast events.
Real-time detection and measurement of a variety of redox-reactive species is fast and easy using the electrochemical (amperometric) detection principle employed in the new TBR4100 . This optically isolated four-channel free radical analyzer has ultra low noise and independently operated channels . For use with WPIs wide range of nitric oxide, hydrogen peroxide, hydrogen sulfide and oxygen sensors, the TBR4100 can measure four different species simultaneously in the same preparation . Simply plug a sensor into any one of the input channels on the front panel and select the current range . Poise voltage can be selected from a range of values tuned for optimal response from WPI sensors . An independent output for real-time monitoring of temperature is also included . The TBR4100 analyzer utilizes PC-based data acquisition via our Lab-Trax interface;
l Measure nitric oxide from < 0.3 nM to 100M. l Measure hydrogen peroxide < 10 nM to 100mM. l Measure hydrogen sulfide l Measure glucose l Measure oxygen from 0.1% to 100%. l Isolated architecture allows Lab-Trax interface to simultaneously measure free radical and independent analog data (i.e., ECG, BP, etc.) data on any channel.
data traces are displayed and recorded in real-time . The Data-Trax software comes pre-configured for single or multiple electrode recording; filters, gains, and smoothing are all set for optimal results . Data can be viewed making adjustments to smoothing and filter settings without affecting the original stored raw data . Electrode calibration from multiple concentration readings can be input into the software's Multipoint Calibration utility quickly provides a plot and slope calculation for electrode sensitivity determination . Alternately, the Lab-Trax T series data interface can be used for providing simultaneous acquisition of Free Radical data along with other physiological data (ECG, HR, BP, etc .) as each of the four input channels has its own independent input amplifier, filters, and 24-bit converter . (See WPI website for more information on Lab-Trax data acquisition.)
Dont need four channels? Thesingle-channel TBR1025packsthepowerofitsbigbrotherina small,economicalpackage.
68
Multipoint electrode calibration and slope determination can be quickly derived from recorded calibration data. TBR4100 SPEcIFIcaTIONS
Power ......................................................100 ~ 240 VAC, 50-60 Hz, <15 W Operating Temperature (ambient) ........0 - 50C (32 - 122F) Operating Humidity (ambient) ..............15 70% RH non-condensing Warm up Time .......................................<5 minutes Dimensions ............................................135 X 419 X 217 mm (5.25 X 16.5 X 8.16) Weight.....................................................1.35 kg (3 lb) Display Functions ..................................18 mm (0.7) LCD readout, 4.5 digit Polarization Voltage (mV) Current input (nA, A) Controls ..................................................Power (on/off) Current Input Range Polarization Voltage Analog Output Range ............................+/- 10 V (continuous) Analog Output Impedance ....................10 kohm Channel to Channel Isolation ................>10 Gohm Channel to Output Isolation ..................>10 Gohm Power Supply to AC Line Isolation ........>100 Mohm Analog Output Drift ...............................<10 pA/h Temperature Input Number of Channels .....................................1 Sensing Element............................................Platinum RTD, 1000 Ohm Range .........................................................0-100C Accuracy .........................................................+/- 1C Resolution......................................................0.1C TBR4100-416 TBR4100-424T Analog Output ...............................................31.25 mV/C (continuous) amperometric Input Number of Amperometric Channels ..............................4 Signal Bandwidth............................................................0-3 Hz Polarization Voltage (selectable via rotary switch) Nitric Oxide .......................................................865 mV Hydrogen Sulfide ..............................................150 mV Hydrogen Peroxide ...........................................450 mV Glucose ..............................................................600 mV Oxygen ..............................................................700 mV ADJ (user adjustable)........................................+/- 2500 mV Polarization Voltage Accuracy ........................................+/- 5 mV Polarization Voltage Display Resolution .......................+/- 1mV Current measurement Performance Range Analog Output Noise @ 3Hz * Noise @ 0.3 Hz * +/- 10 nA 1 mV / 1 pA < 1 pA < 0.3 pA +/- 100 nA 1 mV / 10pA < 7 pA < 3 pA +/- 1 A 1 mV / 100pA < 70 pA < 30 pA +/- 10 A 1 mV / 1A < 700 pA < 300 pA *Instrument performance is measured as the (max-min) over 20 seconds period with open input. Typical values are given at 3 Hz and 0.3 Hz bandwidth. Typical sensor performance with TBR4100 ISO-NOPF100 noise .......................................................0.2 nM NO (<2 pA)** **Sensor noise is measured as the (max-min) over a 20 seconds period with the sensor immersed in 0.1 M CuCl2 solution.
BIOS EN S I NG
TBR1025
Four-channel Free Radical analyzer with Lab-Trax 4/16 Data acquisition System IncludesTBR4100analyzer&powercord,Lab-Trax-4/16dataacquisitionsystem&USBcable,4BNCcables, 3electrodeadaptercables,1temperatureprobe,2sensorsofyourchoice,andsensorstart-upkit(s),ifapplicable. Four-channel Free Radical analyzer with Lab-Trax 4/24T Data acquisition System IncludesTBR4100analyzer&powercord,Lab-Trax-4/24Tdataacquisitionsystem&USBcable,4BNCcables, 3electrodeadaptercables,1temperatureprobe,2sensorsofyourchoice,andsensorstart-upkit(s),ifapplicable Single-Channel Free Radical Analyzer
REcOMMENDED accESSORIES SNaP50 SNAP S-Nitroso-N-acetyl-D-penicillamine, 50 mg vial See ProGuide Electrode Positioners, page 63.
69
Multi-Port Measurement chamber

Temperature stabilized four-port closed chamber for measurements of nitric oxide, oxygen hydrogen peroxide and other species in cell culture
l Four port (WPI #NOCHM-4) chamber accommodates WPIs 2-mm sensors for nitric oxide (ISO-NOP), oxygen (OXELP), hydrogen peroxide, and WPIs KWIK-TIP ion selective electrodes in combination with WPIs 2 mm Dri-Ref reference electrodes .
BIOS EN S I NG
l Two additional top ports for injection of reagents using WPIs MicroFil syringe needles l Closed chamber design greatly reduces the surface area of the solution exposed to air l One top port and up to three side ports configuration provides adequate space for convenient sample and electrode manipulation l Temperature control through an external circulating bath l The chamber can be used for nitric oxide and other species calibration at temperatures from 4-40 C The measurement of NO and other reactive gases dissolved in solutions will be underestimated in stirred conditions if the solution is allowed to equilibrate with air . In the case of NO, accelerated decomposition occurs as the result of diffusion of NO from the solution into the gas phase and the reaction of NO with oxygen . This reaction with oxygen makes a significant and variable contribution to NO decomposition, and hence accuracy of measurement, at concentrations of NO between 0 .1-5 M . These problems can now be eliminated with the use of WPIs two-port NOCHM or four-port NOCHM-4 closed chambers . The chambers consist of a close fitting cap through which a NO probe (ISO-NOP) or other electrode can be inserted . When the probe is in place and the cap is fitted to the chamber the surface area of the solution exposed to air is greatly reduced . Up to three optional side ports are also provided through which an oxygen electrode* (e.g., OXELP), WPIs hydrogen peroxide, or KWIKTIP ion selective electrodes in combination with WPIs 2 mm Dri-Ref reference electrodes can be inserted . The multi-port measurement chambers can be conveniently temperaturecontrolled by circulating water through the outer sleeve of the chamber using an appropriate heating/cooling circulator bath . The inner volume of the chamber (and hence sample volume) can be continuously adjusted in volume from 1 .0 mL to 3 .0 mL and is suitable for most cell suspension experiments .
MuLTI-PORT MEaSuREMENT cHaMBERS

VOLUME OF SAMPLE SAMPLE INJECTION PORTS NUMBER OF ELECTRODE PORTS ELECTRODE COMPATIBILITY Nitric Oxide Electrode Oxygen Electrode* Hydrogen Peroxide Electrode Calcium Electrode Hydrogen Electrode Potassium Electrode TPP (tetraphenylphosphonium) Electrode Dri-Ref Electrode SUPER-Dri-Ref Electrode TEMPERATURE RANGE OF CIRCULATING WATER 1-3 mL 2 (top) 4 ISO-NOP OXELP* ISO-HPO-2 KWIKCAL-2 KWIKH-2 KWIKPOT -2 KWIKTPP-2 DRIREF-2 SDR2 4-40 C
REFERENcE
P. S. Brookes, E. P. Salinas, K. Darley-Usmar, J. Eiserich, B. A. Freeman, V. M. Darley-Usmar, P. G. Anderson. Concentration dependent effects of nitric oxide on mitochondrial permeability transition and cytochrome c release . J.Biol.Chem. 275, 20474-9 (2000) .
Waterinletandoutletrequire1/4-in.IDtubing *Caution:Notrecommendedforlowoxygenconcentration (<1%)measurements.
NOcHM-4 Four-Port Closed Chamber for use with WPIs 2 .0 mm electrodes (e.g., ISO-NOP and OXELP, etc .) NOcHM-P Spare Plug-adapter for ISO-NOP nitric oxide electrode 800100-5 Spare Center Chamber Gasket (package of 5)
70
S-nitrosoglutathione
GSNO has been identified invivo as a potential storage and transport vehicle for NO in the body . GSNO has been used in clinical trials to treat a form of preeclampsia and to prevent platelet aggregation . It also has considerable potential as NO donor in medicine .
GSNO
O SNO H N O
S-Nitroso-N-acetyl-D-penicillamine
SNAP is a stable green crystalline S-nitrosothiol compound that mimics the action of nitric oxide invivo . It has vasodilatory properties and has been shown to relax isolated bovine coronary artery rings by activating soluble granulate cyclase . This reagent also actuates apoptosis in mouse thymocytes and has been accounted for reversible inactivation of protein Kinase C . SNAP can be used for calibration of all WPI NO H3C CH3 O sensors . Call for details . M .W . 220 .2 Purity > 98% by NMR or TLC
N S NHAc COOH
HO2C NH2
N H
CO2H
M .W .336 .3 C10H16N4O7S Purity > 98% Soluble in water or DMSO Storage: -20C
REFERENcES
REFERENcES
A. R. Butler, Anal.Biochem. 249:1-9(1997) . D. Nikitovic, J.Biol.Chem. 271(32), 19180-19185(1996) . D. R. Noble, NitricOxide 4:392-398 (2000) . D. L. H. Williams, Acc.Chem.Res. 32:869-876 (1999) .
S. C. Askew, etal. Bioorg.Med.Chem.3, 1 (1995) . K. Fehsel, etal. J.Immunol.155, 2858 (1995) . R. Gopalakrishna, etal. J.Biol.Chem.268, 27180 (1993) . E. Southam, J. Garthwaite, Neurosci.Lett.130, 107 (1991) . P. J. Henry, etal. J.Pharmacol.Exp.Therap.248, 762 (1989) .
BIOS EN S I NG
GSNO-50 GSNO 50 mg vial GSNO-100 GSNO 100 mg vial
SNaP25 SNaP50 SNaP100
SNAP, 25 mg vial SNAP, 50 mg vial SNAP, 100 mg vial
Pre-polarizer
Keep extra NO sensors ready to use
ISO-NOP Rejuvenator
Achieve a stable background current quickly . This small battery-powered device applies a potential to the NO electrode equivalent to the potential applied by the ISO-NO meter . Consequently, a sensor which has been connected to the activator may be transferred to the meter for immediate use . For use with all WPI NO electrodes.
NSa-3
ISO-NO Activator (for three sensors)
After an ISO-NOP 2-mm sensor is used for long periods, sensitivity may become reduced and response time may increase . This little device can restore ISO-NOP performance to original levels by applying an electric waveform for a few seconds . 9v alkaline battery included .
JuV
ISO-NOP Rejuvenator
71

Records redox currents with carbon fiber microelectrodes
Advanced Neurotransmitter Detection

Measures oxidizable compounds such as catecholamines (epinephrine, norepinephrine, dopamine), indolamines (serotonin, melatonin), ascorbic acid and Fe (II) with exquisite sensitivity, low noise and site specificity
BIOS EN S I NG
Use with WPI electrodes see next page

MicroC, WPIs low cost and elegant instrument for electrochemical detection using carbon microelectrodes, will record the presence and concentration of oxidizable biological compounds invivoand invitro. It also features inherently low noise and a sensitivity of 1 millivolt per picoampere of oxidation current . Response time to quantal catecholamine release is less than 1 millisecond . When used with carbon fiber microelectrodes, redox current can be recorded over a range of 1-picoampere to 2
microamperes . The built-in carbon electrode activation feature allows the easy renewal of electrode sensitivity . In addition, MicroC features a low-pass filter and the option of applying DC potential externally . A wide range of compounds can be detected: dopamine, epinephrine, norepinephrine, serotonin, ascorbic acid, etc . Other compounds, such as glutamate, glucose, acetylcholine and alcohol, can also be detected with MicroC using enzyme-modified biosensors .
See Application Notes, Carbon Fiber Microelectrodes, available as a PDF file which may be downloaded from WPIs web site .
The MicroC Potentiostat is supplied with a carbon electrode probe, with 5 feet triax cable, which accepts 0 .79 mm connector pin, and a reference electrode with a 4 mm Ag/AgCl half cell (seepage21) . For applications where smaller half cells are needed, please call WPI for more information .
References
G. A. Gerhardt, Nafion-coated electrodes with high selectivity for CNS electrochemistry BrainRe earch,290: 390-395 (1984) . s R. M. Wightman, etal., Temporally resolved catecholamine spikes correspond to single vesicle release from individual chromaffin cells . Pro.NatlAcad.ofSci. 88: 10754-58, (1991) . Z. Zhou and S. Misler, Action Potential-induced Quantal Secretion of Catecholamines from Rat Adrenal Chromaffin Cells, J.Biol.Chem.270; 3498-3505, (1995) .
MIcROc SPEcIFIcaTIONS
METHOD APPLIED POTENTIAL CURRENT RANGES BANDWIDTH NOISE DISPLAY RECORDER OUTPUT RISE TIME POWER BATTERY LIFE SHIPPING WEIGHT 2 electrode, DC potentiostat 0 .65 V, variable 2 .5 V 2000 pA, 20 nA, 200 nA, 2 A 1 .67 Hz, 167-1000 Hz < 1 pA 312-digit LCD display, 2 V 4 .5 volts < 1 millisecond Six 1 .5 volt alkaline batteries (included) > 1000 hours, est . 4 lb (1 .8 kg)
ELECTRODE PROBE/CABLE LENGTH Triax shielded, 5 feet
SYS-MIcROc Potentiostat MIcROcP Replacement Probe for MicroC OPTIONaL accESSORIES 300305 ATP Adapter (0 .031" pin to 1 mm socket)
72
carbon Fiber Microelectrodes

l Sensitive, renewable/durable and economical carbon fiber electrodes for electrochemical detection of oxidizable compounds
Carbon fiber microelectrodes have been used in both the detection of oxidizable compounds (Gonon, etal., 1978; Cahill and Wightman, 1995) and extracellular single-unit recording (Armstrong-James and Millar, 1979) . WPIs ultra-sensitive and low-noise carbon fiber (cF) electrodes can be applied, with our Micro-C Potentiostat or similar instruments, in the electrochemical detection of catecholamines (epinephrine, norepinephrine and dopamine), indolamines (serotonin, 5-HT or melatonin), ascorbic acid, Fe (II), and other oxidizable compounds . CF electrodes (diameter of 10 or 30 m) respond with an excellent linearity to the oxidizable compounds (Fig . 1) and can detect the compounds as low as 0 .2 nM . While the shorter (25-100 m) CF electrodes are suitable for invivoamperometric and voltammetric measurements, the longer CF electrodes provide higher sensitivity and are especially useful for the invitrostudies (amperometric or differential pulse voltammetry) . When used with the Micro-C Potentiostat, these CF electrodes can be activated and renewed in sensitivity for multiple use . The selective detection of catecholamines can be achieved with our Nafion-coated CF electrodes . For selective detection of 5-HT and ascorbic acid, please contact WPI for more information .
50
Potential (V)
0 -50 -100 0 5 10
Time (ms)
Fig. 2 Extracellular recording using a carbon electrode in CA1 region of the hippocampus in an anesthetized rat shows ultrat s low noise (-<5 V-). Cour e y:Dr.CarolynHarleyofMemorialUniversity, Newfoundland,Canada.
BIOS EN S I NG
References
P. S. Cahill, R. M. Whightman, Anal.Chem., 67, 2599-2605 (1995) . F. Gonon, etal., Hebd Seances Acad . Sci . Ser . 286, 1203 (1978) . M. Armstrong-James, J. Millar, J.Neurosci.Methods,1, 279 (1979) . caRBON FIBER MIcROELEcTRODES, uNcOaTED Diameter Length cF10-100 10 m 100 m cF10-250 10 m 250 m cF30-50 * 30 m 50 m cF30-100 30 m 100 m
Dopamine Concentration/Response Curve

1000000 100000
(pack of 5)
Current Output (pA)
10000 1000 100 10 1 0.1
10
100
1000
10000
100000
1000000
Concentration (ng/ml)
Fig. 1 Excellent linearity in the response of carbon fiber electrode (CF30-500) to dopamine recorded on Micro-C. Courtesy:Drs. D.YeomansandX.-T.Wang,Uni er i yofIllinoisatChicago. v st
caRBON FIBER MIcROELEcTRODES, NaFION-cOaTED Diameter Length (pack of 5) cFN10-50 * 10 m 50 m cFN10-100 10 m 100 m cFN10-250 * 10 m 250 m cFN30-50 * 30 m 50 m cFN30-100 * 30 m 100 m cFN30-250 * 30 m 250 m * Built to order allow up to 4 weeks manufacturing time.
1 mm O.D. glass pipette or 2 mm plastic tube Gold-plated connector pin 0.031 in. (0.79 mm)
glass insulation 30 or 10 carbon fiber
Carbon fiber microelectrodes, approximately 25-50 mm (1-2 in. ) long, feature a gold-plated pin for connection to the probe.
cement
25-1000 m
73
OxyMini & OxyMicro

A new generation of fiber optic oxygen sensors based on luminescence lifetime
The OxyMini system is optimized for process control and biotechnology applications . The OxyMicro is designed for biological research applications including implanting into tissues, cell cultures, profiling of biofilms and sediment related bioassays . The measurement principle of the sensor system is based on the detection of oxygen concentration as a function of luminescence lifetime either in dissolved or gaseous phase environments .
MicroFlow
The MicroFlow fiber optic oxygen sensor (WPI #501657) is a miniaturized fiber optic chemical sensor optimized for fast response time (t90 < 1 sec in gases, < 5 sec in liquids) . The tiny probe has a tip size of 50 m and is integrated in a T-shape flow cell for easy connection via Luer-Lock adapters to external tubings . Liquids (like water, blood, etc .) can be pumped through the cell .
MicroImplant
The MicroImplant fiber optic oxygen sensor (WPI #501658) is an implantable probe (IMP) with a tiny probe tip size 50 m, an exposed fiber length of 5-mm and a jacket diameter of 900 m . The IMP sensor was successfully implanted in crabs, fishes and soil .
OxyMini systems
The OxyMini is a single-channel fiber optic oxygen meter for WPIs fiber optic oxygen minisensors . These sensors are based on 2 mm polymer optical fibers and have a length of 2 .5 m . A wide range of applications is possible with these sensors . l Process control: bottling plant in breweries and quality control of packages l Biotechnology: Control of cell culture media and non-invasive control of bioreactors l Implantation of oxygen sensors into soil and trees .
OxyMini and OxyMicro Benefits

l l l l l l l l Oxygen is not consumed during the experiment Immune to electrical and magnetic interference Excellent long-term stability No lengthy polarization necessary (e.g., as Clark-type oxygen electrodes require) Fast response time < 0 .5 s for MicroTip sensors Probe size of MicroTip sensors as small as 50 m Measurement is feasible in dry gas Optical isolation of sensor tip available for fluorescent or photosynthetically active samples
MiniTip
This oxygen dipping probe (WPI #501641) has a tip diameter of 4 mm and consists of a polymer optical fiber, with an oxygen sensitive coating . The MiniTips range is 0 to 100% . This robust sensor has a response time (t90) of approximately 40 s .
Measurement Principle
BIOS EN S I NG
MiniFlow
The MiniFlow oxygen probe (WPI #501642) is a miniaturized fiber optic chemical sensor integrated in a T-shape flow through cell . The standard T-shape flow cell can be easily connected via Luer-Lock adapters to external tubings . Liquids (e.g., water, blood, etc .) can be pumped through the cell . The sensor has a response time (t90) of approximately 40-s and an excellent long-term stability .
Conventional fiber-optic oxygen sensor systems based on intensity measurements are limited in their accuracy by light source stability and ambient light fluctuations . Using a luminescence lifetime detection, measurements are not affected by light source stability, intensity fluctuations caused by fiber bending or changes of the optical properties of the sample (turbidity, refractive index, coloration, etc .) . These advantages make WPIs OxyMini and OxyMicro the most advanced and reliable fiberoptic oxygen system available . calibration: The sensors can be calibrated by a simple two point calibration, 100% air-saturation and 0% air saturation . OxyMini and OxyMicro oxygen meters: The OxiMini and OxyMicro fiber optic oxygen meters are compact, easy to transport . The instruments are designed for in/outdoor use and can be connected to a PC via a RS232 interface . Data can be visualized, analyzed and stored with the supplied software . A full range of sensors covering most biomedical applications are available .
MiniFoil
WPI offers the sensor material on a 1 cm2 support disk made of polyester . This material can be glued, for example, inside glass vials and the oxygen concentration can be measured non-invasively and non-destructively from outside through the wall of the flask . A plastic fiber optic cable (WPI #501644, WPI #501645) is used to illuminate the sensor foil . The wall of the flask must be transparent/non-fluorescent . Response time (t90) of approximately 50 s . The material can be implanted into animal tissues or custommade housings .
OxyMicro systems
The OxyMicro is a single channel fiber optic oxygen meter for WPIs fiber optic oxygen microsensors . Applications include: l Oxygen profiles of marine sediment, soils, or tissue l Implantation into living tissue (e.g., heart or muscle tissue) l Control of cell culture media in Biotechnology .
MicroTip
The MicroTip (WPI #501656) is a needletype (27 ga .) oxygen micro sensor designed for applications where a small tip size of 50 m and a fast response time (t90) of 1 s are necessary . The oxygen sensitive sensor tip consists of 140 m fiber tapered to a 50 m tip . The sensor is housed inside a stainless steel needle of 22 mm length and 0 .4 mm diameter . This allows penetration through a septum rubber or similar material . These sensors are ideal for oxygen profiling in sediments and biofilms .
MINISENSOR SYSTEM OXY-MINI-AOT Fiber-optic Oxygen Meter for Minisensors * MINISENSORS (not interchangeable with Microsensors) 501641 MiniTip, fiber-optic oxygen sensor 501642 MiniFlow, flow-through cell with integrated planar oxygen sensor 503090 MiniSpot, planar oxygen-sensitive spot, 5 mm diam. (includes 10) Requires #501644 501644 Polymer optical fiber with 1 SMA connector MICROSENSOR SYSTEM OXY-MICRO-AOT Fiber-optic Oxygen Meter for Microsensors * MICROSENSORS (not interchangeable with Minisensors) 501656 MicroTip, needle-type housing fiber-optic oxygen sensor 501657 MicroFlow, flow-through housed oxygen microsensor 501658 MicroImplant, implantable oxygen microsensors *Metercontainstwoanalogoutputsandonetriggerinput
MiniTip
Measurement Range dissolved/gaseous Response Time [t90] dissolved/gaseous Sterilization (EtOH, H2O2) autoclavable (130C, 1 .5 atm) Drift (100,000 datapoints, 20C) Accuracy (20C) Resolution (20C) Temperature Range Probe Assembly Length
0-45 ppm, 0-100% 0-760 mmHg 40 s 10 s Y N < 0 .1%
MiniFlow
0-45 ppm, 0-100% 0-760 mmHg 40 s 10 s Y Y < 0 .1%
MiniSpot
0-45 ppm, 0-100% 0-760 mmHg 40 s 10 s Y Y < 0 .1% 0 .2%
MicroTip
0-45 ppm, 0-100% 0-760 mmHg <2s < 0 .5 s Y N < 0 .3%
MicroFlow
0-45 ppm, 0-100% 0-760 mmHg <2s < 0 .5 s Y Y < 0 .3%
MicroImplant
0-45 ppm, 0-100% 0-760 mmHg <2s < 0 .5 s Y Y < 0 .3%
2 .75 0 .01 ppm, 9 .00 0 .05 ppm, 220 0 .15 ppm, 45 .0 0 .25 mmHg, 150 0 .75 mmHg, 375 2 .6 mmHg -10C to 50C 2 .5 m
74
New Oxygen Sensor

Fluorescence-based optical sensor system
l Fluorescence-sensing detector for optical sensors, a viable alternative to traditional chemical sensing devices l Self-contained, benchtop systeminvariant to fiber bending or stray light l AffordableHalf the cost of comparable phase measurement systems l Excellent stability, extremely low drift and phase noise l Simple calibration, setup and control The new oxygen sensing system measures fluorescence lifetime, phase and intensity, using LED excitation and photodiode detection with filterbased wavelength selection . The system is simple to set-up and control . The compact, self-contained unit makes it invariant to fiber bending and stray light . It also has a wide dynamic range of optical intensity, as well as low optical and electronic crosstalk, and low drift and phase noise . When stability and sensitivity to drift are important in your oxygen sensing experiment, this unit is ideal . It is perfect for applications where sample set-ups must be left undisturbed for long periods of time .
Three coatings available for probes and patches

The optical sensors consist of transducer materials, applied to the tips of optical fibers or to substrates such as patches or cuvettes, which change optical properties in response to specific analytes in their immediate environment .
OXYThe standard oxygen sensor designed for monitoring oxygen partial pressure in gas and aqueous solutions is a fiber optic fluorescence probe with a proprietary oxygen sensing coated tip . HIOXYDesigned for monitoring oxygen partial pressure in nonaqueous vapors and solutions . The sensor coating chemistry is compatible with oils, alcohols, and hydrocarbon-based vapors and liquids .
FOSPORA new generation of highly sensitive sensor coating can be used for monitoring traces of oxygen in gas and liquids .
The oxygen sensor probes are low-power and offer high sensitivity, reversibility and stability, ideal for remote monitoring . The thin coating on the probe tips consumes no oxygen, allowing for continuous contact with the sample . They are ideal for viscous samples and are immune to interference caused by pH, ionic strength or salinity fluctuations or biofouling . INTRODucTORY PRIcE FLOX-PaTcH Non-Invasive Oxygen Monitoring Kit, including phase measurement system, temperature probe, 4mm HIOXY sensor patches FLOX-PROBE In Situ Oxygen Monitoring Kit, including phase measurement system, temperature probe, and HIOXY O2 sensor
BIOS EN S I NG
FLOX SPEcIFIcaTIONS
Probe Specifications
O2% range (at 1 ATM) DO range (ppm at 1 ATM) Temperature range 0-60 C for patches O2% resolution DO resolution (at room temp) O2% accuracy DO accuracy Min. detectable level in gas Response time (in gas) (with overcoating in gas) (in pure water)
OXY Formulation (general-purpose coating)

0-100% 0-40 ppm -50-+80C for probes 0-60C for patches 100 ppm in gas 4 ppb <5% of reading <5% of reading 0.01% - 0.05% < 1 second 45-60 seconds 30-45 seconds
FOSPOR Formulation (high-sensitivity for low levels of O2)

0-<10% 0-4 ppm 0-+60C for probes NA 10 ppm in gas 0.4 ppb <5% of reading <5% of reading 0.001% - 0.01% < 30-60 second 60-90 seconds 60-90 seconds
HIOXY Formulation (for hydrocarbon environments)

0-20.9% 0-8 ppm -50-+60C 100 ppm 4 ppb <5% of reading <5% of reading 0.01% - 0.05% < 1 second ~45 seconds
Patch Specifications
02% range (at 1 ATM) DO range (ppm at 1 ATM) Temperature range 02% resolution (20 sec averaging) (at 30 sec averaging) DO resolution (at room temp) 02% accuracy DO accuracy Min. detectable level (at 30 sec averaging) Minimum detectable level in water (room temperature) Response time (in gas) (with overcoating in gas) (in pure water)
OXY Formulation
0-100% 0-40 ppm -20 to +60 C for patches 0.05% 0.05% 20 ppb 5% of reading 5% of reading 0.1% O2 0.1% O2 40 ppb <1 second ~30-45 seconds ~45 seconds
FOSPOR Formulation
0-10% 0-4 ppm 0 to +60 C for patches 0.01% 4 ppb 5% of reading 5% of reading 0.01% O2 4 ppb 30-60 seconds ~60-90 seconds ~60-90seconds
HIOXY Formulation
0-20% 0-8 ppm -20 to +60 C for patches
20 ppb 5% of reading 5% of reading
40 ppb <1 second ~30-45 seconds
Stability (Continuous LED)

Lifetime Stability (Tau) Oxygen Stability %
OXY Formulation
0.0006 usec/ HR 0.01% HR
FOSPOR Formulation
0.003 usec/ HR 0.005% HR
HIOXY Formulation
0.0002 usec/HR 0.007% HR
Sterilization Guide
Form factor Autoclavable Calibration Gamma
OXY Formulation
Probes/Patches No Yes
FOSPOR Formulation
Probes/Patches Not yet determined Not yet determined
HIOXY Formulation
Probes Yes Single point reset required after sterilization Yes
75
Dissolved oxygen meter & oxygen electrode

Electrically isolated, the electrode can function in recording situations where ground-referred electrodes would fail
l Measures gas and dissolved oxygen l Low O2 consumption l 2 mm tip
Isolation prevents adverse interaction with other electrodes and instruments . Highly accurate and stable ISO2 measures oxygen concentrations in aqueous solutions and in gas mixtures . Measurement modes are percent oxygen, parts per million, and oxygen reduction current in nanoamperes . The lower detection limit (DL) for ISO2 (in gaseous or in liquid phase) is 0 .1 ppm or 0 .1% . Oxygen concentration around 0 .5 ppm or 0 .5% and up can be routinely measured in the gaseous or in the liquid phases . DL for a particular sensor tends to be different in gaseous and liquid phases when the baseline noise level is also different . In the case of ISO2, however, the baseline noise level is very close whether the electrode is immersed in solution or used in the gaseous phase, so DL for the ISO2 remains relatively close in either phase . The small tip size (2 mm diameter) and low oxygen consumption of the OXELP electrode make it ideal for measurements invivo or invitro . With a T-Adapter (#5399), the sensor probe can be used also for continuous-flow monitoring of oxygen in small fluid volumes . OXELP also features a fast response time, typically 10 seconds . Optional BNC-to-double banana adaptor (#13347) and BNC cable (#500184) allow ISO2 to be connected directly to your chart recorder . SYS-ISO2 Dissolved Oxygen Meter & Electrode OXELP Replacement Oxygen Electrode for ISO2 5378 Replacement Electrode Sleeve Kit (pkg of 4) Foursleeveswithmembranes,plus10mLrefillsolution. ISO2 Filling Solution (10 mL) 7326 5377 Replacement ISO2 Start-up Kit IncludesCalibrationBottle,10mLRefillSolution,1ccSyringe,2 ReplacementMembranesSleeves,MicroFil(28ga.) 5399 T-Adapter Flow-Through Kit Includes3femaleluerTs,3luerlockfittings,32mmgaskets,6 maleluerto1/8-in.tubing,3luerlockfittings 13347 Chart Recorder Adapter (requires BNC cable) 500184 BNC Cable
BIOS EN S I NG
ISO2 SPEcIFIcaTIONS
MEASUREMENT MODES % O2: ppm: Current: RESOLUTION ACCURACY 1 .5% RECORDER OUTPUT DISPLAY POWER BATTERY LIFE DIMENSIONS SHIPPING WEIGHT 0-100% 0-20 0-200 nA 0 .1 ppm 1000 resistance for chart recorders 3 .5-digit LCD 2 nine-volt alkaline batteries, supplied 1000 hours, estimated 8 x 4 x 2 inches (20 x 10 x 5 cm) 5 lb (2 .3 kg)
OXELP OXYGEN ELEcTRODE

TIP DIAMETER STAINLESS STEEL SLEEVE OVERALL LENGTH CABLE LENGTH RESPONSE TIME 2 mm 66 mm 125 mm 122 cm (4 feet), including BNC connector 10 seconds, 90% response typical in well-stirred solution
Also see WPIs temperature stabilzed chamber, page 70.
76
pHOptica
A novel fiber optic pH system
pHOptica is a pH measuring system which uses fiber optic sensors and patented DLR technology . This method allows referenced measurements with single excitation to be implemented . Features of pHOptica Meter
l Single-channel, compact, easy to transport fiber-optic meter for pH measurements with miniature sensors . l Two 12-bit, programmable analog outputs, with electrical isolation . l One external trigger input, with electrical isolation . l Computer with RS232 interface required for operation . l User-friendly software saves and visualizes measured values . l Several pHOptica meters can be connected to one computer . l Temperature variation is recorded using a temperature sensor .
Features of pH optical sensors

l No reference electrode is needed l Immune to electrical interferences and magnetic fields l Low drift l High spatial resolution due to small tip size l Measurement in very small sample volumes l Additional optical isolation of the sensor tip is available for measurements in colored or photosynthetically active samples .
BIOS EN S I NG
pHOptica Micro system

The pH Optica micro system is a single channel pH system for use with fiber optic micro sensors . The applications include: l Penetration or implantation into living tissue (heart, muscle or animal blood vessels) . l Soil implantation for pH measurement . l Implantation into customer-made housing . To protect the small glass fiber tip against breaking, suitable housings and tubings around it, depending on the respective application, were designed .
pHOptica Mini system

The pH Optica mini system is a single channel pH system for use with fiber optic mini sensors, foil and spot surface sensors . The applications include: l Non-invasive and non-distractive pH measurements from outside through flask walls (cell culture) l Online pH monitoring by flow through cells l Dipping probe pH measurements
pH mini sensors
l OD of the dipping sensor is 4 mm . l Sterilization of the pH sensor spots via gamma radiation . l The pH mini sensor meter is based on 2 mm PMMA waveguides . l Drift of 0 .1 pH units for 10,000 measurements (4 days measurement in the 30 sec data update mode) . Two different housings and sensor spots (sensorfoils) are offered:
Needle-Type Housing Sensor the glass-fiber with its pH-sensitive tip is protected inside a stainless steel needle (18 ga .); fiber has to be extended during measurement; penetration through septum .
Implantable sensor without any housings implantation into animal blood circuits; soil implantation; implantation in customer-made housings
POF Coated with a pHSensitive FoilSmall and robust pH dipping sensor; no reference electrode needed .
pH micro sensors
l Tip size 140 micrometer . l Drift of 0 .1 pH units for 2000 measurements (16 hours measurement in the 30 sec data update mode) .
Flow-Through Cell with Integrated pH SensorOn-line monitoring; can be easily connected via Luer-Lock adapters .
Planar pH Sensitive Foils and spotsnon-invasive and non-destructive measurement from outside through the wall of the flask; online monitoring .
PHOPTICA SPEcIFIcaTIONS
DATA INTERFACE SAMPLE RATE MEASURING pH RANGE RESOLUTION (at 20 C) RESPONSE TIME DIMENSIONS WEIGHT POWER SUPPLY RS232 1 sample per second 5-9 0 .03 (microsensors); 0 .01 (minisensors) < 1 min 185 x 110 x 45 mm 630 g 100 - 220 V AC
MINISENSOR SYSTEM (cannot be used with microsensors) PH-OPTIca-MINI Fiber Optic pH Meter for minisensors, foils and spots 503538* pH MiniTip, fiber optic pH sensor dipping probe, disposable (4 mm OD), pkg of 3 502120* pH MiniFlow, fiber optic pH flow sensor, pkg of 3 *Requires#503110 502122** pH MiniSpot, fiber optic pH spot sensors, pkg of 10, OD 5 mm **Requires#501644 501644 Polymer Optical Fiber with 1 SMA connector 503110 Fiber Optic Cable with 1 SMA connector MIcROSENSOR SYSTEM (cannot be used with minisensors) PH-OPTIca-MIcRO Fiber optic pH meter for microsensors 502123 pH MicroTip (needle-type), fiber optic pH sensors (140 m OD), pkg of 3 502124 pH MicroImplant, fiber optic pH implantable sensor (140 m OD), pkg of 3 77
Beetrode
BEE-caL ZBEEcaL
Micro pH Electrodes
with 100-micron sensing tips!
l NEWIMPROVEDsuper-miniature, superfast coated wire pH electrodes l 100-micron diameter ideal for monitoring fast pH changes in very small places
3508 1358
NMPH2B
NM PH2
NMPH3
NM
NMP
BEETRODE SPEcIFIcaTIONS
TIP DIAMETER TIP LENGTH BODY DIAMETER (NMPH 1, 3, 3L, 5) BODY LENGTH (NMPH 1, 3, 5) BODY LENGTH (NMPH 3L) RESPONSE TIME pH RANGE SLOPE RESISTANCE SELECTIVITY 100 (0 .1 mm) 2 mm (approx .), except 5 mm (approx .) on NMPH5 0 .187 in . (5 mm) 1 .875 in . (48 mm) 0 .75 in . (19 mm) 1 s (90%) typical 0-14 Nernstian 100 k (max) No significant interference by K+, Na+, Ca++ in 0 .1 to 1 M solutions
PH
BIOS EN S I NG
PH
3L
H5
NM
Beetrode is a solid state pH sensor with ideal characteristics over a wide pH range . Exhibits a larger Eo than conventional glass electrodes . Requires a separate reference electrode, such as WPIs Dri-Ref Series. Beetrodes (except the NMPH2) connect to your pH meter via a BNCterminated cable . Beetrodes generate mV readings on standard pH meters . To obtain pH-scale readings on standard pH meters, use BEE-CAL, a small, battery-operated compensator (AA battery included) that adjusts the electrode offset potential so that Beetrodes will produce standard pH-scale readings . (NMPH2B requires ZBEECAL .)
pH-Silver
NMPH1* Beetrode2 mm receptacle NMPH2 Beetrode with 1 m cable (unterminated) NMPH2B Beetrode w/ BNC cable, 1 m cable NMPH3* Dental Beetrode, 45 Bend, 2 mm receptacle NMPH3L* Dental Beetrode w/ 2 mm loop, 2 mm receptacle NMPH5* Beetrode, 2 mm receptacle SYS-BEEcaL Beetrode Offset & Cable (BNC, 2 mm pin) ZBEEcaL Level Shifting Device 3508 BNC-to-US Standard Adapter 1358 BNC-to-2 mm Pin Adapter JE671P pH Meter, pH Electrode, Temp. Probe 110v AC adapter JE671PZ pH Meter, pH Electrode, Temp. Probe 220v AC adapter *Requires BEE-CAL or 1358 BNC-to-2 mm Pin Cable (4-ft) for connection to a pH meter.
Low-noise combination pH electrode

WPIs pH-Silver, single/double-junction, gel-sealed Ag/AgCl combination pH electrodes are very low noise . They are designed for both laboratory and field use, especially for applications involving strong magnetic fields . The unique features of these electrodes provide unparalleled performance .
l Special internal fill offers full range linear temperature compensation l Very low sensor glass membrane resistance l Zero and Isopotential: ~pH 7 l Compatible with almost all pH meters
PH-SILVER JE671P JE671PZ Combination pH Electrode, Low Noise pH Meter, pH Electrode, Temp. Probe 110v AC adapter pH Meter, pH Electrode, Temp. Probe 220v AC adapter
l Superior stability l Fast response l Minimum sodium (alkaline) error l pH 0 -14 full range measurement
PH-SILVER SPEcIFIcaTIONS
BULB SHAPE BODY MATERIAL / COLOR TYPE OF REFERENCE SEALED/REFILLABLE pH RANGE JUNCTION MATERIAL JUNCTION TYPE MAX . TEMPERATURE DIMENSIONS CABLE LENGTH CONNECTOR Ball Epoxy / Blue Ag/AgCl Gel-Sealed 0-14 Ceramic wick Single 80 C 12 x 115 mm 1 .0 m BNC
78
Dri-Ref Reference Electrodes

R DRI EF450
Although the internal filling solution contains KCI, the low fluid leakage means Dri-Ref may be used in combination with ion selective electrodes, including those for K+ and Cl-, without significant contamination from the reference electrode . The Dri-Ref electrodes are chemically resistant to strong acids and alkalines . Dri-Ref electrodes are not suitable for use in organic solvents . In addition, the long, thin FLEXREF may be easily manipulated to accommodate a difficult experimental setup .
DRI
-5 REF
EF-2
DRI R
FL
SUPER-Dri-Ref
With a diameter of 2-mm, SUPER-Dri-Ref doesnotleakelectrolyteatall. Exhibiting the electrical stability of a classic flowing junction reference cell, this electrode exhibits low resistance and a stable half-cell potential essentially independent of sample electrolyte concentration . SUPER-Dri-Ref is ideal for small volume and low salt concentration measurements .
EF EXR
R2 f, S D i-Re Dr EREF-L SuP DRI R
Micro-Reference Electrode
H
Only 450 m in diameter and 1 inch long, WPIs new DRIREF-450 reference electrode can be used along with other sensors in space-restricted areas and very small sample volumes .
RE DRI
IR DR
F-5S
Luer-Tip Reference
2S H
The male luer fitting at the front of the DRIREF-L allows it to be easily connected to a female luer port (see WPIs luer fittings kit, page 138) to form a tight seal a very convenient installation for a flow-through system .
BIOS EN S I NG
EF-
Dri-Ref reference electrodes were developed by WPI to have extremely low electrolyte leakage properties, hence the name Dri-Ref . In addition to this key feature, these electrodes exhibit stable and reproducible potential and low resistance . Stored in KCl when not in use, they have a long life expectancy .
FLEXREF DRIREF-2 DRIREF-2SH DRIREF-5 DRIREF-5SH SDR2 DRIREF-450 DRIREF-L
Flexible Dri-Ref, 1 .5 mm diam . Dri-Ref, 2 mm diam . Dri-Ref, 2 mm diam . (Short) Dri-Ref, 4 .7 mm diam . Dri-Ref, 4 .7 mm diam . (Short) SUPER-Dri-Ref, 2 mm diam . Micro-Dri-Ref, 450 m diam . Reference Electrode with Luer Tip
LENGTH DIAMETER CONSTRUCTION LEAD LENGTH CONNECTOR RESISTANCE (typical) FILLING SOLUTION ELECTROLYTE LEAKAGE (mL/hr)
DRIREF-450 2 .54 cm 450 m Coated Glass 30 in . (76 cm) 2 mm pin <5K KCl
DRIREF-5 9 cm 4 .7 mm Epoxy 30 in . (76 cm) 2 mm pin ~500 KCl ~7 .410-7
DRI-REF SPEcIFIcaTIONS
DRIREF-2 13 cm 2 mm Isoplast 30 in . (76 cm) 2 mm pin ~2 .7 K KCl ~5 .710-8 FLEXREF 13 cm 1 .5 mm Teflon 30 in . (76 cm) 2 mm pin ~2 .7 K KCl ~5 .710-8
SDR2 9 cm 2 mm PVC 30 in . (76 cm) 2 mm pin < 5 K KCl
DRIREF-L 7 .5 cm Standard Luer Polypropylene 30 in . (76 cm) 2 mm pin ~500 KCl ~7 .410-7
DRIREF-5SH 3 .5 cm 4 .7 mm Epoxy 30 in . (76 cm) 2 mm pin ~500 KCl ~7 .410-7
DRIREF-2SH 2 cm 2 mm Isoplast 30 in . (76 cm) 2 mm pin ~2 .7 K KCl ~5 .710-8
IsoplastisatrademarkofDowChemical.TeflonisatrademarkofDuPont.
calcium calibration Solutions

caLBuF-1
For use with calcium electrodes
A set of eight calcium buffers covering the range of concentration from 10-1 to 10-8 M Ca++ . Each buffer contains 20 mL of solution and enough potassium chloride to set the ionic strength to 0 .1 M . Limited shelf life; use within 30 days . Concentration: 1x10-1, 1x10-2, 1x10-3, 1x10-4, 1x10-5, 1x10-6, 1x10-7, 1x10-8 M at 20C . Limited shelf life; use within 30 days . caLBuF-1 Kit of 8 Calcium Buffer Solutions
caLBuF-2
For use with calcium fluorescent indicators
CALBUF-2 is especially suitable for calibrating fluorescent Ca++ indicators . It provides eleven buffer standards in the 10-4 to 10-8 M Ca++ range, whereas other commonly used fluorescent Ca++ indicators have the apparent Kd in the range of 100 to 300 nM . As with any ionic sensitive indicator, the sensitivity range of these indicators is about 1 .0 log unit above and below the Kd . CALBUF-2 provides seven calibration points in this sensitivity range . It has an osmolarity of 0 .305, which is isotonic with most mammalian cells . Concentration: 1x10-8, 4x10-8, 1x10-7, 2 .5x10-7, 5x10-7, 7 .5x10-7, 1x10-6, 4x10-6, 1x10-5, 4x10-5, and 1x10-4 M at 20C . Ionic strength: 0 .150 M . 11 bottles, 20 mL each . Limited shelf life; use within 30 days . caLBuF-2 Kit of 11 Calcium Buffer Solutions
79
Kwik-Tip
Each kit includes three electrode tips.
Ion selective electrodes
l Superior, stable PVC membrane l Fast response l 2mm diameter tips l Interchangeable tip holder
st e, fa ical! rat ccu econom A and
MicroFil filling syringe (included).
BIOS EN S I NG
These highly stable electrodes accurately measure calcium, potassium, hydrogen and TPP ion activity . Tips consist of 2 mm diameter plastic tubes sealed at one end with an ion-sensitive membrane . After filling with electrolyte solution, the user inserts the tube into the holder and connects it to a pH meter . Tips and holders are interchangeable, so one tip may be replaced with another sensitive to a different ion . Replacing a tip takes less than a minute . Electrode tips normally last several months, when stored properly in saline solution . When replacement is necessary, only the tip need be replaced . Kwik-Tip electrodes are available separately and as kits . Each KWIK Electrode Holder kit includes a reusable holder and three removable tips . In addition to a 4-foot BNC cable and an electrolyte filling syringe; TIP Electrode Kits contain three electrode tips for a specific ion . a separate reference electrode, such as WPIs Dri-Ref, is also required. If your pH meter requires a US Standard connector, also order Part #3508 (BNC-to-US pH Standard adapter) .
cOMPLETE KITS KWIKcaL-2 Holder & 3 Calcium Electrodes KWIKH-2 Holder & 3 Hydrogen Electrodes KWIKPOT-2 Holder & 3 Potassium Electrodes KWIKTPP-2 Holder & 3 TPP (Tetraphenylphosphonium) Electrodes HOLDERS aND REPLacEMENT TIPS KWIK-2 Electrode Holder with BNC cable TIPca Calcium Electrode Tips (3) TIPH Hydrogen Electrode Tips (3) TIPK Potassium Electrode Tips (3) TIPTPP TPP+ (Tetraphenylphosphonium) Electrode Tips (3) accESSORIES 3508 BNC-to-US pH Adapter JE671P pH Meter, pH Electrode, Temp. Probe 110v AC adapter JE671PZ pH Meter, pH Electrode, Temp. Probe 220v AC adapter Also see Dri-Ref Reference Electrodes
Min. Slope / Decade 28 mV 54 mV 54 mV 54 mV
TIP ELEcTRODE SPEcIFIcaTIONS

Part No. TIPca TIPH TIPK TIPTPP Electrode Calcium Hydrogen Potassium TPP+ Color Code Green Orange Yellow Purple Recommended Filling Solution 0 .1 M CaCl2 1 M Citric Acid, 0 .01 M NaCl, pH 5 .6 0 .1 M KCl 10 mM TPP+ Concentration Range 0 .1 M - 10-6 .75 M pH 5 .0 - 12 0 .1 M - 10-4 .5 M 0 .001 M 10-4 M Selectivity Coefficients (-log) Na+ 5 .5, K+ 5 .4, Mg++ 4 .9 Na+ 10 .4, K+ 9 .8, Ca++ 11 .1 Na+ 4 .0, Ca++ 3 .9, Mg++ 3 .0 K+ 6 .0
Liquid Ion Exchangers

caTIONS
ION CATALOG NO . Na+ Mg++ K+ Ca++ USEFUL pH RANGE SLOPE LINEAR RANGE APPROX . EQUIV . H+ IE 010 12 .7 2-10 56 mV pH 4-12 K+ IE 190 Ca++ IE 200
SELEcTIVITY cOEFFIcIENTS*
1 .97 5 .5 2 .95 4 .9 5 .4 2 .7 4-10 4-10 58 mV 28 mV pK 0-3 pCa 1-7 Corning ETH1001 477317 *Selectivity Coefficients are expressed here as -log Kij or pKij .
When used in micropipettes to record cellular ion concentrations, consider using WPIs Duo 773 electrometer (channel A).
IE010 IE190 IE200 Hydrogen Ion Exchanger (0 .1 mL) Potassium Ion Exchanger (1 .0 mL) Calcium Neutral Ion Exchanger (0 .1 mL)
80
47530 (without base) 47540 (with base)
ProGuide
47520 (without base) 47510 (with base)
Novel electrode holder

Designed to hold WPI biosensors and any standard pH electrode, the unique ProGuide allows the positioning of an electrode in small sample volumes without the need for a micromanipulator . The smooth mechanism easily moves an electrode side-to-side or up and down while keeping it at a constant vertical angle . The ProGuide Plus (shown at right) comes with a micrometer positioner which allows fine adjustment of 0 .01mm in your samples .
BIOS EN S I NG
47520 47510 47530 47540
ProGuide Positioner/Holder ProGuide Positioner/Holder with Base ProGuide Plus Positioner/Holder with Micrometer ProGuide Plus Positioner/Holder with Micrometer with Base
pH Meter
Hard-to-find, classic pH meter JE671P allows the scientist to control all the parameters manually . Especially useful for non-standard pH and ISE electrodes . l All solid state design l Low drift and high stability l Fast input response l Manual and automatic temperature compensation l Auto polarity mV measurement
JE671P SPEcIFIcaTIONS
RANGE pH . . . . . . . . . . . .00 .00 - 14 .00 mV . . . . . . . . . . .-1999 to +1999 Temp . . . . . . . . . .0 .0 to +100C RESOLUTION pH . . . . . . . . . . . .0 .01 mV . . . . . . . . . . .1 mV Temp . . . . . . . . . .0 .1C ACCURACY pH . . . . . . . . . . . . 0 .1 mV . . . . . . . . . . . 0 .1% Temp . . . . . . . . . . 0 .5C
JE671P JE671PZ
pH Meter, pH Electrode, Temperature Probe, 110V AC Adapter pH Meter, pH Electrode, Temperature Probe, 220V AC Adapter
81
Glass capillaries
Clean, high quality glass for making micropipette electrodes and other research implements
Standard, no Filament Standard, with Filament Thin Wall, no Filament Thin Wall, with Filament
WPI offers a wide spectrum of high-quality glass capillaries . We take pride in our ability to ship your glass order within 48 hours . If you need a special glass that does not appear in our catalog, please call us . We will make every effort to provide it for you .
Single-Barrel Standard Borosilicate Glass Tubing

Length
3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm)
OD (mm)
1 .0 1 .0 1 .2 1 .2 1 .5 1 .5 1 .0 1 .0 1 .2 1 .2 1 .5 1 .5 2 .0 2 .0 1 .0 1 .0 1 .2 1 .2 1 .5 1 .5 2 .0 2 .0
ID (mm)
0 .58 0 .58 0 .68 0 .68 0 .84 0 .84 0 .58 0 .58 0 .68 0 .68 0 .84 0 .84 1 .12 1 .12 0 .58 0 .58 0 .68 0 .68 0 .84 0 .84 1 .12 1 .12
Filament
4 4 4 4 4 4 4
FirePolished
Quantity
500 500 350 350 225 300 500 500 400 350 300 300 125 200 500 500 350 350 225 225 125 125
Item
1B100F-3 1B100-3 1B120F-3 1B120-3 1B150F-3 1B150-3 1B100F-4 1B100-4 1B120F-4 1B120-4 1B150F-4 1B150-4 1B200F-4 1B200-4 1B100F-6 1B100-6 1B120F-6 1B120-6 1B150F-6 1B150-6 1B200F-6 1B200-6
Price
uS$54 uS$54 uS$54 uS$54 uS$54 uS$54 uS$59 uS$59 uS$59 uS$59 uS$59 uS$59 uS$59 uS$59 uS$71 uS$71 uS$71 uS$71 uS$71 uS$71 uS$71 uS$71
Fire-Polished glass
BIOS EN S I NG
capillaries are easier to insert into microelectrode holders without damaging the gasket . More importantly, fire-polished glass wont scratch the chloridized wire used in a recording electrode . Firepolishing does not affect the glasss mechanical or electrical properties .
4 4 4 4 4 4 4
capillaries: Close dimensional tolerances assure

microelectrode uniformity and reproducibility . Available in one-, two-, three-, five- and sevenbarrel configurations; a complete range of single barrel thin-wall sizes; and a variety of special configurations . Capillaries with filaments contain a solid filament fused to the inner wall, which speeds filling of electrodes . Capillaries with or without inner filaments are available for making microelectrodes in a wide range of diameters .
Borosilicate glass
4 4 4 4
Single Barrel standard wall thickness capillaries are offered either with or without inner filaments for quick filling in a variety of lengths and diameters . Two usable electrodes can be made from one 6-inch length . Borosilicate glass is Corning N51A .
Thin-Wall Single-Barrel Standard Borosilicate (Schott Duran) Glass Tubing

OD (mm)
1 .0 1 .0 1 .2 1 .2 1 .5 1 .5 1 .0 1 .0 1 .2 1 .2 1 .5 1 .5 1 .0 1 .0 1 .2 1 .2 1 .5 1 .5
ID (mm)
0 .75 0 .75 0 .90 0 .90 1 .12 1 .12 0 .75 0 .75 0 .90 0 .90 1 .12 1 .12 0 .75 0 .75 0 .90 0 .90 1 .12 1 .12
FIL
4 4 4
FirePolished
Length
3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 3 in . (76 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 4 in . (100 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm) 6 in . (152 mm)
Quantity
500 500 400 350 225 300 500 500 350 350 225 300 500 500 400 350 225 300
Item
TW100F-3 TW100-3 TW120F-3 TW120-3 TW150F-3 TW150-3 TW100F-4 TW100-4 TW120F-4 TW120-4 TW150F-4 TW150-4 TW100F-6 TW100-6 TW120F-6 TW120-6 TW150F-6 TW150-6
Price
uS$56 uS$56 uS$56 uS$56 uS$56 uS$56 uS$59 uS$59 uS$59 uS$59 uS$59 uS$59 uS$71 uS$71 uS$71 uS$71 uS$71 uS$71
Thin Wall single barrel capillaries are offered

both with or without inner filaments . The concentricity of this material provides excellent strength . Micropipettes made from thin wall capillaries have fine tips with a short taper .
4 4 4 4 4 4 4 4 4 4 4 4
Note: Because electrode tips erode when left filled with saline solutions for long periods, electrodes should be made and filled immediately prior to use .
82
Amplifier
AC/DC
Differential Headstage
EMG EKG
Stimulation Isolated
Multichannel
Battery Powered
Connectors
Page
Intracellular Bioamplifiers
FD223A Electro 705 Duo773 DC DC DC t t t t t t t t 2 mm pin 2 mm pin 2 mm pin 84 85 86
Extracellular Bioamplifiers WPIs Low-Noise Amplifiers Outperform Cheap Imitations

DAM50 DAM80 ISO80 DAM800 AC/DC AC AC t t t t t t t t t t t t t t RJ-11 Mini Banana Mini Banana 88 90 91 92 94
Transducer Amplifiers
TBM4M DC t t 8-pin DIN WPI transducers
AMPLIFIERS, ELECTROMETERS
105
Epithelial Voltage/Current Clamp Bio Amplifier

EVC4000 DVC1000 DC DC t t t t Ussing 2 mm Ussing 2 mm 24 25
Specialty Measurement
121 Window Discriminator 260 Dual Microiontophoresis Current Generator 900A Intracellular Pressure Measurement ABM Audible Baseline Monitor LPF30 Low-Pass Filter Omega-Tip-Z Electrode Volt-Ohmmeter Pressure Manometer 102 93 104 93 93 103 199
Accessories
Ag/AgCl Half Cells Cables & Connectors Force Transducers Metal Microelectrodes Transducers for Physiological Measurement LUME, PNEU 103 140 99 100 98
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel:941-371-1003 Fax:941-377-5428 E-mail:sales@wpiinc.com Internet: www.wpiinc.com
83
Dual Channel Differential Electrometer
l High
input impedance (10 15 ) l Differential (A-B) output l Low noise and wide bandwidth
l Electrode
resistance test circuitry l Probe test circuitry l Driven guard shield

theprobeinputmaintainsthespecifiedhighresistanceandreducesthe straycapacitanceoftheprobes. Carefuldesign,coupledwithqualitycomponentselection,particularly intheheadstage,resultsinanexcellentamplifierwithlownoiseandwide bandwidth.TheFD223awillfaithfullyreproducethemeasuredsignal. Toreducethenoiseandstraycapacityevenfarthertheprobehousing includesasignaldrivenguard.Aportionofthisinnerdrivenshellis exposedattheprobetipallowingaspringshieldtobeextendedoverthe electrodeholderandmicroelectrode. Theamplifierfeaturesaprobetestportthatpermitstestingofthe electrodetestfeatureandsettingoftheprobeleakagecurrent,(IG).A standbymodeisincludedandshouldbeusedwhenattachingglass microelectrodesorelectrodeholderstotheprobeinput.Whileinthe standbymodethevoltageattheprobeinputisclampednearzerovolts thusprotectingtheinput.
TheFD223aisadualdifferential,highimpedanceamplifier/electrometer designedspecificallyforelectrochemicalmeasurementsusingionspecific (K+,Na+,C1-,etc.)orpHglassmicroelectrodes. Theinstrumentisverystable,driftfree,andfeaturesabuiltinprovision formeasuringandadjustinginputleakagecurrent.DClevelsmaybe independentlyadjustedforeachprobechannel. Theabilitytolocatethesensingprobesdirectlyatthemeasurement siteovercomesthenoiseintroducedbythelongcablesusuallyneeded tobringthemeasuredpotentialtotheinstrument.Signal-drivenguardsat
FD223A SPECIFICATIOnS
INpuTImpeDANCe INpuTCApACITANCe LeAKAGeCurreNT GAIN OuTpuTreSISTANCe INpuTSWINGVOLTAGe rISeTIme(10TO90%) BASeLINeSTABILITy pHySICALDImeNSIONS pOWer prOBeHANDLe SHIppINGWeIGHT >1015,shuntedby0.5pF 1pF,nominal 75fAmax 1.0000.1% 50 10V 5s,smallsignal 0.1mV/day Case:8.8x21.0x17.5cm(HxWxD) probe:12.7x65mm(DxL),1.8mcable 90-265VAC,50/60Hz,10VA 6.5x65mm(DxL) 2.5kg
#2547 Driven Guard Shield

FD223A FD223aDualChannelDifferentialelectrometer 2 probes, driven guard shields and micropipette holder MEH1SF included for all glass microelectrodes O.D. 1.0 mm, 1.2 mm, 1.5 mm, or 2.0 mm. OPTIOnAL M3301L M-3 RC1T 2547 MEH1SF FD223AP ACCESSORIES micromanipulator(specify left- or right-handed) 80Tiltingbase referencecell(Ag/AgCl) DrivenguardshieldforFD223Approbe microelectrodeholder replacementprobe(includescalibration) See cables and connectors, page 140. See microelectrode holders, pages 124. See capillary glass, page 118.
NOISe(0.1HzTO10KHz) <100Vp-p,inputshorted pOSITIONCONTrOLSrANGe 600mV
OperATINGCONDITIONS equipmentisintendedtobeoperatedin acontrolledlaboratoryenvironment.Temperature:0-40C;altitude: sealevelto2000m;relativehumidity:0-95%.
84
WPIs Quietest Intracellular Amplifier!

BAT POW TE RY ERE D
Electro 705
LE TAB POR
A low noise high quality intracellular amplifier well-suited for the student lab
Photo shows two units arranged for differential recording. Manipulators not included. lRemote Headstageeasilymountedinanymanipulator,this smallprobe,containingthefirststageofamplification,includesa microelectrodeholder,whichplugsdirectlyintotheprobeinput. lBattery PowerFour9Valkalinebatteries(included)powerthe electro705forapproximately500hoursgivingasupercleanlownoise sourceofpowermakingtheelectro705thequietestamplifieravailable. Batteriescanbeeasilytestedbythepressofabutton. lCapacitance CompensationCorrectsforlossofrisetimecaused bythepresenceofelectrodecapacity.upto50pFofelectrodeshunt capacitymaybeneutralized. lDriven Guard ShieldStraycapacitancecanbe furtherreducedbyplacingthedrivenguardshield (included)overthemicroelectrodeholderatthe inputendoftheprobe. lTickler CircuitAmomentaryoscillationthathelpsachievecell penetration. lElectrode Resistance TestThe705providesa1nAelectrodetest current.electroderesistanceismonitoredatthe1Xoutputasavoltage(1 mV/m). lProbe Test PortAllowstheconvenienceoftestingtheamplifier's intrinsicnoiseandgainwithoutcumbersomeexternaltesthookups.Gate leakagecurrentcanalsobeadjustedwithminimumeffort. lBaseline Position Control Addsorsubtractsupto300mVto theheadstageoutput,allowingartifactvoltagessuchasliquidjunction potentialstobenulledpriortorecording. lDifferential OutputTwoelectro705scanbeconnectedintandem tocreateanoptionaldifferentialamplifierprobesystem. SYS-705 electro705electrometer Probe, driven guard shield and micropipette holder MEH1SF included for glass microelectrodes O.D. 1.0 mm, 1.2 mm, 1.5 mm, or 2.0 mm. OPTIOnAL ACCESSORIES 3468 DualrackmountKit 3469 SinglerackmountKit M3301L micromanipulator(specify left- or right-handed) M-3 80Tiltingbase RC1T referencecell(Ag/AgCl) 2541 Drivenguardshieldfor705pFprobe MEH1SF microelectrodeholder 705PF replacementprobe(includescalibration)* *Instrument must be returned to WPI for free calibration with new probe. See cables and connectors, page 140. See microelectrode holders, pages 124. See capillary glass, page 118. Reference
Koch, U. (2000)Interdependenceofspatialandtemporalcodingintheauditorymidbrain. Journal of Neurophysiology83,4,2300-2314
ELECTRO 705 SPECIFICATIOnS

INpuTImpeDANCe OuTpuTImpeDANCe GAIN INpuTVOLTAGerANGe rISeTIme NOISeLeVeL GATeLeAKAGeCurreNT eLeCTrODereSISTANCeTeST DCpOSITIONING COmmONmODerejeCTION pOWer DImeNSIONS SHIppINGWeIGHT 10 Ohms,shuntedby1pF
12
100Ohms,bothoutputs X1:0.1% 5V 15s,10-90% 500Vpeak-to-peak* 10pA,adjustabletozero 1mV/mOhms 300mV >104(indifferentialmode) Four9Valkalinebatteries,supplied 8.5x3.5x2.2in.(22x9x6cm) 5lb(2.3kg)
INpuTCApACITANCeCOmpeNSATION 0-50pF
* Full band width, with 20 M Ohms source
85
Duo 773 Dual Microprobe System

2-channel intracellular amplifier
For intracellular dual or differential studies, the Duo773 has separate negative capacity controls and built-in active filtering that allows the precise balancing of time constants for artifact-free differential measurement. Comes complete with two probe headstages, 1015 Ohms & 1011 Ohms probes to monitor signals from ionspecific micro-electrodes as well as KCl-filled electrodes.
* Although injected currents are constant, the maximum current in a given situation will always be limited by the system compliance of 10 V. **The 712P headstage may be used on either A or B channels, however Current Injection specifications do not apply when used on channel A. The 715P headstage may not be used on the B channel.
DUO 773 SPECIFICATIOnS

HEADSTAGE (PROBE) ACTIVeprOBeINpuTImpeDANCe GAIN OuTpuTreSISTANCe OuTpuTVOLTAGerANGe mAXImumINpuTVOLTAGe prOBeLeAKAGeCurreNT DCpOSITIONADjuSTrANGe eLeCTrODereSISTANCeTeSTCurreNT INpuTCApACITyCOmpeNSATION NOISe Inputshorted 20mcarbonresistor rISeTIme 10-90%directinputsmallsignal 10-90%through20m(-Con) CurreNTINjeCTION InternalDCCurrent externallycommandedCurrent externalcurrentcommandfactor Currentmonitor Compliance Bridgebalance Bridgeamplifiergain LOWpASSFILTer meTerSeCTION Display ranges Accuracyandresolution DImeNSIONS Instrument probe pOWer SHIppINGWeIGHT CerTIFICATION 712P (red, port B) 715P (blue, port A) 1015 >1011 x1,x10 x1 100 100 10V 10V 15V 15V 10-14A 5X10-12A 300mV 300mV 1nA 1pA,1nAselectable +10to-50pF 0to-10pF <50Vp-p10kHzbandwidth <50Vp-p10kHzbandwidth <200Vp-p10kHzbandwidth <200Vp-p10kHzbandwidth 1s,typical 25s,typical (712ponly)** 50nAlowrange,500nAhighrange 500nAlowrange,5Ahighrange 20mV/nAlowrange,2mV/nAhighrange 100mV/nAlowrange,10mV/nAhighrange 3Vlowrange,10Vhighrange 0-100m,0-1000m x10,x50 40dB/decade,continuouslyvariable1-30kHz 3.5-digitLeD 200mV,2000mV,20V,200nA,2000nA 1digit 17x5.25x10in.(43x13x25cm) Diameter:12mmLength:34mm 95-135Vor220-240V,50/60Hz 15lb(7kg) Ce,CSA
References
L. Pluja (2000)electricalandmechanical effectsofvasoactiveintestinalpeptideand pituitaryadenylatecyclase-activatingpeptide intheratcoloninvolvedifferentmechanisms. European Journal of Pharmacology389,217224. G. X. Wang, X. B. Zhou, et al. (2000)effectsof mitoxantroneonexcitation-contractioncoupling inguineapigventricularmyocytes.Journal of Pharmacology and Experimental Therapeutics 293,2,501-508. S. Tsuruoka(2000)Acuteeffectofcadmiummetallothioneinonglucoseandaminoacid transportacrosstheapicalmembraneofthe rabbitproximaltubuleperfusedin vitro.Journal of Pharmacology and Experimental Therapeutics 292,2,769-777.
86
HeadstageTwogold-plated,epoxysealedminiatureactiveprobescan bepositioneddirectlytothemeasurementsite.microelectrodeholders containinganAg/AgClelectrochemicalhalf-cellsplugdirectlyintothe probes.Straycapacitancecanbereducedbyplacingtheincludeddriven guardshieldoverthemicroelectrodeholderattheendoftheprobe. Capacity CompensationChannelAcancompensateupto10pFof electrodeshuntcapacityandChannelBcancompensateupto50pF. Tickler CircuitAssistsincellpenetration.Thefrequencyand amplitudeoftheoscillationsmaybevariedfordifferencesinmembrane thicknessorcellsize.Thedurationofticklecanbecontrolledeitherby usingthemomentaryswitch,afootswitch,orbyapplyingasignaltothe remoteticklerinput. Active FiltersLowpasssettingsona-40dB/decadeactivefilter varythecutofffrom1to30kHz.eitherprobeorbridgeoutputsmaybe selectedforfiltering. Current InjectionChannelBcanejectcurrentthroughthe microelectrodebyapplyingacommandsignaltothestimulusinput connector;theresultingoutputfromtheprobewillthenbeaconstant currentreplicaoftheinputsignal.Tworangesofcurrentdeliveryare provided:50nAand500nAorbyanexternalsource.Thissourcecan beusefulfordeliveringhyperpolarizingcurrentstostabilizethecell membranepotentialandasaholdingcurrentformicroiontophoresis. Compliance AlarmWhentheelectrodevoltageexceedstheprobe inputmaximumallowedvoltage,anaudibleover-compliancealarmwill sound. Bridge BalanceSubtractstheexcesselectrodevoltageassociated withdeliveringcurrentthroughtherecordingmicropipette.electrode resistancesupto1000mcanbebalancedintworanges.Thebalanced signalisavailablefromx10orx50frontpaneloutputconnectors.
Independent OutputsTheDuo773hasanoutputforeachprobe independentofgainfilteringorbalancing.InadditiontheDuo773has a10xanda50xoutputforeasyintegrationtomostdataaquisition programs. Digital MeterTheDuo773comescompletewitha3-digitdisplay formonitoringinjectioncurrentorthevoltagesforeitherprobe(single endedordifferential). SYS-773 Duo773electrometer Specify line voltage Includes two probes (712P and 715P or two 712P) with driven guard shields and eight MEH1SF microelectrode holders for 1.0 mm, 1.2 mm, 1.5 mm, or 2.0 mm glass electrodes.
OPTIOnAL ACCESSORIES 712P replacementprobe(includescalibration)* 715P replacementprobe(includescalibration)* *Instrument should be returned to WPI for free calibration with new probe. 2933 2547 15790 TW100F-4 TW150F-4 rackmountKit,514-in.high DrivenGuardShieldfor712p&715pprobes replacementprobeHandle Glasscapillarywithfilament Glasscapillarywithfilament See Dri-Ref, page 79. See cables and connectors, page 140.
#2547 Driven Guard Shield
Typical setup:
Optional Holders for Intracellular Amplifiers
Duo773
50x gain output

M EH F 1S
(su
pp
lie
d)
Data Acquisition System
EH
2S
EH
2S
FW
Recording Electrode (with holder MEH1SF)
Drug or dye current electrophoresis injection
EH
3S
EH
3S
FW
EH
6S
Micromanipulator
Micromanipulator
EH
6S
FW
See Microelectrode Holders,

Inverted Microscope
page 124
87
WPIs Low-Noise Amplifiers Outperform Cheap Imitations
n amplifier, in simplest terms, is an electronic device that magnifies an input signal. However, the way an amplifier is designed to handle noise and bandwidth limitations greatly affects the quality and sustainability of the final output signal.
reproduced. This is called hitting the rail. be generated with the amplifier. It is determined by the maximum voltage of the power supply. If the amplitude of the output signal is too large for the output range, part of the signal is cut off (clipped). Rail The upper or lower limit of the amplifier range is called a rail. Signals that exceed the rail cannot be faithfully reproduced. DC Offset DC offsets can appear in biological preparations. This offset is the amount the output signal is displaced away from a zero reference point, and it is usually a result the potential difference at the electrodes tip. In our example, a 1.0V input signal at an 106 gain would generate a 1.0V output signal. Since the power supply is rated up to +5.0V, this output signal is clearly visible. If the input signal in this example is greater than 5.0V, the output signal would be greater than +5.0V. Since 5.0V is the top of the range that the power supply is capable of producing, the output signal hits the upper rail and gets cut off. This amplifier will give a +5.0V DC output signal for all input signals greater than or equal to 5.0V. In this instance, a smaller gain factor should be used to bring the output signal back into the dynamic output range of the amplifier. Noise Limits Amplifier Useability All electronic devices produce their own internal electronic noise, an unavoidable signal that can mask the output signal. For example, if the input signal is 2mV and the noise is 1mV, the signal to noise ratio is two to one (2:1), and the output signal would be undetectable. In this case, it is nearly impossible to discern which part of the output is generated by noise and which part is the desired signal. (Fig. 1)
Signal vs. Noise
Defining terms
To knowledgeably discuss amplifiers, lets define a few terms. Gain The gain is the multiplier defining how much the amplitude of an input signal is increased. A signal with an 1 gain is not amplified. An 10 gain produces an output signal ten times greater than the input signal. Noise Any unwanted signal fluctuations are called noise. While noise can also result from external sources, for the purpose of this discussion, we are primarily concerned with the noise resulting from the inner workings of the electronic device, our amplifier. This intrinsic noise is called shot (or schott) noise. Signal to Noise Ratio (SNR) The ratio of the output signal to the noise of the amplifier is called the signal to noise ratio. The smaller the shot noise signal in an amplifier in comparison with the output signal, the easier the desired signal is to discriminate. When engineering an amplifier, the SNR may be improved by boosting the first stage gain to yield a larger output signal or by using quality components to minimize the shot noise level of the amplifier. Output Range The output range determines the maximum output signal that can 88
How does an amplifier work?

Power Supply Rails Limits the Range In a perfect world an input signal can be infinitely multiplied by the gain factor to determine the output signal. For example: Input Signal Gain Output Signal 2mV 1 2mV 2mV 2 4mV 2mV 10 20mV 2mV 100 200mV 2mV 10,000 20V In the real world, however, the power supply rails limit the possible output range of the amplifier. For example, a bio-amplifier could have a range of 5.0V. In order for the output signal to be faithfully reproduced, the input signal times the gain factor must fall within the voltage window set by the power rails. Otherwise, the output signal will go off scale, and the input signal will not be faithfully
Range
+5.0V
Upper Rail
Signal Noise
-5.0V
Lower Rail
Fig. 1The higher the signal to noise ratio, the more discernable the desired signal.
Ideally,thesignaltonoiseratioshouldbeat least50to1toproduceaqualityoutputsignal. Agoodsignaltonoiseratiocanbeachievedin oneoftwoways: Boosttheoutputsignalbyincreasingthe gain. reducethenoise. Whileincreasingthegainisthesimplest solution,toomuchgaincanimposealimitation onthedynamicrangeoftheamplifier.reducing noiseisamorecomplicatedsolution,butit offersagreaterrangeandmorestabilityinthe end. Two-Stage Amplifiers Bio-amplifiersusuallyinvolvemultiplestagesof amplification. Stage OneTheunadulteratedsignalcoming intotheamplifierisunaffectedbytheintrinsic noiseoftheamplifier.Then,itrunsthroughthe criticalfirststageofamplificationwherethe signalisboostedbytheprimarygainfactorto produceanoutputsignalwiththedesiredsignal tonoiseratio.Theintrinsicnoiseisnotamplified inthefirststage.Highergainfactorsusedinthe firststageofamplificationcanseriouslylimit thedynamicrangeavailableatoutputstage. Largestageonegainsalsolimitthegainfactor availableinthesecondstageofamplification. Stage 2Thestageoneoutputsignalenters thesecondstageofamplificationwhereboth thesignalandthenoisefromthefirststageare amplifiedtogetherbythesecondstagegain factorsothatthesignalislargeenoughtobe seenonachartrecorderordataacquisition system.Thesecondstageamplificationisthe
Result of Amplifier Using Gain to Control Signal to Noise Ratio

+5.0V +5.0V +5.0V
-5.0V
-5.0V
-5.0V
Output signal viewable in range
Offset causes the signal peak to hit the upper rail
Increasing offset renders the signal useless
Fig. 2As the offset naturally increases over time, a poorly constructed amplifier will not be able to faithfully reproduce the signal. This offset can also be a result of gain drift which can occur as the temperature rises. gaintheusercontrols.Itdoesnotchangethe signaltonoiseratio. Insteadofusinghighgainsinthefirststageof amplification,awellconstructedbio-amplifier thatuseshighqualitycomponents,likeWpIs DAmseriesamplifiers,minimizesthenoise inthefirststageofamplificationsothatthe dynamicrangeisretainedthroughoutthe amplificationprocess.Apoorlydesigned amplifierwillsimplyincreasethegainofthefirst stageamplificationuntilthedesiredsignalto noiseratioisreached. forgreaterfirststagegains.However,mostdata acquisitionsystemsarelimitedtoamaximum inputsignalrangingbetween10.0V.Therefore, itisnotpracticaltoincreasethepowerrailsof bio-amplifierbeyond10.0V.Sincetheindustry standardlimitsusto10.0Vpowersupplyrails, theonlywaytoimprovethesignaltonoiseratio istominimizetheshotnoiseinthefirststageof amplification.Thisiswhyhighqualityamplifier componentsareimperative.
Why does my signal flatline?
Amplifier AC/DC Differential Intracellular Bioamplifiers

FD223A Electro 705 Duo773 DC DC DC t t
Headstage
regardlessoftheamplifierused,biological potentialsareoftenaccompaniedbyaDCoffset, becausetheelectrodespolarizeovertime.The Theoretically,increasingthevoltagerails poweringtheamplifierwillincreasetheavailable DCoffsetnaturallyincreasesovertime.Since thepoorlyconstructedamplifierthatutilizes dynamicoutputrange.Itwouldseemnatural greaterfirststagegainhasrestricteditsdynamic toincreasethepowersupplyrailscominginto range,ithaslimitedabilitytohandlethisoffset. theamplifierinordertoprovidethecapability Astheoffsetcontinuestoincrease,theoutput signalmayeventuallybeforcedby EMG StimuMultiBattery theoffsetintotherailcausingtheflat Isolated Connectors EKG lation channel Powered line(clippingthesignal).(SeeFig.2.)
Why not boost the power rails?
t t t t
2 t 2
2 mm pin 2 mm pin 2 mm pin
Theamplifierthatminimizesthe noiseinthefirststageamplification offersalargerdynamicoutputrange andhandlesamuchgreateroffset value.
WPIs amplifiers
Thepurchaseofalow-noise amplifierpaysdividendsintheend. WpIsamplifierswereengineeredfor thebio-medicalresearcher.While 20-30Vofnoiseiscommonin bio-amplifiers,WpIsDAmseries amplifiersgenerate0.4VrmS (rootmeansquared)at0.1-100Hz. (Thatsequalto2Vpeak-to-peak.) ThechartatleftcomparesWpIsbioamplifiers.
Extracellular Bioamplifiers
ISODAM8A ISO80 DAM50 DAM80 DC AC AC/DC AC t t t t t opt t t t t t t t t t 4-8 t t t Mini Banana or 8-pin DIN Mini Banana RJ-11 Mini Banana
Transducer Amplifiers
BRIDGE8 TBM4M DC DC t t 4-8 4 8-pin DIN WPI transducers 8-pin DIN WPI transducers
Epithelial Voltage/Current Clamp Bio Amplifier

EVC4000 DVC1000 DC DC t t 1-4 2 Ussing 2 mm Ussing 2 mm
89
DAM Series Bioamplifiers

A family of very low noise battery-operated amplifiers
Now wi th E S D P rotectio n
Gatedormanualcurrentgenerationforhistologicalmarking, iontophoresis,orcellstimulation. Averylownoiseremoteactiveheadstage(DAm80only)is
usefulforveryhighimpedanceamplificationutilizing glassormetalelectrodes. DAmseriesamplifierscanbeusedasstandalone unitsonanytabletop,oruseoptionalclampmountinghardwaretolocatethemconveniently withintheworkarea.Alternatively,apairof amplifierscanbemountedintoastandard equipmentrackwitharackmountkit(#3484). Avarietyofhookupaccessoriesareavailableto configureyourapplication.
Dam50Basic Amplifier (optional

#5447 electrode adapter not included) Optional probe #5489 for use with DAM50 also includes microelectrode adapter #5469.
WpIsDAmseriesamplifiersarewellknownasastandardofthe industryforextracellularpotentialamplification.Thesebattery poweredbio-amplifiersaredesignedwithacompactchassisprofile thatenablestheusertolocatetheunitclosertothepreparation andtherebyminimizelongleadlengthswhichcontributetonoise. eachamplifierisequippedwithselectablehighandlowfilters,and apositioncontroltooffsetgalvanicpotentialswhichmaydevelop duringrecording.Achoiceofmodelsofferadditionalfeaturesthatare usefulforcertainapplications:
Application Examples
DAM50 DAM50 #5447 Adapter
GND A GND B Electrode Adapter
#5371 Cable #5371 Cable
#3294 Grounding Clip #5489 Probe #2033 Adapter #3578 Cable

A B
Light Stimulation #300102 electrode extension, held by micromanipulators
Micromanipulator
#5469 Metal Microelectrode Adapter Metal Microelectrode (i.e., TM33B01) Petri Dish
Metal Microelectrodes Central Ground EP2 Ag/AgCl Half Cell Immobilized specimen Ag/AgCl pellet
Central Ground
Extracellular recording using metal microelectrode
ERG recording of fly eyes
90
DAM SERIES SPECIFICATIOnS

INpuTImpeDANCe INpuTLeAKAGeCurreNT mAX.DCDIFFereNTIALSIGNAL GAIN COmmONmODerejeCTIONrATIO INpuTCApACITANCe ACmODeNOISe ACmODeNOISe DCmODeNOISe(DAm50) BANDWIDTHFILTerSeTTINGS ACmode ACmode(DAm80) DCmode(DAm50) Lowfrequency,0.1,1,10,300Hz Highfrequency,0.1,1,3,10kHz Highfrequency,0.1,1,3,10kHz BNConDAm50;3.5mmminiphone connectoronDAm80 8V 470 Audibletone 10Hzsquarewave Approximately250mV 1012,commonmodeanddifferential 50pA(typical) 2.5V(DAm50) AC:100x,1000x,10000x DC:10x,100x,1000x(DAm50) 100dB@50/60Hz 20pF 0.4VrmS(2Vp-p)0.1-100Hz 2.6VrmS(10Vp-p)1Hz-10kH 7.5VrmS(30Vp-p)3-10kHz
Dam80 With low-noise headstage DAM80P
DAM80,anACamplifieronly,featuresaverylownoiseheadstage probewhichcanbemountedinmi ro a p aorsforup-closecortical c m ni ul t recording,forexra eluarrecordingfromhighimpedanceglassormetal t c l l mi ro lecrodes.Alsoprovidesagatedcur entfortissuemarking.mi roc e t r c elecrodeholdermeH3SBisrecommended. t IncludedwiththeDAm-80isaStartupKitcontainingthefollowing accessoriesneededforbasicmetalelectrodeelectrophysiologyresearch: CBL102Cable,BNC-to-3.5mmplug,6ft(2m)(two) 5469Adapter,mini-bananato0.031skt.(two) 13388Adapter,mini-bananato2mmskt.(two) 3294Cable,groundcliptowire,3ft 2033mini-bananaplug,black 2034mini-bananaplug,red 2035mini-bananaplugsolderableturrent(two) EP1Ag/AgClpellet(70mmwire)1mmdiamx2.5mmlong M3301EHelectrodeHolder,14cm(two) 54700.031-inchjackon12-inchwire(packageof4)
#3294 Grounding Clip (included) DAM80 or ISO-80 DAM80i Probe (included)
OuTpuTCONNeCTOrS OuTpuTVOLTAGeSWING OuTpuTImpeDANCe BATTeryTeST CALIBrATOrSIGNAL pOSITION CurreNTSOurCe DAm80:DCGenerator
0to50A,variable InputVoltage10Vcommands 50Amax.amplitude@200K 2x9Valkaline(included) 8x4x1.75in.(20.3x10.2x4.4cm) 7x4x1.75in.(17.8x10.2x4.4cm) 3.5lb(1.6kg)
eXTerNALCOmmAND ACOrDCCurreNTWAVeFOrm BATTerIeS DImeNSIONS DAm50 DAm80
SHIppINGWeIGHT
#13388 Adapter
B
#5371 Cable
#300102 electrode extension, held by micromanipulators
EMG recording of a rat
Metal Microelectrodes Ag/AgCl skin electrode pad (#EL203)
FEATURE Inputmode Inputconfiguration Gainrange High/LowFilters Offsetpositioncontrol CurrentGenerator remoteActiveheadstage Outputconnection Standardinputconnection* powersupply
DAM50 AC/DC differential/singleended 100-10K(AC),10-1K(DC) yes yes No No BNC unterminatedwire (2)ninevoltalkalinebatteries
DAM80 AC differential 100-10K(AC) yes yes yes yes 3.5mmminiphone minibanana (2)ninevoltalkalinebatteries
*seeoptionalaccessoriesforadditionalalternatives
SYS-DAM50Bio-amplifier SYS-DAM80 Bio-amplifierwithactiveprobe(DAm80p) OPTIOnAL ACCESSORIES DAM80P replacementprobe 3072 6replacementmodularCables(DAm50) 3517 2OptionalShieldedmodularCables(DAm50) CBL102 3.5mmphoneplug-to-BNCCable 2851 BNC-to-BNCCable 2033 BlackInsulatedmini-Bananaplug 2034 redInsulatedmini-Bananaplug 2035 uninsulatedmini-Bananaplug 2101 9VAlkalineBattery,each(2required)
3484 3485 5447 5469 5489 13388 5371 3578 300102 3414
rackmountKit(for2DAmpreamps) ringstandmountingKit electrodeAdapter(DAm50) metalmicroelectrodeAdapterforDAm80 (mini-banana plug to 0.031 in. (0.79 mm) socket) Adapterformetalmicroelectrode(DAm50) Adapter,mini-bananaplugto2mmsocket Cable,LowNoise(2mmpinto2mmpin) AdapterCableforAg/AgClpellets(2mmpin) electrodeextension,4-inch 9VNimHBattery
Also see cables and connectors, metal microelectrodes, carbon-filled micropipettes.
91
Isolated Differential Amplifier

TheimprovedISO-80provideslownoiseAC coupledamplificationandoffersexcellent recordingperformanceformonitoring extracellularnerveactionpotentialsin vitroandinlivinganimals.TheISO-80is providedwitharemoteheadstage(1mcable) whichincorporatesanelectrodeimpedancetest functionandaconstantcurrentstimulator.Theconstant currentstimulatorcanbeusedforcellmarking,stimulationorelectrode cleaning.TypicalapplicationsincludemeasuringemG,eeG,extracellular andactionpotentialsin vitroorin vivo.TheISO-80systemisDCisolated fromthesubjectgroundandemploysstateoftheartelectro-magnetic shieldingforimprovednoiserejection.Theamplifieremploysbothhigh passandlowpassfilteringwithgainfrom100to10,000.Thelowestlowpasssettingis5Hzandtheupperpassbandis10kHz.
ISO-80 SPECIFICATIOnS
INpuTreSISTANCe InPuT LEAkAGE CuRREnT AMPLIfICATIOn >1011Ohms,Commonmodeanddifferential 50 picoamperes, max. 102,103,104
COmmONmODerejeCTIONrATIO 100dBtyp.@50/60Hz equIVALeNTNOISeSIGNALINpuT 0.4microvoltsrms(0.1-100Hz) 2.0microvoltsrms(1Hz-10kHz) FILTerSeTTINGS Lowfrequency Highfrequency mAX.OuTpuTVOLTAGeSWING eLeCTrODeImpeDANCerANGe STImuLATIONCurreNT mAXImumeLeCTrODeVOLTAGe DISpLAy BATTeryTeST pOWer SHIppINGWeIGHT 5,10,100,300Hz 100Hz,1,3,10kHz 8volts 100kOhm-10mOhm@300Hz 0to20microamperes(constantcurrent) 40volts 312-digitLCD Lowbatterydisplay Two9-voltNiCadbatteries&charger, supplied 4lb(1.8kg)
Included with the ISO-80 is a Startup kitcontainingthefollowing accessoriesneededforbasicmetalelectrodeelectrophysiologyresearch: CBL102Cable,BNC-to-3.5mmplug,6ft(2m)(two) 5469Adapter,mini-bananato0.031skt.(two) 13388Adapter,mini-bananato2mmskt.(two) 3294Cable,groundcliptowire,3ft 2033mini-bananaplug,black 2034mini-bananaplug,red 2035mini-bananaplugsolderableturrent(two) EP1Ag/AgClpellet(70mmwire)1mmdiamx2.5mmlong M3301EHelectrodeHolder,14cm(two) 54700.031-inchjackon12-inchwire(packageof4)
ISO-80
mAXImumSTImuLATIONVOLTAGe 15volts
IsolatedBioamplifierw/activeprobe(ISO80p) Specify line voltage OPTIOnAL ACCESSORIES ISO-80P replacementISO-80probe CBL102 3.5mmphoneplug-to-BNCcable
To ISO-80
To ISO-80
To ISO-80 #5470 electrode adapter* #2033 connector* #M3301 electrode holder*
ISO-80 probe #5469 electrode adapters* micromanipulator metal microelectrodes specimen #3294 grounding wire & clip* Cut, strip, and secure the wires in #2033 connector. micromanipulator
ISO-80 probe red socket #5469 electrode adapter* metal microelectrode specimen micromanipulator
ISO-80 probe*
micromanipulator
red socket #3294 grounding wire & clip* metal #5469 microelectrode electrode adapter*
specimen
#3294 grounding wire & clip* EP1* or similar Ag/AgCl half-cell
#2033 connector*
EP1* or similar Ag/AgCl half-cell
EP1* or similar Ag/AgCl half-cell
Differential Application
Single-Ended Application
Optional Differential Application
92
Dual Microiontophoresis Current Generator

SYS-260 DualmicroiontophoresisCurrentGenerator OPTIOnAL ACCESSORIES 2933 rackmountKit,514-in.high Capillary glass, see page 118.
260 SPECIFICATIOnS
OuTpuT OuTpuTrANGeS OuTpuTpOLArITy Constantcurrent,floating 0to100nA 0to1000nA Switchselected 100V Analogmeters,2%accuracy >100m Lessthan20Vtypical DCto10kHzthrough1m independentofcurrentdelivery Frontpanellight manualorbyremotelogic Four9Valkalinebatteries,included 17x5.25x10in. (43x13x25cm) 13lb(5.9kg)
COmpLIANCe(eXCurSION)VOLTAGe
TheDualmicroiontophoresisCurrentGenerator(model260)isan electricallyisolated,battery-operatedinstrumentdesignedfortheelectroiontophoresisofdyes,drugsandchargedsubstancesfrommicropipettes. Twoidenticalbatteryoperatedcurrentgeneratorsareavailable.In ordinaryuse,thetwocurrentgeneratorsareoperatedinparallelproviding twodistinctcurrents;oneforpreventingsubstancesinthemicropipette fromoutwarddiffusion(theretainorholdcurrent)andthesecondfor activelyejectingchargedmaterial.Forpipetteswithsubmicrontips,ahold currentmaynotbenecessaryifthereislittleoutwarddiffusionofpipette material.model260ispoweredbytwo9-voltalkalinebatteriesperside (four,intotal);uniquecircuitryconvertsthe9Vto100Vwithouta transformer,yieldinganexceedinglyquietoutput.
meTer OuTpuTreSISTANCe NOISe OVerVOLTAGeALArm HOLD&ejeCTSWITCH pOWer DImeNSIONS SHIppINGWeIGHT
LeAKAGeCurreNTTOGrOuND Lessthan0.5nA
Audible Baseline Monitor

TheABm,abatery-op r t dvolt ge-cont eae a trolledos ilaor,letsyoumonitorpoenial c l t t t au i ly.ABmisparic aryuseulbe ause db t ul l f c itallowstheusertoesi atevolt gelev ls tm a e whenusngami ro copeoren agedinoth r i c s g e taskswhichdonotalowviewinganos ilol c l scopeorre ord r.Anaudibletoneisgen r tc e ea edwithincreasingpitchastheinputvolt ge a becomesin reasngypositive. c i l SYS-ABM AudibleBaselinemonitor
FrequeNCyrANGe INpuTreSISTANCe pOWer
ABM SPECIFICATIOnS
Audible 1012 10V Nine-voltalkalinebattery,supplied 1octaveper100mV@1kHz 32.752inches(874cm) 2lb(0.9kg) mAXImumAppLIeDINpuTVOLTAGe pITCH(VOLTAGeSeNSITIVITy) DImeNSIONS SHIppINGWeIGHT
Low-Pass Filter
A complete, ready-to-use instrument

LPF30 SPECIFICATIOnS
INpuTImpeDANCe GAIN BANDWIDTHFILTer SHArpNeSS OuTpuTVOLTAGerANGe mAX.INpuTVOLTAGe OuTpuTreSISTANCe LOWBATTeryINDICATOr pOWer BATTeryLIFe DImeNSIONS SHIppINGWeIGHT 1m 1,10 100Hzto30kHz(2poler/C) 40dB/decade 100HzBandwidth 30kHzBandwidth 8V 10V 100 LeDlightswhenapproximately60 hoursofbatteryliferemain. 2nine-voltalkalinebatteries,supplied About400hours 532inches(1385cm) 2lb(0.9kg) 10Vpp 30Vpp
equIVALeNTSHOrTeDINpuTNOISeATx10GAIN
upperfrequencybandlimitcanbesmoothlyvariedbetween100Hzand 30-kHzusingasingleknob.WpIsnewlow-passfilterissmall,con umes s littlepower,andcanbelocatedalmostanywhereinyourworkspace. Featuresswitch-selectablegainof1or10andlownoise.Anidealtool forfilteringananalogsignalbeforedigitalconversionbydataacquisition systems.
SYS-LPF30
Lo-passFilter
93
Choose the amplifier modules you need to measure nearly anything!

l Rack mountable and stackable l Ergonomic design l 8-Channel l Small footprint
Signal conditioning in the last decade has increasingly moved in the direction of the computer, because the software preserves the raw data and is highly reliable. Operations such as integration, differentiation, filtration and even waveform generation are now efficiently handled in software. On the other hand, however, the transduction of physical signals such as bio-potentials, force, temperature, pressure or ionic concentrations must be measured with an electronic amplifier. transducer outputs and the outputs from electrochemical free radical sensors. This platform simply focuses on the reliable transduction of the electronic signal and provides a convenient passage for the translation of real world signals to a computer for analysis. The system consists of an 8-channel, rack mountable frame that includes an ultra quiet, shielded power supply. All of the module outputs are routed to rear panel connectors. If you prefer, outputs may be routed internally to the inputs of other modules. The system has a small footprint and may be stacked to provide as many channels as you need.
8-Channel Enclosure
The SI-BMFA Power Frame is the foundation of the SI Heidelberg modular physiology suite. It incorporates a robust power supply that can accommodate up to eight physiology modules, which can be mixed or matched in any combination. Modules are quick and easy to install, thanks to an innovative and mechanically solid card rail system. Features l 8 channel slots l Backplane design includes provision for configurable communication between modules
SIH/WPIs physiology amplifier system focuses on this idea and provides a flexible electronic platform intended to process the transduction of physical signals, displacement
SI-BMFA
Power Frame Enclosure
94
Optical Transducer Amp

The SI-BAM21-LCB is designed specifically for use with the SI Heidelberg KG series force transducers. Also available in a single standalone enclosure (see page 6), either version provides an incredibly quiet, linear and stable transducer signal to your data recording system. Features l Rapid Auto Zeroing function with fine offset adjustment l Offset indicator LEDs l Multiple gain ranges with adjustable fine tuning for precise calibration l Digital interface for optional Anti-Oscillation module for use in isotonic studies
Bridge Amplifier
The SI-BRIDGE80 module is designed for use with standard bridge type transducers to measure pressure, force, or displacement. Features l Multiple gain ranges from 1X to 1000X plus an adjustable gain option l Defeatable offset adjustment control l Low pass filter down to 30 Hz l Operates in differential or single ended configuration
SI-BAM21-LCB
Optical Transducer Amplifier
SI-BRIDGE80
Bridge Amplifier
SI-BRIDGE80 SPECIFICATIONS SI-BAM21-LCB SPECIFICATIONS

Input Configuration Gain Input Offset Adjustment Output Impedance Power Output Range Current to voltage converter 1, 2, 5, 10 Optional factory setting: 10, 20, 50, 100 2.0 VDC 470 12 VDC provided by chassis 10 VDC Low Pass Filter Band (KHz) Input Impedance Power Amplification Input Leakage Current Voltage Offset Adjustment Amplifier Output Voltage Excitation Voltage Equivalent Noise Signal Input > 1012 Ohms 12 VDC provided by chassis 1, 10, 50, 100, 500, 1000 and Adjustable 0.1 pA at 25 C 50 mV (low); 100 mV (high) 4.4 V (10 mA max.) 10 V ( 5.0V) 100 mA max < 0.4 V RMS (2 V p-p) 0.110 Hz Gain >10 < 3 V RMS (15 V p-p) 0.1100 Hz Gain >10 0.03, 0.1, 0.3, 1, 5, 10, Wide Band R-C Butterworth 6 dB / Octave
95
Extracellular Bio-Amp
Anti-Oscillation Unit
The SI-AOSUB Anti Oscillation module operates in conjunction with the SI-BAM21-LCB module and the motor controller to actively cancel the force transducers natural harmonic resonance. This is critical when performing dynamic muscle contraction and release studies to ensure the integrity of the force signal from the tissue. Features l Adjustable amplitude and frequency of pulse generation to ping transducer resonant frequency l LED amplitude meter peaks when resonant frequency is generated
The SI-DAM800 is a general purpose extracellular bio-amplifier module with an optional remote head stage, useful for working with metal micro electrodes. Features l High and low pass filters l Multiple gain ranges from 10X to 10,000X l AC or DC coupling l Optional remote powered headstage
SI-DAM800 Extracellular Bio-Amplifier
SI-AOSUB Anti-Oscillation Module
SI-DAM800 SPECIFICATIONS
Power Input Impedance Input Leakage Current Max. DC Differential Signal Gain (AC or DC) CMMR Input Capacitance AC Mode Noise AC Mode Noise DC Mode Noise Bandwidth Filter Settings Output Connector Output voltage Output Impedance Calibrator Signal Position DC Current Source Gen. External Commands AC / DC Current Waveforms 12 VDC provided by chassis > 1012 common mode and differential 50 pA at 25 C typical 2.5 V 10, 100, 1000, 10000 100 dB @ 50/60 Hz 20 pF 0.4 V RMS (2 V p-p) 0.1100 Hz 2.6 V RMS (10 V p-p) 1 Hz10 KHz 7.5 V RMS (30 V p-p) 310 KHz Low Filter Frequency: 0.1, 1, 10, 300 Hz High Filter Frequency: 100 Hz, 1, 3, 10 KHz 3.5 mm MiniPhone connector 8V 470 10 Hz square wave 250 mV approx. 0 - 50 A variable 10V signal levels 50 A max. amplitude at 200 K
SI-AOSUB SPECIFICATIONS
Power Input Pulser Output Damping Frequency Range Output Range 12 VDC provided by chassis 10 VDC 0 10 VDC adjustable 0.1 Hz 4.0 KHz 0.1 Hz 2.0 KHz 10 VDC
96
Amperometric Amp
TheSI-TBR1000module incorporatesallthefeaturesofa TBr1025amperometricamplifierin acompactmoduleforuseintheSIBmFApowerframe.SeeTBR1025on page69orvisitwww.wpiinc.comfor detailedfeatures. Features l powersandamplifiestheredox currentsignalfromanyof WpIsamperometricbiosensors, includingnitricoxide,oxygen, hydrogenperoxide,hydrogen sulfide,andglucose. l Frontpanelmeterdisplaysredox currentfromthesensororvoltage bias(poisevoltage)appliedtothe sensor. l Builtintemperaturesensorinput
SI-TBR1000 SPECIFICATIOnS
Power ......................................................12 VDC, provided by chassis, <15 W Operating Temperature (ambient) ........0 - 50C (32 - 122F) Operating Humidity (ambient) ..............15 70% RH non-condensing Warm up Time .......................................<5 minutes Display Functions ..................................LCD readout, 4.5 digit Polarization Voltage (mV) Current input (nA, A) Controls ..................................................Current Input Range Polarization Voltage Analog Output Range ............................+/- 10 V (continuous) Analog Output Impedance ....................10 kohm Channel to Channel Isolation ................>10 Gohm Channel to Output Isolation ..................>10 Gohm Power Supply to AC Line Isolation ........>100 Mohm Analog Output Drift ...............................<10 pA/h Temperature Input Number of Channels .....................................1 Sensing Element............................................Platinum RTD, 1000 Ohm Range .........................................................0-100C Accuracy .........................................................+/- 1C Resolution......................................................0.1C Analog Output ...............................................31.25 mV/C (continuous)
SI-TBR1000 AmperametricAmplifier Includes temperature probe and one sensor of your choice. RECOMMEnDED ACCESSORIES SnAP50 SNApS-Nitroso-N-acetyl-D-penicillamine,50mgvial
Amperometric Input Number of Amperometric Channels ..............................4 Signal Bandwidth............................................................0-3 Hz Polarization Voltage (selectable via rotary switch) Nitric Oxide .......................................................865 mV Hydrogen Sulfide ..............................................150 mV Hydrogen Peroxide ...........................................450 mV Glucose ..............................................................600 mV Oxygen ..............................................................700 mV ADJ (user adjustable)........................................+/- 2500 mV Polarization Voltage Accuracy ........................................+/- 5 mV Polarization Voltage Display Resolution .......................+/- 1mV Current measurement Performance Range +/- 10 nA +/- 100 nA +/- 1 A +/- 10 A Analog Output 1 mV / 1 pA 1 mV / 10pA 1 mV / 100pA 1 mV / 1A Noise @ 3Hz * < 1 pA < 7 pA < 70 pA < 700 pA Noise @ 0.3 Hz * < 0.3 pA < 3 pA < 30 pA < 300 pA
See ProGuide Electrode Positioners, page 81.
See Sensors, pages 63-66.
*Instrument performance is measured as the (max-min) over 20 seconds period with open input. Typical values are given at 3 Hz and 0.3 Hz bandwidth. Typical sensor performance with TBR4100 ISO-NOPF100 noise .......................................................0.2 nM NO (<2 pA)** **Sensor noise is measured as the (max-min) over a 20 seconds period with the sensor immersed in 0.1 M CuCl2 solution.
97
These transducers are designed for general use in data acquisition and recording instruments and systems. They are supplied with 5-ft cables terminating in an 8-pin DIN connector which readily plugs into Transbridge, a 4-channel analog signal conditioner and Bridge8 .
PnEU
LUME
Ticonderoga #2 word processor not included.
LIGHT
Whenpoweredby+2voltsormore,Lumeprovidesanoutputvoltage sig alpro orion ltoinci entlightoverthevisibletonearinfrared n p t a d spectrum.Containngaminauresiliconphoo iode,theslenderstainless i i t t d steelprobecanbeeasilymountedtodoawideva i tyofusefuljobs, re suchasmonorngtrans ited,reflectedoriner upt dlightbeams.Optic it i m t t r e fi ersupto2mmdi m ermaybein ert dintothetip. b a et s e LUME 3491 photocell probeextensionCable Caution: Extension cable may diminish signal-to-noise ratio.
PRESSURE
pNeutransducersareac u atedifer nialpressuremea urngde ic sfor c r f e t s i v e noncorrosivegas sandgaseousfluids.Lin arandre eat ble,withlittle e e p a tem er uredrift,theycon erthy ro tatcpressurelevelstosta leand p at v d s i b proportionalvoltagesig als. n PnEU01 pressureSensor,1psig PnEU05 pressureSensor,5psig PnEU15 pressureSensor,15psig 3491 probeextensionCable Caution: Extension cable may diminish signal-to-noise ratio.
LUME SPECIFICATIOnS
pOSITIVeSuppLyVOLTAGe NeGATIVeSuppLyVOLTAGe LIGHTVOLTAGe DArKOuTpuTVOLTAGe ANGuLArFIeLDOFVIeW SpeCTrALrANGe prOBe +50V,maximum -20V,maximum 50mVminimum (per5mW/cm2with2870Ksource) 100Vmax.(+5Vsupply) 12degreesoffaxis 400-1200nm(peakat860nm) 5mmdiam.x100mm, stainlesssteel
PnEU01, PnEU05, PnEU15 SPECI FICATIOnS

WOrKINGpreSSure pNeu01 pNeu05 pNeu15 mAXImumpreSSure 0-1psi,differential(52mmHg) 0-5psi,differential(260mmHg) 0-15psi,differential(780mmHg) 3xFullScalepressure
TrANSDuCerSeNSITIVITy pNeu01:18mV,FullScale(10%at10V) pNeu05:60mV,FullScale(10%at10V) pNeu15:90mV,FullScale(10%at10V) SuppLyVOLTAGe INpuT&OuTpuTreSISTANCe LINeArITyerrOr 10V(5V) 4k,nominal 0.5%maximum
98
FORT
5000
FORT
1000
FORCE TRAnSDUCERS
Theserigid-leverforcetransducerstransformappliedforceintopro orp tion lvoltage.usingbalancedstraingauges,FOrTtransducersproduce a lin aroutputvolt gevs.appliedforceinputwithverylittledeflection. e a Touse,clampthehandleoftheFOrTtransducerinahorizontal positionandapplytheforcestobemea uredtoarivetorhookmounted s intheholeattheendoftheflatsensingleaf. FORT100 FORT250 FORT1000 FORT5000 ForceTransducer(100g) ForceTransducer(250g) ForceTransducer(1000g) ForceTransducer(5000g)
FORT
250
FORT
100
FORT SPECIFICATIOnS
FORT100 FOrCerANGeS,FuLLSCALe OuTpuTSeNSITIVITy(10%) INpuT&OuTpuTreSISTANCe reSOLuTION reSONANTFrequeNCy LINeArITyerrOr mAX.OperATINGVOLTAGe mAXImumAppLIeDFOrCe DrIFT DImeNSIONS WeIGHT(excludingcable) 100grams 7V/V/g 350 0.01%offullscaleforce 300Hz Lessthan0.1%offullscale 10VACorDC 3ratedfullscaleforce thermallycompensated 0.3inchdiam4in. (7.6mmdiam10.2mm) 0.3oz(8g) FORT250 250grams 3V/V/g 350 0.01%offullscaleforce 300Hz Lessthan0.1%offullscale 10VACorDC 3ratedfullscaleforce thermallycompensated 0.3inchdiam4in. (7.6mmdiam10.2mm) 0.3oz(8g) FORT1000 1000grams 0.84V/V/g 350 0.01%offullscaleforce 300Hz Lessthan0.1%offullscale 10VACorDC 3ratedfullscaleforce thermallycompensated 0.3inchdiam4in. (7.6mmdiam10.2mm) 0.3oz(8g) FORT5000 5000grams 0.38V/V/g 350 0.1%offullscaleforce 60Hz Lessthan0.1%offullscale 10VACorDC 3ratedfullscaleforce thermallycompensated 0.3inchdiam4in. (7.6mmdiam10.2mm) 0.3oz(8g)
10g & 25 Force Transducers

FORT10g FOrCerANGe,FuLLSCALe OuTpuTSeNSITIVITy INpuT&OuTpuTreSISTANCe reSOLuTION reSONANTFrequeNCy LINeArITyerrOr mAXImumOperATINGVOLTAGe mAXImumAppLIeDFOrCe DrIFT DImeNSIONS WeIGHT 0-10grams 10mV/gm,nominal 1500 <1mg 450Hz <0.2%offullscale 10VDC(-5V~+5Vor0~10V) 2ratedfullscaleforce <30mg/hr 40x22x19mm Handle88mm 100gram FORT25 0-25grams 3mV/gm,nominal 1500 <2mg 450Hz <0.2%offullscale 10VDC(-5V~+5Vor0~10V) 3ratedfullscaleforce <50mg/hr 40x22x19mm Handle109mm 100gram
These10-gramand25-gramforce transducersarereliabletoolsforhigh precisionforcemeasurement.usingbalanced semiconductorstraingauges,bothproduce linearoutputvoltagevs.appliedforceinput withverylittledeflection.Therigidleverforce transducertransformstheappliedforceintoa proportionalvoltage.Featuringatemperaturecompensatedfull-bridgeconfigurationwith fourhighsensitivitysemiconductorstrain gauges.Thesetransducershavebroad dynamicmeasuringrangeandveryhigh sensitivity. Touse,clampthehandleoftheFOrT10 orFOrT25transducerinahorizontal positionandapplytheforcestobemeasured toarivetorhookmountedintheholeatthe endoftheflatsensingleaf.
99
Metal Microelectrodes
EXPOSED TIP DIMEnSIOnS
nominal Impedance 0.1meg 0.5meg 1.0meg 2.0meg 5.0meg (nominal) Tungsten 100 55 30 12 5 Elgiloy 120 66 36 15 6 Platinum Iridium 60 18 10 6 3 Pure Iridium 45 14 10 5 2.5
Superior microelectrodes for outstanding extracellular recording tungsten, iridium, platinum-iridium, and Elgiloy
Metal
Exposed tip 25:1 taper
Parylene-C*
Kapton* tubing,indicatedbyKTin thepartnumber,extendsfromthe con ecortowithin5mmofthetip, n t pro idngstiffnessandadditional v i in uaiontotheelectrodeshaft. s l t Kapton-cladelecrodesarerec mt o mend dwhentheelectrodeistobe e insertedthroughacannulaforextra deeppen raion. et t
Parylene-C Insulation
Gold-plated connector pin
Parylene coating
2-, 3-, 5-inch lengths
Gold-plated connector pins Shrink tubing
Polyimide tubing 0.014" O.D. for 0.005" O.D. WE
Glue
Exposed tips
Type A
Note: Electrode diagrams not shown to scale.
Gold-plated connector pin Polyimide tubing 0.016" O.D. Glue seal 3 Parylene
Gold-plated connector pin
3" and 5" total length
5 mm typical
Tip separation 90 or 125m 15%
Type B
Polyimide tubing Glue 5 mm
29 gauge stainless steel tubing
Type C
29 gauge stainless steel tubing 3" total length
0.003" IR
12"
0.003" Iridium or 0.005" Tungsten electrode, Parylene-coated
5 mm typical
Type D
core conductor exposed stainless steel surface stainless steel tubing Polyimide tubing
Concentric Bipolar Electrodes

Excellent for shielded macro recording as well as evoked potentials especially well suited for bipolar stimulation
Thetungstenelectrodeissharpenedtoapointandis75micronsin diameter.Theouterstainlesssteelconductorisinsulatedwithpolyimide tubingtowithin0.2mmoftheendofthestainlesssteeltube.Also availablewithouttheouterpolyimideinsulation.
Heat Treated Tip (above)isidealfor penetratingtough membranes(not recommended forchronic implantation).Thisprocessisperformedusingamicroforgeinwhichthe heatingelementispositionedincloseproximitytothetipinordertomeltthe parylene-Cdistaltotheexposedmetal.Itprovidesasmoothtransitionand producesbetteradherenceoftheparylene-Ctothemetal. Tohaveyourelectrodesheattreated,justaddthesuffixHtoanyoftheKT numbersonthefacingpage.Costofthetreatmentis $10perpackageof10 electrodes($20perpackageforTypeB).
* Parylene is a trade mark of Union Carbide. Kapton is a trade mark of DuPont. Elgiloy is a trade mark of Elgiloy Ltd.
x shrink tubing L=3" or 5" (2" for PTM)
Y <0.2 mm Y
Insulated metal conductor with exposed concentric surface

.389" (9.88 mm) .031" (0.79 mm) pin #5482 .404" (10.26 mm)
Gold-plated pins (#5482) and sockets (#5483) may be attached to 24-, 26-, or 28-gauge wire.
socket #5483
0.51 mm ID
#5470 (mount in M3301EH holder, see page 200)

Electrode plugged into adapter #5470
ACCESSORIES 300102 micromanipulatorholder,4in.,2mmto0.031socket 5468 2mmreceptacleto0.031-inchjack(forOmega-Tipz) 5469 Adaptsminibananaplug(DAm80)to0.031-inch receptacle(metalmicroelectrode) 5470 0.031-inchjack,28ga.wire,12inch(pkgof4) 5482* pins,0.031-inch,gold-plated(pkgof50) 5483* Sockets,0.031-inchgold-plated(pkgof50)
*Gold-plated pins (#5482) and sockets (#5483) may be attached to 24-, 26-, or 28-gauge wire.
#5468
#300102
#5469
100
Introductory Assortments
Each of these assortment kits includes electrodes with different impedance within each style. Use an assortment kit to determine which electrode you need for your experiment. Ten electrodes per box, no mixing.
Item TM31/33Axx TM31/33AxxKT TM33BxxKT TST33AxKT Contains the following electrode impedances by quantity (pkg of 10) Tm33A05(2),Tm33A10(3),Tm33A20(3),Tm31A50(2) Tm33A05KT(2),Tm33A10KT(3),Tm33A20KT(3),Tm31A50KT(2) Tm33B01KT(3),Tm33B05KT(2),Tm33B10KT(3),Tm33B20KT(2) TST33A05KT(3),TST33A10KT(4),TST33A20KT(3) Price 178 US$ 239 US$ 239 US$ 497
US$
Concentric Electrodes*
Item Metal Core Length Imp 10-15K 10-15K 10-15K 10K 200K Tungsten 3 (76) TM33CCNON TM33CCINS Tungsten 3 (76) TM53CCINS Tungsten 5 (127) PTM23CC001NON Pt/Ir 2 (51) PTM3CC02INS Pt/Ir NS fine 3 (76) *All have a stainless steel outer shaft Item Length Insul. Thick. Probe Outer Diameter (total) 0.013 uninsulated (325 m) 0.016 insulated (400 m) 0.018 insulated (450 m) 0.020 uninsulated (525 m) 0.013 insulated (325 m) Tip Diam. 3-4 3-4 3-4 3-4 2-4 Core diam. .003 (76 m) 003 (76 m) 005 (127 m) 0.01 (254 m) 0.002 (50.8 m) Y dim. 0.4 mm 0.4 mm 0.4 mm 0.4 mm .25 mm X dim. w/ polyimide .005 (127 m) .005 (127 m) .008 (203 m) .014 (356 m) .004 (114 m) Price (pkg of 5) US$ 265 US$ 288 US$ 322 US$ 380 US$ 403
Selection Guide for Metal Electrodes

nominal Tip Diam. Typical Use Impedance ( 20%) Package of 10 0.254mm 1.0m 1-2 Singleandmultiunitrecording,stimulation,Chronicimplants 0.127mm 0.216mm 0.127mm 0.085mm 0.127mm 0.127mm 0.216mm 0.127mm 0.254mm 0.356mm 0.254mm 0.356mm 0.254mm 0.356mm 0.254mm 0.085mm 0.085mm 0.229mm 0.356mm 0.229mm 0.229mm 0.356mm 0.356mm 0.356mm 0.216mm 0.356mm 0.180mm 0.106mm 0.106mm 0.180mm 0.106mm 0.180mm 0.106mm 0.180mm 0.180mm 0.61mm 0.61mm 0.406mm 1.0m 1.0m 2.0m 0.5m 0.5m 1.0m 1.0m 2.0m 0.1m 0.1m 0.5m 0.5m 1.0m 1.0m 2.0m 0.5m 1.0m 0.5m 1.0m 7.0m 12.0m 0.5m 1.0m 2.0m 0.5m 1.0m 0.1m 1.0m 1.5m 2.0m 2.5m 2.5m 3.0m 3.0m 5.0m 1.0m 2.0m 1.0m 1 1 1 1 1 1 1 1 1-2 1-2 1-2 1-2 1-2 1-2 1-2 1 1 1-2 1-2 1-2 1-2 1 1 1 1 1-2 2-3 1-2 1-2 1-2 1-2 1-2 1-2 1-2 1-2 1-2 1-2 1 Package of 10 multiunitandsingleunitrecordingandmicrostimulation multiunitandsingleunitrecordingandmicrostimulation multiunitandsingleunitrecordingandmicrostimulation recordingfromsmalltightlypackedcells multiunitandsingleunitrecordingandmicrostimulation multiunitandsingleunitrecordingandmicrostimulation multiunitandsingleunitrecordingandmicrostimulation multiunitandsingleunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleandmultiunitrecordingandmicrostimulation Singleunitandstim/chronicuse Singleunitandstim/chronicuse Package of 10 recordingandStimulating(prussianbluestaining) recordingandStimulating(prussianbluestaining) recordingandStimulating(prussianbluestaining) recordingandStimulating(prussianbluestaining) Package of 10 Stereotrode/Bipolar,differentialmeasurements Stereotrode/Bipolar,differentialmeasurements Stereotrode/Bipolar,differentialmeasurements Stereotrode/Bipolar,differentialmeas.extrafine(75mseparation) Stereotrode/Bipolar,differentialmeasurements Package of 5 multiunit&erprecording&stimulation Singleandmultiunitrecordingandstimulation Singleandmultiunitrecordingandstimulation Greaterselectivity&microstimulation Greaterselectivity-smallcells Greaterselectivity-smallcells Greaterselectivity-smallcells Greaterselectivity-smallcells Greaterselectivity-smallcells Package of 5 Deepbrainstudies Deepbrainstudies Package of 5 Deepbrainstudies Shaft Diam. Price
Platinum Iridium Profile A PTM23B10 51mm 3 Tungsten Profile A TM31A10 76mm TM31A10KT 76mm TM31A20 76mm TM31C05 76mm TM33A05 76mm TM33A10 76mm TM33A10KT 76mm TM33A20 76mm TM33B01 76mm TM33B01KT 76mm TM33B05 76mm TM33B05KT 76mm TM33B10 76mm TM33B10KT 76mm TM33B20 76mm TM33C05 76mm TM33C10 76mm Elgiloy/Stainless Profile SSM33A05 76mm SSM33A20KT 76mm SSM33A70 76mm SSM33A120 76mm Tungsten Profile B TST33A05KT 76mm TST33A10KT 76mm TST33A20KT 76mm TST33C05KT 76mm TST53A10KT 127mm Pure Iridium IRM23E01KT IRM23E10 IRM23E15 IRM23E20KT IRM23E25 IRM23E25KT IRM23E30 IRM23E30KT IRM23E50KT Profile C 50mm 50mm 50mm 50mm 50mm 50mm 50mm 50mm 50mm 1 1 1 1 3 3 3 3 3 3 3 3 3 3 3 1 1 A 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3
US$
382
185 252 185 US$ 185 US$ 178 US$ 178 US$ 239 US$ 178 US$ 178 US$ 239 US$ 178 US$ 239 US$ 178 US$ 239 US$ 178 US$ 185 US$ 185
US$ US$ US$
161 240 US$ 185 US$ 185

US$ US$
499 499 US$ 499 US$ 516 US$ 575

US$ US$
522 468 US$ 468 US$ 522 US$ 468 US$ 522 US$ 468 US$ 522 US$ 522
US$ US$ US$ US$
Platinum Iridium Profile D PTM123B10KT305mm 3 PTM123B20KT305mm 3 Tungsten Profile D TM123A10KT 305mm 3
490 490 427
US$
Additional metal microelectrodes available on website Ordering: www.wpiinc.com AddtheBsuffixwherebluntelectrodesaredesired.(Forexample,anIrm123A10KTorderedasabluntwillbeIrm123A10KTB.)

eligoySteel*Cobalt/chromium/nickelalloy.ThekTsuffixreferstoKaptoncladding. Allmetalmicroelectrodesareavailableincustomlengths,bluntorheattreaded(extracharge). AddtheHsuffixwhereheattreatedelectrodesaredesired.(Forexample,anIrm123A10KTorderedaswithheattreatmentwillbeIrm123A10KTH.)
101
Window Discriminator
l l l l Monitor signals and discriminator levels simultaneously at the multiplex output Window height independent of lower discriminator level setting Logic level output pulses, TTL compatible Output pulses indicated by LED display
Thisamplitudediscriminatorisdesignedforaudioandsub-audiosignals suchasextracellularnerveactionpotentials.Foreverywaveformpeak thatappearswithinthewindowaperturesetbytheuser,apulseis generatedattheWithinWindowoutput.Signalsthatexceedtheupper levelofthewindowproduceapulseattheAboveWindowoutput.A visualindicationofthepulsesisprovidedateachoutputbytheLeD display.Boththeinputsignalandthewindowaperturesettingsarevisible atthemultiplexportasshownbelowintheuppertrace.Byviewingthe inputsignalaswellasthewindowdiscriminatorlevelsatthemultiplex portprovidesaconvenientvisualizationandeaseinsettingupan experiment.model121smultiplexcircuitrysamplesinputsignalsand windowlevelsona70%/30%basisrespectively,minimizinglossof signalinformation.TheLowerLevelcontrolsetsthelowerdiscrimination level,andtheWindowAperturecontrolsetstheupperwindowlevelwith respecttothelowerlevelsetting.Thismeansthatchangingthelower levelsettinghasnoeffectonthewindowapertureexcepttodisplacethe windowupordown.Itisimpossibletosetthelowerlevelhigherthanthe upperlevel,afeatureuniquetomodel121.Thepulsesfromeitheroutput
(WithinWindoworAboveWindow)aregeneratedbythefallingedgeof theanalyzedsignalasitcrossesthepresetlevels.Becausethelogiccircuit isnottimedependent,model121canbeusedtoanalyzesignalsofany duration.Ten-turncontrolswithdialindicatorsallowprecisesettingand directreadingofthewindowlevels. enclosureincludesatiltstandforbenchoperation.rackmounting hardwareisoptional.
WInDOW DISCRIMInATOR SPECIFICATIOnS

INpuTImpeDANCe mAXImumFrequeNCy mINImumpuLSeWIDTH INpuTpOLArITy mAXImumINpuTVOLTAGe WINDOWrANGeupper, LOWerLeVeLS DISCrImINATOrreSOLuTION DISCrImINATOrACCurACy WITHIN&ABOVeWINDOWOuTpuT 100KOhms Approximately10KHz 80s positiveornegativeswitchable upto50V(peak-to-peak)inthree ranges:0-0.5V,0-5V,0-50V upto10Vinthreeranges: 0-0.1V,0-1V,and0-10V 0.1%offullscale(selectedrange) 2% rectangularpulses,approx.3.0V amplitude(TTLcompatible),adjustable pulsewidthfrom0.1to1.0ms.Output impedancelessthan500Ohms.LeD indicatespresenceofoutputpulse. Cyclelengthnominally37s. Signalontime:26s(70%) Levelsontime:11s(30%) Outputimpedancelessthan100 ~120/240V,50/60Hz,12VA 17x3.5x9.5in.(43.2x8.9x24cm) 11lb(5kg)
MULTIPLEX OUTPUTS
Upper Level Lower Level Input Signal Window Output
muLTIpLeXOuTpuT pOWerrequIremeNTS DImeNSIONS SHIppINGWeIGHT
Above Window Output
The diagram above shows the multiplex signal output with the window parameters displayed on the input signal. A within pulse occurs at the lower level crossing point after the input signal is measured within the boundaries of the settings and an above pulse is generated for those signals going above the upper level setting.
SYS-121 2932 2851 500184 500257 500258 500259
WindowDiscriminator rackmountKit,3.5-in.High BNC-to-BNCcable,52 BNC-to-BNCcable,10ft BNC-to-BNCcable,6inch15cm BNC-to-BNCcable,12inch30cm BNC-to-BNCcable,18inch46cm
102
mega-Tip-Z
Millivolt and megohm meter measures impedance of metal or glass capillary microelectrodes
Omega-Tip-Zwascreatedespeciallyformeasuringimpedancein etchedtung ten,platinum-iridium*andsteelmicroelectrodes,aswellas s electrolyte-filledmicropipettes.ThemetersACimpedance-measuring circuitisunaffectedbyelectrodeoffsetortipjunctionpotentials.The gold-platedminiatureprobeletsyouconvenientlymonitormicroelectrodeimpedanceinelectrolytes,andanelectrodetipcleaningfeature letsyouremovebuildupquickly.Omega-Tip-zcanalsomeasureDC electrodetippotentialsupto2000millivolts.Theinstrumentoperatesfor hundredsofhourswithoutbatteryfailure. nOTE: metalmicroelectrodeswhichhavebeenprecalibratedat1kHz shouldbebaselinedforusewithOmega-Tip-z. *See Metal Microelectrodes, page 100.
OMEGA-TIP-Z SPECIFICATIOnS
INpuTreSISTANCe INpuTLeAKAGeCurreNT mAX.INpuTVOLTAGeSWING VOLTmeTer range Accuracy resolution OHmmeTer range measurement resolution Accuracy prOBe prOBeHANDLe prOBeCABLe mAINHOuSING pOWer SHIppINGWeIGHT 1012,typical 1pA,typical 2V 0to2000mVDC 0.1%ofreading,1leastsignificantdigit 1mV(3.5digits) 0to20m@500Hz(metal) 0to200mor0to2000m@12.5Hz(glass) 10nAand1nA(glass);10nA(metal) 10K 20% 1.2cmdiameter3.2cmlong 4.7mmdiameter8.9cmlong 1.5m 742in.(18105cm) 6AA1.5-voltalkalinecells,supplied 4lb(1.8kg)
SYS-OMEGAZ 711P 5468
mega-Tip-zwithprobe&Holder replacementprobe Adaptertoconnectmetalmicroelectrodesto probe,2mmsocketto.031in.receptacle
OPTIOnAL ACCESSORIES nOVA NovaflexFiberOpticIlluminator(115v,60Hz) nOVA-Z NovaflexFiberOpticIlluminator(230v,80Hz) 500186 BifurcatedLightGuidewithlenses nOVA-186 NovaflexIlluminatorandbifurcatedlightguide
EP05
0.5 mm dia. 2 cm long Ag Wire 40 mm long
EP08
Ag/AgCl Half-Cells
New,improvedsinteredpelletswithlowerresistanceandhighstrength. Stableandwellbalancedinthepresenceofcurrent,thesesmalland inexpensivehalf-cellsareeasytoworkwithasbathelectrodes. EP05 EP08 EP1 EP2 EP4 EP8 EP12 3578 Ag/AgClelectrode0.5mmdiamx20mm Ag/AgClelectrode0.8mmdiamx20mm Ag/AgClelectrode1.0mmdiamx2.5mm Ag/AgClelectrode2.0mmdiamx4mm Ag/AgClelectrode4.0mmdiamx1mm Ag/AgClelectrode8.0mmdiamx1mm Ag/AgClelectrode12.0mmdiamx1mm AdapterCableforAg/AgClpellets
1 mm dia. 3 mm long Ag Wire 70 mm long
EP1
EP2
2 mm dia. 4 mm long Ag Wire 5 cm long
EP4
4 mm dia. 1 mm thick Ag wire 12 mm long
EP8
8 mm dia. 1 mm thick
EP12
Ag wire 12 mm long
Ag wire 12 mm long
103
Measure hydrostatic pressure in small vessels and oocytes
Model 900A Micropressure System AMPLIFIERS, ELECTROMETERS

l Simultaneously measures electric potential and pressure l Preset internal microelectrode pressure l Air-filled system no debubbling
model900Aisdesignedtomeasurehydrostatic pres ureinsmallvesselsandcells.pressureranges s of-200to+400mmHgcanbemeasuredwith stabilityandaccuracy.Thesystemssensingelement isanelectrolyte-filledglassmicroelectrodewithatip di m errangeof2to5microns. a et pressuresofelectrolytesolutionsaremeasured bymaintainingasaltconcentrationgradientatthe tipofthesensingelectrodeindynamicequilibrium byapplyinganequalairpressureinsidethemi roc elecrode.Thepressurereadingappearsonthefront t pan ldisplayandviatheBNCrecorderoutput. e Becausethepiezoelectricpressurecontrolleruses externalpressureandvacuumsources,pressures low rthan-200togreaterthan+400mmHgcan e bequicklyandaccuratelymeasuredatthemi roc elecrodetip. t Theopenpressurechamberisalmostimmune tovibrationsandmovementsand,unlesstheyare exremeylarge,theopensystemisunaffectedby t l leaks.Thepressurecontrolleriscontainedinasmall, light eightenclosurethatcaneasilybemounted w nearthemicropipettetohelpreducedeadspace. Itin ludesanamplifier,apiezoelectricvalveand c apres uretransducer.Theusersuppliesfluid-filled s mi ro lecrodes,+500mmHgpressuresourceand c e t a-300mmHgvacuumsource. measuringelectricpotentialandpressuresi ul am t neousyletsyouusepotentialrecordingasanad il d tion lcueforlocatingtheelectrodewherevis ily a ib it islimited,orcorrelatepressureandpotentialwhen thisismeaningful. TheuniqueSetpressuremodeletsyoupreset theinternalpressureofthemicroelectrodeselect apositivepressureforflushingthetip,oranegative pressureforpullingsolutionintothetip.Bydis onc nectngthemicroelectrodeholderandattachingthe i tubingtoamanometer,youcancheckthecal raib tionagainstastandard. Abuilt-inalarmsoundstoindicatemaximum pres ure.Thealarmalsosoundswhenthetipis s blockedorelectricalcontinuityisbro en(e.g.,the k mi ro lecrodecomesoutofthesouion,toolittle c e t l t fillingsouiontocovertheAg/AgClpellet,dis onl t c nect dgroundreference,etc.). e Thepiezoelectricpres urecontrollerregulates s iner alpipettepressurebyconrolingairflowinto t n t l andoutofasmallpressurecham er.Avacuum b sourceiscon ect dontheoutletsideofthechamn e ber,andapi zo lecricvalvemetersairenerng e e t t i thepres urzedcham er.There id lvol meof s i b s ua u thepres urecham erincludesthemi ropi ette,the s b c p con ectngtubngandthepres uretrans uc ron n i i s d e theoutletsideofthepiezo lecricvalve.The900A e t ac u ateyconrolsandaduststhepres ureinthe c r l t j s cham ertomatchpres uresap liedexer alyto b s p t n l themi ro lecrodetip. c e t Theresponsetimeofthepiezoelectricvalveis 0.5msfromfullyclosedtofullyopen.Overallsystemresponsetimede endslargeyontheamount p l ofresidualvol meinthetubng.Whenthisvolume u i issmall,thesystemre pondsveryrapdy(typically s i l 10mili ec nds). ls o Thelightweightpres urecontrollerpodmaybe s mountedclosetothemi ro lecrodeusingsmallc e t boretubing,tomin izesystemdeadspace. im Microelectrode holders MEH6RF and MEH6SF for 1.0 mm O.D. capillary glass included. (1.2, 1.5 and 2.0 mm also available please specify when ordering.)
SYS-900A micropressureSystem System price includes a one-day technical training session at WPI in Sarasota, Florida. Specify line voltage OPTIOnAL ACCESSORIES 900AP replacementprobe CAL900A pressureCalibrationChamber 3491 probeextensionCable 2933 rackmountKit 5332 replacementLiquidTrap MEH6RF micropipetteHolder(1.0,1.2,1.5or2.0mmSpecifyO.D.) MEH6SF micropipetteHolder(1.0,1.2,1.5or2.0mmSpecifyO.D.) TIPTW900A prepulledmicropipettefor900A(1mmthin-wall,2Tip)(pkgof10) 900APP replacementpressurepod SYS-PM015D pressuremanometer(15psi)
104
4-Channel Transducer Amplifier
Transbridge(TBM4M)isa four-channelanalogtransducer manifold,specificallydesigned toamplifyoutputvoltage signalsfrompressure,force, displacement,andtemperature transducersaswellasawide varietyofothersignalsources. Analogoutputsignalsare availablefromeachchannel forinputtoadataacquisition systemfordigitalsignal processinginacomputer. eachchannelcontainsa regulated10-voltpowersupply (+5and-5voltswithrespect tosignalground)toprovide DCpowertotransducers,and aprecisiondifferentialamplifierwithselectablevoltageamplificationand variablepositionadjustmentcontrol. TransducerscanbeconnectedtoTransbridgeviaanyofthe8-pin connectorsonthefrontpanel.Fourspare8-pinDINplugsare providedwitheachinstrumenttoallowyoutorewirecablesofother manufacturerstransducersandconnectthemtoTransbridge.each TransbridgechannelmaybeusedineitherFullBridgeortheHalfBridge modeindependently.Fortransducertypesotherthanresistivebridges, suchasactivetransistorcircuits,magnetic,photocellorpiezoelectric devices,theinstrumentsdifferentialamplifiersmaystillbeused effectivelyforsignalamplificationindifferential(fullbridge)andsingleended(halfbridge)modes.SeeWpIscompletelineofTrANSDuCerSfor physiologicalmeasurements.
FORT100 PNEU FORT100 Transducers not included. See WPIs complete line of transducers for physiological measurement.
TRAnSBRIDGE SPECIFICATIOnS
CHANNeLS VOLTAGeAmpLIFICATION VOLTAGeOFFSeTADjuSTmeNT NOISe LINeArITy OuTpuTVOLTAGeSWING mAXImumOuTpuTCurreNT INpuTImpeDANCe,eACHINpuT TrANSDuCereXCITATION BANDWIDTH,SmALLSIGNAL DImeNSIONS SHIppINGWeIGHT 4 x1,x10,x100,x1000 >50mV .4uVp-p(0.1to10Hz,G=100) +/-.001%ofFSrG=1; +/-.01%ofFSr,G-=1000 10V 2mA 1010ohms 10VDC(5V)approx. 1mHz(x1),80KHz(x10), 10KHz(x100),1.0KHz(x1000) 8.5x5.12x10in.(21.6x13x25.44cm) 11lb(5kg)
TRAnSDUCERS PnEU01 pressureSensor,1psig PnEU05 pressureSensor,5psig PnEU15 pressureSensor,15psig LUME photocell FORT10-100ForceTransducer,Dualrange(10gand100g) FORT10g ForceTransducer(10g) FORT25 ForceTransducer(25g) FORT100 ForceTransducer(100g) FORT250 ForceTransducer(250g) FORT1000 ForceTransducer(1000g) FORT5000 ForceTransducer(5000g) 3491 probeextensionCable Caution: Extension cable may diminish signal-to-noise ratio.
SYS-TBM4M
TransbridgeTransducerAmplifier Specify line voltage OPTIOnAL ACCESSORIES 13024 SinglerackmountKit 13025 DualrackmountKit 500184 BNC-to-BNCcable,10ft 3161 8-pinDINplug 3718 packageof4,8-pinDIN(startupkit) See Transducers, pages 98-99
105
Feature
DlS100 Biphasic, Digital Analog Modeling
Input
Digital from DS8000
Output
0-100 V 1 A to 10 mA
COmpatIble StImulatOr:
0
8 DS
00
a320 SIU/built-in stimulator TTL 0-100 V 1 A to 10 mA
8 DS
00
A3
00
A3
10
a365 Mono/Biphasic TTL 100 V 1 A to 10 mA
8 DS
00
0 A3
00
A3
10
STIMULATORS, ISOLATORS
a385 High Current TTL 36 V 10 A to 100 mA
8 DS
00
0 A3
00
A3
10
a395 Analog Analog 10 volts 70 V 1 A to 10 mA
8 DS
00
0 A3
00
A3
10
DuO 773 Intracellular Amplifier Analog 0-1 volt 500 nA
8 DS
00
0 A3
00
A3
10
106
A310 Accupulser
Stimulus Isolator (A360)
Optional footswitch #3259
Combining the accuracy of digital electronics with the convenience of analog controls
A pulse generator/stimulator combining the reproducibility and accuracy of digital electronics with the fine resolution and continuous adjustment possible with analog circuitry. All timing parameters are entered with tenturn readable potentiometers and six-position range switches. Outputs are accurate to within 1% of the set value. pulses can be created in continuous run, single-shot, or train/burst modes. Duration of the train/burst is easily controlled using the onboard envelope generator or by using either of two external gating inputs. Used in conjunction with the A360, A365, A385, or A395, bipolar pulses or trains may be easily produced. Output stimulus can be fed through the Duo 773 for iontophoresis. Footswitch allows hands-free operation. three separate outputs are available on the front panel. A Monitor output provides 10-15 V signals (up to 50 mA) for viewing the output on an oscilloscope or for controlling other devices. The stimulators signal, simultaneously available at the Isolator output, is sufficient to drive any WPI A300 Series stimulus isolator (A360, A365, or A385) and is also TTL and CMOS compatible. The Variable output can provide signals varying between 10 V with a resolution of 1 mV. Separate variable outputs are provided for positive and negative signals. SYS-A310 Accupulser Signal Generator Specify line voltage OPTIONAL ACCESSORIES 3259 Footswitch for A310 2933 Rack Mount Kit, 514 in. high
A310 ACCUPULSER SPECIFICATIONS

tImInG parameterS EVENT INTERVAL EVENT DELAY PULSE WIDTH TRAIN DURATION (ENVELOPE) PULSE INTERVAL OutputS SYNC MONITOR ISOLATOR VARIABLE (Pos or Neg) PULSED/DC Range Resolution 5 s, TTL, and 5 V CMOS compatible, 20 mA max. 10-15 V, 50 mA max. TTL & 5 V CMOS compatible, 20mA max. LOW RANGE 0 to 1 V 1 mV HIGH RANGE 0 to 10 V 10 mV 100 s to1000 s* 10 s to 100 s * 10 s to 100 s * 100 s to 1000 s* 20 s to 100 s*
NOISE Pulsed at 100 kHz bandwidth <500 V DC Wide Band <500 V OUTPUT IMPEDANCE InputS EXTERNAL SYNC EXTERNAL GATE pOWer DImenSIOnS SHIppInG WeIGHt Accepts 1-s minimum pulses TTL, CMOS compatible Accepts 1-s pulse to continuous TTL, CMOS compatible 95-130 V or 190-260 V, switch selectable single phase, 50/60 Hz 17 x 5.25 x 10 in. (43 x 13 x 25 cm) 14 lb (6.4 kg) <1
*Continuously variable in six ranges. All accuracies better than 1% of set value. 50kHz maximum pulse frequency.
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments tel: 941-371-1003 Fax: 941-377-5428 e-mail: sales@wpiinc.com Internet: www.wpiinc.com
107
A300 Pulsemaster Multi-Channel Stimulator
An integrated five-channel pulse generator/stimulator including one inter val generator, five pulse or train channels, two mixer channels and one very quiet variable voltage output stage
The Pulsemaster (Model A300) is WPIs third generation, multichannel, pulse/train generator/stimulator that combines the superb accuracy of digital electronics with the you-see-what-you-get displays only available on single-channel products. In one compact rack mountable enclosure, the Pulsemaster contains an event interval generator, five pulse train channels, two mixing channels and a very quiet variable voltage output channel. System timing is accurate to 100 ppm; output timing is continuously variable in 0.1% of full scale increments over a range of eight orders of magnitude. Bright, threedigit LED displays continuously and simultaneously show all the variable timing parameters. The Pulsemaster is designed for ease of use and flexibility. Each channel can be operated synchronized with the onboard event interval generator, triggered manually from any other channel or external source, and as an independent asynchronous pulse generator. Except for the external source, all channel interconnections are accomplished on the panel, without the use of cables. The output from each channel is compatible with standard digital circuitry and is also designed to drive WPIs A300 series stimulus isolators. If desired, any channels output may be internally connected to the variable channel, whose amplitude can be continuously adjusted from millivolts to ten volts. a highly accurate and stable crystal oscillator, the EVENT INTERVAL generates synchronization pulses at regular intervals. The width of the sync pulses is fixed at approximately 6 s, but their repetition interval is panel adjustable from 10 s to 999 s, using the display and its associated switches. Sync pulses may also be generated at random or irregular intervals by using the SINGLE EVENT or the EXTernal SYNC mode. The sync pulses are internally distributed to the five PULSE TRAIN channels and are also available externally through the SYNC OUT connector.
The Pulse Train

There are five PULSE TRAIN channels in the Pulsemaster. Except for sharing a common power supply, each is an independent instrument. Each channel has two adjustable timing parameters, DE LAY and WIDTH, which in combination with internal or external signals may be used to create a variety of pulse and train waveforms. DELAY and WIDTH parameters can be changed while the instrument is operating. The basic difference between PULSE and TRAIN modes is the number of pulses that can be generated per sync pulse. In PULSE mode, only one pulse is generated for each sync pulse. As the sync pulse is received from one of the selected input sources, the leading rising edge of the pulse is recognized and a DELAY time/pulse WIDTH pair is generated. In TRAIN mode, multiple pulses can be generated per sync pulse. As in PULSE mode, as the leading rising edge of the sync pulse is recognized, a pulse WIDTH/DELAY pair is generated.
The Event Interval

The EVENT INTERVAL is the heartbeat of the Pulsemaster. Based on
108
A300 PULSEMASTER SPECIFICATIONS

Pulses (WIDTH/DELAY pairs) are continuously produced as long as the sync pulse is still high at the conclusion of the DELAY time. By means of the INPUT SELECT switch, sync pulses can be received from an external source through the EXT SYNC connector, manually by the SINGLE switch, from any of the other PULSE TRAIN channels, or one of the MIXER channels. The channel may also be disabled by switching to one of the OFF positions. EXT SYNC position: permits control of the PULSE TRAIN channel by other instruments and computers. SELF SYNC position: the channel becomes a free running pulse generator. The symmetry of the waveform can be adjusted by varying the DELAY and/or the WIDTH times. SINGLE EVENT position: pulses are generated at your discretion. Every time the SINGLE button is pressed, one and only one DELAY/ WIDTH sequence is generated. EI position: connects the output of the EVENT INTERVAL generator to the input of the PULSE TRAIN channel. For every output sync pulse from the EVENT INTERVAL generator, one DELAY/WIDTH pair is generated. PT positions (4): internally connect the outputs from the respective PULSE TRAIN channels to the input of this PULSE TRAIN channel. In the PULSE mode, for every OUTPUT pulse from the other selected PULSE TRAIN channel, one DELAY/WIDTH pair is generated from this channel. In the TRAIN mode, pulses are generated from this channel as long as the pulse from the other channel remains high. MIX positions (2): internally connect the outputs from the respective MIXER channels to the input of this PULSE TRAIN channel. In the PULSE mode, for every OUTPUT pulse from the MIXER channel, one DELAY/WIDTH pair is generated from this channel. In TRAIN mode, pulses are generated from this channel as long as the pulse from the MIXER channel remains high. OUTPUT connector: supplies the waveforms generated by the PULSE TRAIN channel. This OUTPUT is designed to drive WPIs A300 series stimulus isolators. It is also useful for synchronizing other instruments (recorders, oscilloscopes, computers, etc.) with the pulses generated from the Pulsemaster.
Output eVent InterVal CHannel Operating Modes Input RS232C compatible Timing EVENT INTERVAL 10 s to 999 s (100 kHz - 0.001 Hz), 0.1% of full scale, continuously variable in 0.1% of full scale increments, through three orders of magnitude, in six ranges SYNC OUT pulse of 6 s, TTL, 5 V CMOS compatible EXTernal SYNC, SINGLE EVENT, CONTIN UOUS ON EXT SYNC accepts 1s pulses; TTL, CMOS,
pulSe traIn CHannel (5 provided) Operating Modes EXTernal SYNC, SELF SYNC, manual SINGLE event, sync from Event Interval, sync from any of other four Pulse Trains, sync from one of the MIXers, off, TRAIN/PULSE Input EXT SYNC accepts 1s pulses; TTL, CMOS, RS232C compatible Timing DELAY and WIDTH 10 s to 999 s, 0.1% of full scale, continuously variable in 0.1% of full scale increments, through three orders of magnitude, in six ranges (.0005 Hz to 50 kHz in the SELF SYNC mode) Output OUTPUT PULSE/TRAIN of preset timing, TTL, 5 V CMOS compatible, 4 mA sink and source mIXer CHannel (2 provided) Inputs Any combination of an EXTernal pulse, the outputs of the five Pulse Train channels, and DC continuous ON/ DC MOMentary EXT INPUT accepts 1s pulses; TTL, CMOS, RS232C compatible Output OUTPUT, TTL, 5V CMOS compatible, 4 mA sink and source VarIable CHannel Inputs Output from any one PULSE TRAIN channel or one of the two MIXER channels or DC Output 0 to +1 V low range, 1 mV resolution 0 to +10 V high range, 10 mV resolution 5 mA max sink and source Output Impedance <1 ohm Noise <500 V peak @ 100 kHz bandwidth, PULSED mode <500 V, wide band, DC mode Signal Ground pOWer batterIeS DImenSIOnS Floating, i.e., not connected to chassis 95-135 V or 220-240 V, 50/60 Hz Three 1.2 V DC, size AA, NiMH batteries 8.5 x 19 x 8.75 in. (22 x 45 x 22 cm) 21 lb (9.5 kg)
The Mixer
The MIXER does what its name implies, it combines any or all of the outputs of the PULSE TRAIN channels with external signals into one waveform. It can also provide a continuous (DC ON) or momentary (DC MOM) high level signal. The Mixer OUTPUT connector supplies the combination waveforms generated by the MIXER channel to drive WPIs A300 series stimulus isolators or to synchronize the operation of other instruments with the Pulsemaster.
The Variable Channel

The VARIABLE channel can replicate the OUTPUT waveforms from any of the PULSE TRAIN or MIXER channels at amplitudes that can be varied from millivolts to ten volts. The channel also provides a very low noise, adjustable DC voltage source: the DC mode which converts the VARIABLE channel into a constant voltage source. The OUTPUT connector supplies the amplitude modified waveform or the DC voltage level of the VARIABLE channel.
SYS-A300
Pulsemaster Multi-Channel Stimulator Specify line voltage
SHIppInG WeIGHt
109
Isostim Stimulator/Isolator
Combining the ease of use and accuracy of WPIs 300 Series stimulators with the power output of a stimulus isolator
Timing Pulse interval and width are set with single-turn continuously variable controls from 5 ms to 5.5 s in three ranges. Pulse width is continuously variable from 50 s to 550 ms in four ranges. Modes of operation In FREE RUN, Isostim generates continuous square waves. In EXT GATE or EXT SYNC modes, externally applied pulses can generate trains or single events. Single pulses of finite duration can be produced using a push-button on the instruments front panel. EXT/DC mode converts Isostim to a passive stimulus isolator. Dual tone audible alarm A tone sounds when an open circuit is detected or when system compliance is reached. A second tone, which sounds when a signal is applied to the input, can only be heard if the batteries have sufficient charge to operate the isolator. A violation light advises when pulse width exceeds the interval.
Current delivery Stimulus currents up to 10 mA can be set on the front panel with a control knob and a two-position range switch. Output current is load-independent. Power Isostim model A320D is powered by readily obtainable 9-volt alkaline batteries (included). Under average use these will last several months before replacement is required. The rechargeable A320R is supplied with a nickel metal hydride battery stack which provides 10-12 hours of operation before recharge is required. the a362 battery Charger must be used with the a320r.
ISOSTIM SPECIFICATIONS
tImInG parameterS Interval Pulse width Input External sync External gate External command voltage Trigger threshold Output Waveform Current ranges Output polarity Current rise time and delay Current fall time and delay Optocoupler pOWer Dry Cell (Version D) Rechargeable (Version R) DImenSIOnS SHIppInG WeIGHt 16 alkaline 9V batteries included 16 rechargeable NiMH 9V batteries incl 8.5 x 3.5 x 4.9 in (22 x 9 x 12 cm) 4 lb (1.8 kg) DC, pulse from internal timing or externally generated pulse 0-1 mA, 0-10 mA Reversible, manual switch 8 s, typical (1 K load) 10 s, typical (1 K load) 2500 V rated min. breakdown voltage Accepts 1 s minimum pulses Accepts 1 s pulse to continuous 5.0 V at 3.0 mA (TTL level), 10 V max. 2.0 V at 0.5 mA 5 ms to 5.5 s continuously variable in three ranges (0.18 to 200 Hz) 50 s to 550 ms continuously variable in four ranges
A362 Battery Charger

Required for A320R, A365R and A395R
Recharges the high-voltage nickel-cadmium or NiMH battery stack in the A320R, A365R or A395R. LED lamp indicates charging status. Full charge overnight. Dimensions: 2.8 x 4.1 x 5 in. (7 x 10 x 13 cm). Shipping weight: 4 lb (1.8 kg). SYS-A362 A320RC SYS-A320D SYS-A320R Battery Charger for A320R, A365R, A395R A320R with Charger (A362) Isostim Stimulator/Isolator Isostim Stimulator/Isolator (rechargeable) Specify line voltage OPTIONAL ACCESSORIES DRL Dummy Load Resistor Kit (set of 3) 13347 BNC-to-Double Banana Adapter
Load voltage excursion (compliance) 100 V nom., 150 V max.
Leakage resistance, output to ground 1012 Ohms
110
Stimulus Isolator / Precision Current Source
model a365 includes the same features and specifications as A360 but with the added capability for automated bipolar pulsing for zero net charge on biological preparations. polarity Output polarity is determined by a push switch on the front panel. Bipolar current is toggled by the command waveform, setting alternating pulses as positive or negative.
A365 SPECIFICATIONS
OUTPUT WAVEFORM OUTPUT CURRENT RANGES CURRENT AMPLITUDE ERROR CURRENT RESOLUTION OUTPUT LOAD VOLTAGE EXCURSION (COMPLIANCE) EXTERNAL COMMAND VOLTAGE TRIGGER THRESHOLD OUTPUT POLARITY CURRENT RISE TIME & DELAY CURRENT FALL TIME & DELAY OUTPUT TO GROUND RESISTANCE OPTOCOUPLER POWER Model A365D (dry cell) Model A365R (rechargeable) DIMENSIONS SHIPPING WEIGHT DC or current pulse 0.1, 1.0, and 10 mA 0.5% of full scale, max. 0.1% of full scale, typical 100 V 5.0 V at 3.0 mA (TTL level), 10 V max. 2.0 V at 0.5 mA Reversible, manual switch or automatic 6 s, typical (1 K load) 10 s, typical (1 K load) 1012 2500 V, rated min. breakdown voltage 16 alkaline 9 V batteries, included 16 rechargeable NiMH 9 V batteries incl. 8.5 x 3.5 x 5 in (22 x 9 x 12 cm) 4 lb (1.8 kg)
SYS-A365D A365RC SYS-A365R SYS-A362
High Voltage Isolator, Bipolar, alkaline batteries A365R with charger (A362) High Voltage Isolator, Bipolar, rechargeable Battery Charger for A320R, A365R, A395R Specify line voltage OPTIONAL ACCESSORIES DRL Dummy Load Resistor Kit (set of 3) 3468 Dual Rack Mount Kit for A365 3469 Single Rack Mount Kit for A365 13347 BNC-to-Double Banana Adapter
DRL Dummy Load Resistor Kit Converts current output to precise voltages.
111
Combines optical isolation with a 100 mA current generator
A385 High Current Stimulus Isolator

Delivers positive, negative, or bipolar currents. For bipolar delivery, polarity of the output is toggled to the opposite state with each pulse presented to the input. Pulse duration is controlled by an externally applied voltage. Input connector is a standard BNC, allowing signals from any source such as computer D/A or I/O lines to be used. Output amplitude is set on a 3-digit, ten-turn dial as a percentage of the range selected: for example, a setting of 45.6 in the 0-10 mA range translates to 4.56 mA at the output. Accuracy and repeatability are excellent. Designed for subcutaneous stimulation, maximum output voltage at the stimulating electrodes is 36 volts, reducing the possibility of serious accidental transcutaneous shocks. A compliance/output alarm sounds
when the 36-volt limit is reached. Internal circuitry maintains electrodes short-circuited during inactive periods (electrode exhauster feature). A385 is not appropriate for transcutaneous stimulation. The 1.2 amp-hour rating of the six heavy-duty lead-acid rechargeable batteries ensures that experiments will not be interrupted by dead batteries even at peak currents. Indicator lights and audible alarms keep the user constantly apprised of battery charge status. These batteries must be recharged by the A382 System Charger designed especially for the A385.
A385RC SYS-A385R SYS-A382
A385R with A382 Charger High Current Isolator, rechargeable Battery Charger for A385 (see below) Specify line voltage OPTIONAL ACCESSORIES 3468 Dual Rack Mount Kit
A385 SPECIFICATIONS
OUTPUT WAVEFORM OUTPUT CURRENT RANGES CURRENT AMPLITUDE ERROR CURRENT RESOLUTION REPEATABILITY OUTPUT LOAD VOLTAGE EXCURSION (COMPLIANCE) EXTERNAL COMMAND VOLTAGE TRIGGER THRESHOLD OUTPUT POLARITY CURRENT RISE TIME AND DELAY CURRENT FALL TIME AND DELAY OUTPUT TO GROUND RESISTANCE OPTOCOUPLER POWER DIMENSIONS SHIPPING WEIGHT DC or current pulse 1, 10, and 100 mA 0.5% of full scale, max 0.1% of full scale, typical 36 V 5.0 V at 3.0 mA (TTL level), 10 V max. 2.0 V at 0.5 mA Reversible, manual switch, or electronically switched bipolar delivery 6 s, typical (1 K load) 10 s, typical (1 K load) 1012 2500 V, rated minimum breakdown voltage Six rechargeable lead-acid batteries (Requires companion charger A382) 8.5 x 3.5 x 5 in. (22 x 9 x 12 cm) 5 lb (2.3 kg) POWER DIMENSIONS SHIPPING WEIGHT

An innovative threestep charger, A382 employs fast, medium, and trickle charges at a safe, low current, greatly extending battery life. After a fast initial phase, the charger automatically switches to a constant voltage mode. When charging is complete, the charger switches to the trickle-charge mode. LED lamps indicate charging status. (For use only in charging batteries installed in the A385.)
A382 SPECIFICATIONS
95-135 V or 220-240 V, 50/60 Hz 8.5 x 3.5 x 5 in (22 x 9 x 12 cm) 5 lb (2.3 kg)
112
A395 Linear Stimulus Isolator

Replicates a programmed waveform of any shape or polarity
Current Delivery A 10 V input produces the maximum output current for the current range selected, i.e., 100 A, 1 mA, or 10 mA. Front panel controls allow DC current to be generated. Externally applied signals can be superimposed simultaneously (DC offset). Warning lamps indicate open circuit or excessive current conditions. Digital meter Measures DC or average output current. Overload lamps Indicate when output voltage has reached positive or negative compliance voltage limit. A395RC SYS-A395D SYS-A395R SYS-A362 A395R with Charger (A362) Linear Stimulus Isolator Linear Stimulus Isolator, Rechargeable Battery Charger Specify line voltage OPTIONAL ACCESSORIES 3468 Dual Rack Mount Kit 3469 Single Rack Mount Kit
All WPI stimulus isolators are designed to supply constant current because current threshold (not voltage) is the most quantitatively reproducible parameter for stimulation of nerve and muscle. Model A395 dispenses current reproducibly from its Output terminals; the amplitude being determined by the selected current RANGE and the input voltage. Current amplitude is constant, that is, load resistance independent, provided that the I x R (load) product does not exceed the available battery supply voltage. A visual indicator (the compliance LEDs) displays if I x R reaches this limit. When the unit is out of compliance, one of the two LEDs (labeled - and +) illuminate, depending in which direction the current is flowing. Model A395 D can generate a voltage of 70 volts or more across its OUTPUT terminals. Thus, the user can be sure that the amplitude of the current will be as dialed as long as the voltage drop across the load (stimulus electrode path) does not reach the magnitude of the supply voltage. The compliance LEDs will then be visible. The user would then know that (a) too much current was dialed for a given load or (b) interelectrode resistance was too high or the electrode circuit path was open. Model A395 generates an output current of arbitrary (user-defined) wave shape; DC, AC, pulse, and combinations thereof. Battery operated, and photoelectrically-isolated from the input voltage drive, the instrument regenerates output currents which are linearly proportional to the analog voltage waveforms provided by your D/A converter or signal generator (see diagram below). The A395 is ideally suited for data acquisition and stimulator generators. It can be easily daisy-chained for mutiple channel requirements.
A395 SPECIFICATIONS
OUTPUT CURRENT, Imax OUTPUT VOLTAGE RANGE OUTPUT BANDWIDTH INPUT RESISTANCE INPUT VOLTAGE @ Imax INPUT/OUTPUT LINEARITY ERROR RISE, FALL TIME POWER Model A395D Model A395R DIMENSIONS SHIPPING WEIGHT 3 ranges: 100A, 1 mA, and 10 mA 70 V 10 kHz (measured across 1K load R) > 20 M 10 volts < 0.5% 26 s @ 10 K 17 alkaline 9 V batteries 17 rechargeable NiMH 9 V batteries 6.5 x 4 x 3.5 in. (16 x 10 x 9 cm) 4 lb (1.8 kg)
10 V
INPUT
0V -10 V +100 A, +1 mA, +10 mA

Required for A320R, A365R and A395R
Recharges the high-voltage nickel-cadmium or NiMH battery stack in the A320R, A365R or A395R. LED lamp indicates charging status. Full charge overnight. Dimensions: 2.8 x 4.1 x 5 in. (7 x 10.5 x 12.7 cm). Shipping weight: 4 lb (1.8 kg).
OUTPUT
0 -100 A, -1 mA, -10 mA
pts Acce g o anal t inpu
113
DS8000 8-Channel Digital Stimulator
Single board computer w/ LCD touch screen Scope mode displays waveforms 8 banks of 3 timers, synchronous / asynchronous 8 internal and 8 external trigger inputs 32 separate outputs ( 24 BNC's front panel )
Lifetime firmware upgrades via serial / Ethernet Unipolar, bipolar, paired pulse, sine, ramp, custom Custom upload of real biopotentials 2 independent full parameter memory banks GLP / GCP compliant w / password protection
In fact, this decade old technology has serious limitations since each control button has been programmed to perform multiple functions. Moreover, it can only display limited lines of scrolled textno graphics! To complicate matters, it is almost impossible to upgrade the software with new functions once the instrument has been manufactured; even the programming is awkward. The DS8000 overcomes the hardware limitations of other types of stimulators by being reliant on a flexible software-timing interface. The user can then apply this dynamically to almost any kind of stimulation protocol without being restricted by the hardware limitations of the traditional logical circuit based stimulators. In order to suit complex custom protocols, the DS8000 is designed to offer a unique flexibility by simply reprogramming the pattern output using a few keystrokes under pull-down menus. Although it may be argued that some functions of the DS8000 can be implemented on a standard PC, it is important to recognize that the inherent design of a PC operating system makes the accurate delivery of precision pulse protocols impossible. Despite the fact that PCs are very economical, they are simply not designed to generate highly accurate timing because the microprocessor resources are not prioritized for this function. In addition, analog waveform generation is not readily available without adding expensive output boards and the required programming is non-standard. The DS8000 platform is based on a powerful single board computer that is fully dedicated to the temporal accuracy and precision required in current biological and neurological research. Indeed, the DS8000 Digital Stimulator offers all of these solutions plus Good Laboratory Practices (GLP) compliance for research traceability. DS8000 there is no competition!
The DS8000 represents a quantum leap in the performance of the research stimulator, and is the most advanced stimulator on the market. With a built-in computer, the entire waveform is generated digitally with precision timing. The DS8000 can generate stimulating wave patterns of a complexity unmatched by any other instrument on the market. A built in digital oscilloscope allows the user to preview waveforms on the LCD. An Ethernet connection allows the user to transfer custom waveforms and upgrade the software using TCP/IP protocol via remote access. The DS8000 has 8 analog outputs, 8 TTL outputs and 8 combined analog or TTL outputs. Each combined output can be comprised of a combination of any of 1 to 8 channels. Eight independent internal timers and eight independent external triggers are offered. The built-in waveforms include unipolar, bipolar, and paired pulse, as well as step, sine, ramp and custom. An external trigger, internal analog channel, internal TTL channel, or any of the eight built-in timers can be assigned to control each output channel. A unique feature of the DS8000 is the capability to stimulate with a waveform that is identical or similar to real biopotential wave patterns associated with ECG, EEG or action potentials. A biopotential waveform captured by a data acquisition system may be transferred to an Excel spreadsheet for editing or modification, then loaded into to the DS8000. One of the main problems of designing a stimulator is that a user might want very different stimulating patterns for different research applications. In order to satisfy all of these needs, traditional logical circuit based stimulators have control panels that use buttons and knobs to give the user as much control options as possible. However, even with a full panel of buttons, the selection of the stimulating pattern is still very limited. These types of stimulators can not generate complicated waveforms, such as combination pulses at varying interpulse intervals and amplitudes. Although microprocessorbased stimulators have made a significant step in solving these problems, certain complex waveforms are still impossible to generate.
DS8000
8-Channel Digital Stimulator
114
A quantum leap in the performance of the research stimulator

Soft Keys and GuI interface The DS8000 employs soft keys, which are programmable controls widely used in several menu options to sequentially change the numerical value of any variable waveform parameter. The DS8000s soft keys are easily recognized as single or double + and - signs located adjacent to a parameter value box (Fig. 1). Soft keys provide quick and easy access to modify parameter values on the fly during an experiment. The GUI interface (Fig. 3) enables the user to assign the incremental value of the soft key to suit the needs of the experiment. Alternatively, a pop-up numeric keypad is accessible for each parameter to program a precise value that is not a multiple of the softkey-preset increment.
Fig. 1 Channel Settings Paired Pulse Protocol The DS8000s Paired Pulse function allows the user to generate triggered paired pulses (including refractory period) from a single channel without the use of a train function. WPIs paired pulse algorithm simplifies the arduous repetitive task normally associated with manual resetting of interpulse intervals in refractory studies. Auto-increment eliminates the need to overlap train functions from multiple channels to generate a complete protocol. Thus, there is a significant reduction in setup time and a minimization of the potential for human error during interactive protocol modification. Fig. 1 shows Channel 1 configured in the TRIGGERED PAIRED PULSE mode. In this example, a dual pulse event occurs synchronously with each trigger pulse from Channel 8, which is set to trigger every 300 ms. The initial interpulse interval is set to 20 ms. Subsequent interpulse intervals are automatically incremented by 35 ms for each three consecutive paired pulse events. The resulting paired pulse is displayed in the lower trace on the DS8000 scope (Fig. 2). The upper trace shows the master trigger pulse set up on Channel 8.
Fig. 3 Graphic User Interface CA BNC outputs. The setup in Fig. 4 indicates that all TTL channels are assigned to their respective CTTL outputs with the exception of the output of CTTL 1, which is assigned a combination of the TTL signals from channels 4 and 5. Changing assignments is as easy as checking the associated box. The CA tab reveals an identical matrix for programming the COMBINED ANALOG BNC outputs.
Fig. 2 Scope Display

Combined Channel assignment matrices The CTTL (COMBINED TTL matrix) and CA (COMBINED ANALOG matrix) screens permit the assignment of any combination of the 8 available TTL or Analog signals to any permutation of the respective (8) CTTL or (8)
Fig. 4 Combined TTL Matrix
DS8000 SPECIFICATIONS
Timing parameTers Period (total signal width) Pulse width BiPolar gaP width oPerating Modes triggers train events train Pulse width train Pulse delaY train Period BnC outPut ConneCtors waveForMs CustoM waveForM variaBle steP waveForM 0.04 ms to 10,737,418.24 ms 0.02 ms to 10,737,418.24 ms 0.00 ms to 10,737,418.24 ms Free run, triggered, gated, train, dC 8 external, manual, ttl 1-8, combined ttl 1-8, timer start or stop 1-199 0.02 ms to 10,737,418.24 ms (3 hours) 0.04 ms to 10,737,418.24 ms 0.06 ms to 10,737,418.24 ms analog, combined analog, combined digital (ttl) unipolar, bipolar, rectangular, sine, ramp, step, paired pulse, custom defined 12 steps/ voltage point (1025 if remote controlled) 100 points (1025 if remote controlled) outPut noise tiMing aCCuraCY outPut voltage resolution Max. outPut voltage outPut iMPedanCe external trigger sYnC digital i/o Mains voltage diMensions shiPPing weight aMBient teMPerature huMiditY < 5 mv rms < 100 ppm 5 mv +/-10v @ +/- 10 ma @ 0.005 v/step 50 ohm analog, < 1 ohm Combined analog 40 s minimum pulse ttl, CMos 20 s glitch and spike protection 5v max 10 ma (input) 85-260 v aC, 45-65 hz 50w 13.3 cm x 42.5 cm x 25.4 cm 5.25 x 16.73 (19 rack) x 10 12 lb (5.5 kg) -10 to +40 C; -20 to +50 C (internal) Max. 95% relative humidity, non-condensing
SPECIFICATIONS SUBJECT TO CHANGE WITHOUT NOTICE.
115
Digital Linear Stimulus Isolator

for use with DS8000 Digital Stimulator
Top View
The new DLS100 is preferentially optimized for applications in which the DS8000 digital stimulator is used. DLS100 connects to the DS8000 via a flexible cable through which it receives power and stimulus signals in a digital format. Up to eight DLS100 isolators can be connected independently to one DS8000. Very high isolation is achieved through the use of optical coupling of the digital signal and a galvanically isolated DC power supply within the DLS100. Unlike some other multi-channel isolators, this digital isolator can be located at the site of the experiment, allowing the use of short connecting leads and thereby preserving high isolation and fast signal rise and fall times. The DLS100 operates in two modes: current source or voltage source. In the current source mode, the output current is proportional to the amplitude and polarity of the signal generated by the DS8000. In the voltage source mode, the output voltage is proportional to the amplitude and polarity of the signal generated by the DS8000. The DLS100 has user-selectable push-button switches that select different current or voltage ranges (the full-scale current from 1 A to 10 mA, or the 10V and 100V full-scale, respectively). Three status indicators on the DLS100 indicate power on, activity (presence of signal from DS8000) as well as an alarm (over-range condition) indicator. Over-range can occur when the resistance of the load (the experiment) is too high for the current or voltage that is demanded from the DLS100.
DLS100 SPECIFICATIONS
CUrenT SOUrCe MODe Full-scale Current Compliance Voltage Output Impedance Zero-signal Leakage 10 mA, 1 mA, 100 A, 10 A, 1 A, bipolar 100 volts Greater than 100 Megohms Less than 0.01% of full-scale range setting 10 mV @ 100 V / 10,000 Ohms, 10 mA Scale = < 1 A Leakage Better than 0.05% of full-scale range setting range and load dependant: 20 kHz with 10K load and 100 A or above range. 100 volts 10 mA Less than 1 ohm Less than 1 mv Better than 0.05% of full-scale range setting Greater than 1000 Megohms Less than 10 pF, from output terminals to DS8000 and earth ground +12 volts and +5 volts, supplied by DS8000 14 x 9 x 3.5 cm (5.5 x 3.5 x 1.5 in.) Mini-banana jacks 150 cm (5 ft)
Linearity Bandwidth VOLTAGe SOUrCe MODe Full-scale Voltage Maximum Current Output Impedance Zero-signal Offset Linearity ISOLATIOn resistance Capacitance POWer reQUIreMenTS DIMenSIOnS OUTPUT TerMInALS COnneCTInG CABLe
DLS100 501670 83016 503301 116

Digital Linear Stimulus Isolator Adapter, Dual Mini-Banana-to-BnC(F) replacement Cable, DLS100-to-DS8000 Cable, mini-DIn extension, 10-ft
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. Germany: Tel: 030-6188845 wpide@wpi-europe.com
Glass Capillaries
Fire-Polished Single-Barrel Standard-wall and Thin-wall glass Tubing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118 WPIs Fire-polished glass capillaries are perfect for recording electrodes. The fire-polished ends eliminate possible damage to the chloridized (Ag/AgCl) wire and microelectrode holder, and also facilitate smoother insertion into a microelectrode holder. Single-Barrel Standard Wall Capillaries (with or without inner filament) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118 WPIs standard wall capillaries are easier to pull longer and smaller tip micropipettes. These are particularly suitable for intracellular microelectrodes. The inner filament greatly facilitates pipette filling with electrolyte. Single-Barrel Thin Wall Capillaries (with or without inner filament) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118 Thin wall capillaries produce smaller OD and bigger ID pipettes that are suitable for microinjection
GLASS, HOLDERS
Patch Clamp Glass Capillaries

Best for patch clamp studies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 119
Multi-Barrel Glass Capillaries

Multi-Barrel Standard wall tubing (with inner filament) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 Designed for microiontophoresis Septum Theta Capillaries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 Ideal for making dual-channel micropipettes used for intracellular work in small cells Piggyback Glass Capillaries (with filament) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 Ideal for making two-barrel electrodes with a significant tip diameter differential Borosilicate Glass Rod . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 Suitable for making rod pipettes to be used as tools to dissect chromosomes or to probe and move objects Five- and Seven-Barrel Micropipette Blanks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121 Designed for precise local application of chemicals in extracellular electrophysiological studies
Tip Pre-Pulled Glass Capillaries

Borosilicate Glass Micropipettes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 122 Plain, luer and silanized Tips
& ELECTRODES
Microfil, Micropipette Holders and Accessories

MicroFil Nonmetallic Syringe Needles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 123 For filling micropipettes Micropipette Storage Jar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121 For 1.0mm, 1.2mm, 1.5mm and 2.0mm OD glass pipettes PolyFil Multi-Barrel Micropipettes Coupling Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 123 For easy and secure coupling of a multi-barrel micropipette to a pressure source Micropipette Holders & Half-Cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124 For coupling fluid-filled glass micropipettes to high input impedance amplifiers Optical Quality Glass Bottom Sterile Cell Culture Dishes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173 For microinjection, fluorescence, high resolution image analysis, cell culture, electrophysiology
Microelectrodes
Metal Microelectrodes For extracellular recording . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 Dri-Ref Reference Electrodes featuring extremely low electrolyte leakage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 CALBUF Calcium Calibration Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 BetterSkin Electrodes Reusable surface-mounted electrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 128 Disposable Ag/AgCl Snap Electrodes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 128 GEL100 Conductive Electrode Gel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 128 Ag/AgCl Half-Cells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 129
117
Glass Capillaries
Clean, high quality glass for making micropipette electrodes and other research implements
Standard, no Filament Standard, with Filament Thin Wall, no Filament Thin Wall, with Filament
& ELECTRODES
WPI offers a wide spectrum of high-quality glass capillaries. We take pride in our ability to ship your glass order within 48 hours. If you need a special glass that does not appear in our catalog, please call us. We will make every effort to provide it for you.
Single-Barrel Standard Borosilicate Glass Tubing

Length
3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm)
OD (mm)
1.0 1.0 1.2 1.2 1.5 1.5 1.0 1.0 1.2 1.2 1.5 1.5 2.0 2.0 1.0 1.0 1.2 1.2 1.5 1.5 2.0 2.0
ID (mm)
0.58 0.58 0.68 0.68 0.84 0.84 0.58 0.58 0.68 0.68 0.84 0.84 1.12 1.12 0.58 0.58 0.68 0.68 0.84 0.84 1.12 1.12
Filament
4 4 4 4 4 4 4
FirePolished
Quantity
500 500 350 350 225 300 500 500 400 350 300 300 125 200 500 500 350 350 225 225 125 125
Item
1B100F-3 1B100-3 1B120F-3 1B120-3 1B150F-3 1B150-3 1B100F-4 1B100-4 1B120F-4 1B120-4 1B150F-4 1B150-4 1B200F-4 1B200-4 1B100F-6 1B100-6 1B120F-6 1B120-6 1B150F-6 1B150-6 1B200F-6 1B200-6
Price
54 54 US$ 54 US$ 54 US$ 54 US$ 54 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71
US$ US$
Fire-Polished glass
capillaries are easier to insert into microelectrode holders without damaging the gasket. More importantly, fire-polished glass wont scratch the chloridized wire used in a recording electrode. Fire-polishing does not affect the glasss mechanical or electrical properties.
4 4 4 4 4 4 4
Borosilicate glass capillaries: Close

dimensional tolerances assure microelectrode uniformity and reproducibility. Available in one-, two-, three-, five- and seven-barrel configurations; a complete range of single barrel thin-wall sizes; and a variety of special configurations. Capillaries with filaments contain a solid filament fused to the inner wall, which speeds filling of electrodes. Capillaries with or without inner filaments are available for making microelectrodes in a wide range of diameters .
4 4 4 4
GLASS, HOLDERS
Single Barrel standard wall thickness capillaries are offered either with or without inner filaments for quick filling in a variety of lengths and diameters. Two usable electrodes can be made from one 6-inch length. Borosilicate glass is Corning N51A.
Thin-Wall Single-Barrel Standard Borosilicate (Schott Duran) Glass Tubing

OD (mm)
1.0 1.0 1.2 1.2 1.5 1.5 1.0 1.0 1.2 1.2 1.5 1.5 1.0 1.0 1.2 1.2 1.5 1.5
ID (mm)
0.75 0.75 0.90 0.90 1.12 1.12 0.75 0.75 0.90 0.90 1.12 1.12 0.75 0.75 0.90 0.90 1.12 1.12
FIL
4 4 4
FirePolished
Length
3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 3 in. (76 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 4 in. (100 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm)
Quantity
500 500 400 350 225 300 500 500 350 350 225 300 500 500 400 350 225 300
Item
TW100F-3 TW100-3 TW120F-3 TW120-3 TW150F-3 TW150-3 TW100F-4 TW100-4 TW120F-4 TW120-4 TW150F-4 TW150-4 TW100F-6 TW100-6 TW120F-6 TW120-6 TW150F-6 TW150-6
Price
56 56 US$ 56 US$ 56 US$ 56 US$ 56 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71 US$ 71
US$ US$
Thin Wall single barrel capillaries are offered both with or without inner filaments. The concentricity of this material provides excellent strength. Micropipettes made from thin wall capillaries have fine tips with a short taper.
4 4 4 4 4 4 4 4 4 4 4 4
Note: Because electrode tips erode when left filled with saline solutions for long periods, electrodes should be made and filled immediately prior to use.
118
Patch Clamp Capillary Glass

To select the best patch clamp glass for your experiments, we have evaluated available glass types in terms of the four properties most crucial to successful patch clamp studies: The softening temperature determines how easily each glass type can be pulled to the desired shape and the extent to which it can be heat polished. Glass with a high softening temperature is difficult to pull and causes unnecessary wear on the heating element of the puller. This makes it very hard to make electrodes that are reproducible and of consistent quality. Patch clamp glass with a low softening temperature is preferred; however, higher softening temperature glass is stronger. Electrical properties determine how much noise the glass is likely to produce in recording situations. The lower the product of dielectric constant times the loss factor, the smaller the equivalent noise current the glass will produce (Rae and Levis, Methods in Enzymology, 207, p67, 1992). Patch clamp glass with good electrical properties is critical especially in single-channel recording. Sealability: It is not clear what factors determine the sealing ability of the patch to the glass. Almost any glass can form a gigohm seal under the right conditions. Different glass types vary, however, in how easily they form a seal. It is important to select a patch clamp glass that seals easily. Good fire polish is critical for seal (see DMF1000). Leachable components: Substances leached from glass can alter channel behavior. Since different channels are sensitive to different glass components, it is best to record one type of channel with several different kinds of pipette glass to eliminate any artifact due to the glass. WPI offers capillary tubing made from two glass types widely used in constructing patch clamp electrodes. The significant characteristics of each are as follows: PG52151-4, PG52152-4 and PG52165-4 are prepared from Schott #8250 glass (equivalent to Corning #7052), one of the most widely used patch clamping glasses. This is a specially formulated borosilicate glass with a softening temperature that is 110C lower than regular borosilicate glass (Corning 7740, or Pyrex). It has excellent sealing properties for most cells. Electrical properties are also very good. PG10150-4 and PG10165-4 are composed of Corning #0010 glass, a high lead content (22% PbO) glass. Its thermal and electrical performance is between the Schott #8250 and Corning #8161 glasses described above. It is much more economical than Corning #8161 glass. It has been found that this glass causes much less alteration in channel behavior than Corning #8161 and Schott #8250 glass (Furman and Tanaka, Biophys. J. 53, p287, 1988). Patch clamp capillaries do not have microfilaments.
GLASS, HOLDERS
PATCH CLAMP CAPILLARY GLASS

Catalog# PG52151-4 PG52165-4 PG10150-4 PG10165-4 Glass Type OD/ID (mm) #8250 #8250 #0010 #0010 1.5/1.0 1.65/1.1 1.5/0.75 1.65/1.1 Dielectric Constant 4.9 4.9 6.7 6.7 Softening Point C 720 720 625 625 Quantity 100 100 100 100 Price 56 56 US$ 56 US$ 56
US$ US$
& ELECTRODES
Glass Handling Forceps

Ever had difficulty picking up a glass capillary? Special tips on these forceps solve the problem, holding glass firmly without risk of breakage. They also keep the glass clean and avoid contamination from skin oils.
77020
Glass Handling Forceps
US$
47
119
Multi-Barrel Glass Capillaries
& ELECTRODES
Two-Barrel
Three-Barrel
Five-Barrel
Seven-Barrel
Multi-barrel configurations are designed especially for microiontophoresis. Because the capillaries are fused together during manufacture, you will not need to twist them while pulling to seal the tips together. An inner filament in each barrel makes filling easy and fast.
Multi-Barrel Borosilicate Glass Tubing with Filaments

Length
4 in. (102 mm) 4 in. (102 mm) 4 in. (102 mm) 4 in. (102 mm) 4 in. (102 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm) 6 in. (152 mm)
Description
Two-Barrel Three-Barrel Five-Barrel Seven-Barrel Seven-Barrel Two-Barrel Three-Barrel Five-Barrel Seven-Barrel
OD/ID (mm)
1.5/0.84 1.2/0.68 1.2/0.68 1.2/0.58 1.2/0.68 1.5/0.84 1.2/0.68 1.2/0.68 1.0/0.58
Filament
4 4 4 4 4 4 4 4 4
Quantity
100 100 65 60 75 100 100 65 60
Item
2B150F-4 3B120F-4 5B120F-4 7B100F-4 7B120F-4 2B150F-6 3B120F-6 5B120F-6 7B100F-6
Price
65 65 US$ 65 US$ 90 US$ 90 US$ 77 US$ 77 US$ 74 US$ 90
US$ US$
Also see PolyFil for a novel way to connect multi-barrel pipettes
Special Configuration Borosilicate Capillaries
GLASS, HOLDERS
Septum Theta offers superior cell impalement. The natural bevel resulting from the prominent spear-like projection of the septum gives microelectrodes a sharp, spear-point tip. This style has low resistance for use as a single microelectrode, and it can be used to make superior double-tipped microelectrodes with low trans-tip coupling. The natural bevel of Septum Theta Septum Theta Piggyback also significantly increases the effective tip cross-section. As supplied, the width of the septum is approximately 0.2 mm; wall thickness is approximately 0.2 mm. Piggyback glass consists of a pair of borosilicate capillaries fused together during Special Configuration Borosilicate Glass Tubing manufacture. One barrel is larger than the other, and both have inner filaments for Description OD/ID (mm) Length Quantity Item Price quick filling. Piggyback glass makes it simple US$ Septum Theta 1.5/1.02 6 in. (152 mm) 100 TST150-6 90 to fabricate two-barrel electrodes with a 1.51/0.84 significant tip diameter differential. US$ 65 Piggyback 4 in. (102 mm) 50 PB150F-4
Piggyback 0.75/0.35 1.51/0.84 0.75/0.35 6 in. (152 mm) 50 PB150F-6
US$
96
Borosilicate glass rod

1.0 mm diameter for making tools, probes, tips
Description
Glass Rod Glass Rod 1.0 1.0
Borosilicate Glass Rod

OD (mm) Length
4 in. (102 mm) 6 in. (152 mm)
Quantity
500 500
Item
GR100-4 GR100-6
Price
US$ US$
55 61
120
Five-and Seven-Barrel Micropipette Blanks

High quality multi-barrel micropipette blanks for pressure injection
The P-5 and P-7 micropipettes are designed for precise local application of chemicals in extracellular electrophysiological studies. Drug application may be by one of two methods: 1 . microiontophoretic ejection of charged substances, or 2 . pressure ejection. P-5 and P-7 pipette blanks exhibit levels of quality and reproducibility impossible to match in handmade pipettes. They are compatible with most vertical pipette pullers that accommodate 3.00 mm diameter glass. P-5 and P-7 blanks have a solid ball pulling tip and are fabricated from 3.00 mm Kwik-Fil tubing. All barrels except the large central one have filaments.
GLASS, HOLDERS
See PMP-107 Programmable Multipipette Puller, Page 180.

1 ") (3 4
m 2m
P-5-50 P-5-10 P-7-10 PI-305A MBMPH5-7
5-Barrel Micropipette Blank (pkg of 50) 5-Barrel Micropipette Blank (pkg of 10) 7-Barrel Micropipette Blank (pkg of 10) Pressure Ejection Kit (1 kit) Holder for P-5 & P-7 Pipettes
510 150 US$ 234 US$ 114 US$ 59

US$ US$
PI-305A Pressure Ejection Kit contains 20 plastic fittings, an insertion tool, five 5-ft lengths of colored tubing, a five-valve manifold coupling, six male luer adapters and one male/female luered line. These Pressure Ejection fittings connect the pressure ejection tubing to the P-5 and P-7 pipette barrels quickly and securely.
& ELECTRODES
Micropipette Storage Jar

Stores up to 30 micropipettes, filled or unfilled, up to three inches in length. A gentle sliding action inserts or removes pipettes without damage to the delicate tips.
E210 E212 E215 E220
Storage Jar for 1.0 mm OD Micropipettes Storage Jar for 1.2 mm OD Micropipettes Storage Jar for 1.5 mm OD Micropipettes Storage Jar for 2.0 mm OD Micropipettes
47 47 US$ 47 US$ 47
US$ US$
REPLACEMENT PARTS 1965 Foam Ring for 0.75 - 1.0 mm glass 1966 Foam Ring for 1.2 - 1.5 mm glass 1967 Foam Ring for 2.0 mm glass
18 18 US$ 18
US$ US$
121
TM
Borosilicate glass micropipettes

Shank
PLAIN
Plain Shank or Luer Fittings
Tip I .D .
0.1 m 0.2 m 0.3 m 0.4 m 0.5 m 1 m 2 m 5 m 10 m 10 m 30 m 0.1 m 0.2 m 0.3 m 0.4 m 0.5 m 1 m 2 m 5 m 10 m 30 m 5 m 5 m 10 m 10 m 30 m 30 m
Shank Length
1 inch 2 inch 1 inch 2 inch 1 inch 2 inch
Glass O .D .
1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.14 mm A203XV glass * 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall 1.0 mm Thin-Wall
Filament
Yes Yes Yes Yes Yes No No No No No No Yes Yes Yes Yes Yes No No No No No No No No No No No
Fire Polished
No No No No No Yes Yes Yes Yes Yes Yes
Catalog #
TIP01TW1F TIP02TW1F TIP03TW1F TIP04TW1F TIP05TW1F TIP1TW1 TIP2TW1 TIP5TW1 TIP10TW1 TIP10XV119 TIP30TW1 TIP01TW1F-L TIP02TW1F-L TIP03TW1F-L TIP04TW1F-L TIP05TW1F-L TIP1TW1-L TIP2TW1-L TIP5TW1-L TIP10TW1-L TIP30TW1-L TIP5TW1LS01 TIP5TW1LS02 TIP10TW1LS01 TIP10TW1LS02 TIP30TW1LS01 TIP30TW1LS02
& ELECTRODES
Eliminate the cost and trouble of making your own micropipettes WPI can quickly supply your need for consistently sized pre-pulled glass micropipettes for injection of dyes or proteins into cells, oocytes and for many other biomedical laboratory applications. Tip diameters (ID) range from 0.1 to 10 micrometers. Schott Duran borosilicate glass 0.5 micrometer and smaller ID micropipettes include an internal glass fiber for easy filling Tip inner diameter tolerance 20% Short taper yields high strength Nominal length 50 mm OD:ID = 1.33:1 Standard capillary outer diameters are 1.0 mm (thin-wall) or 1.14 mm Every pipette individually tested and inspected
(pack of 10) US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 155 US$ 143 143 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143
US$ US$
Price
LUER
LUER/SILANIZED
143 143 US$ 143 US$ 143 US$ 143 US$ 143
US$ US$
* 10 (ID), 1.14 mm capillary pipettes are for use in WPIs Nanoliter 2000.
GLASS, HOLDERS
Vacuum packed
Silanized Tips (Luer Shank)
Silanization waterproofs the glass to retard water when inserting into cell. This will not let the outside fluid run down the pipette and get inside so easily.
TIP SAMPLER TIPMIX01-05 TIPMIX05-10 TIPMIX01-05-L TIPMIX05-10-L
ASSORTMENTS Two each, 0.1, 0.2, 0.3, 0.4, 0.5 m ID, plain shank Two each, 0.5, 1, 2, 5, 10 m ID, plain shank Two each, 0.1, 0.2, 0.3, 0.4, 0.5 m ID, Luer Two each, 0.5, 1, 2, 5, 10 m ID, Luer
143 143 US$ 143 US$ 143

US$ US$
Micro Cannula
0.4mm O.D., 0.2mm I.D. tubing Autoclavable Biocompatible Perfluorocarbon tubing material
KZ1101
Micro Cannula, 3-inch
US$
96
This micro cannula is ideal for placement in the carotid or femoral artery of mice, rats, and other small animal blood vessels. It can be used with a pressure transducer (WPIS BLPR2) for blood pressure measurement, or in conjunction with a micro-syringe injection system (like WPIs UMPIII or MMP pumps). The incorporated standard female luer fitting makes connecting to existing experimental plumbing quick and easy. The cannula is provided with a contoured-tip stainless steel stylet (trocar) to facilitate placement using established techniques. A movable shoulder ring provides a tie-in point to prevent accidental removal. The cannula may be left in place for 2 hours or more, and with proper care and cleaning, may be re-used multiple times. Instructions for use included.
122
MicroFil
WPIs MicroFil fills micropipettes easily and reliably. Its long and fine tip allows you to start the filling very close to the pipette tip, eliminating both air bubble formation and clogging due to the washing down of dust particles. The transparent amber MicroFil needle is constructed from a combination of plastic and fused silica no metal components are used. The MicroFil needle can be stored for days with the filling solution inside without clogging.
The MicroFils tip elasticity is sturdy and very flexible though not unbreakable. Since it is more flexible than stainless steel needles, moderate bending will not block or damage the MicroFil needle. The combination of plastic and fused silica in the MicroFil tip is sturdier than plastic tips, allowing easy and repeated insertions into micropipettes. MicroFils luer fitting allows easy coupling to syringes and syringe filters. 1-5 pkgs US$ 59 US$ 59 US$ 59 6-10 pkgs US$ 49 US$ 49 US$ 49
GLASS, HOLDERS
U.S. PATENT 5,294,325
MF34G-5 MF28G-5 MF28G67-5
MicroFil, 34 ga., 67 mm long (pkg of 5) MicroFil, 28 ga., 97 mm long (pkg of 5) MicroFil, 28 ga., 67 mm long (pkg of 5)
CUSTOM MICROFIL
All MicroFil products, including custom orders, can be shipped immediately. Custom orders for special needs can be made using nine sizes of MicroFil tubing in lengths up to 50 cm except for CMF90UxxL which has a maximum length of 10 cm because of its high resistance to flow. Quantity discounts available. Specify length when ordering by inserting the length (in centimeter increments) into the catalog number in place of the XXs. CMF20GxxL CMF22GxxL CMF23GxxL CMF26GxxL CMF28GxxL CMF31GxxL CMF34GxxL CMF35GxxL CMF90UxxL MicroFil, 20 Gauge, 700 m ID, 850 m OD (pkg of 4) MicroFil, 22 Gauge, 530 m ID, 700 m OD (pkg of 4) MicroFil, 23 Gauge, 530 m ID, 665 m OD (pkg of 4) MicroFil, 26 Gauge, 320 m ID, 430 m OD (pkg of 4) MicroFil, 28 Gauge, 250 m ID, 350 m OD (pkg of 4) MicroFil, 31 Gauge, 100 m ID, 238 m OD (pkg of 4) MicroFil, 34 Gauge, 100 m ID, 164 m OD (pkg of 4) MicroFil, 35 Gauge, 75 m ID, 144 m OD (pkg of 4) MicroFil, approx. 36 Gauge, 20 m ID, 90 m OD (pkg of 4) 143 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143 US$ 143
US$ US$
Nonmetallic syringe needle for filling micropipettes
PolyFil
Multi-barrel micropipette coupling kit
& ELECTRODES
MicroFil inserted into each barrel
A drop of hot glue provides a secure, leak-free seal .
PolyFil allows easy and secure coupling of a multi-barrel micropipette to a pressure source. Coupling is achieved by bonding temperature-resistant and flexible MicroFil to the capillary tube with hot melt adhesive. The luer end of each MicroFil is connected to PVC tubing (200 PSI rated). Kits also include a five-port manifold that allows use of a single PV800 Series PicoPump to drive up to six micropipette barrels independently by switching on only the barrels to be injected. All connections are locking luers pressure safe and convenient. Kit includes: 1 pipette holder/handle, plastic; 7 pieces MF28G MicroFil; 7-pieces tubing with male luer lock fittings; 1 flow-thru manifold with five luer lock ports; 1 hot melt glue gun(110V only); 3 glue sticks. 5440 13316 PolyFil Multi-Barrel Micropipette Coupling Kit Mini Glue Gun and (3) glue sticks
US$ US$
Pipette pulled from multi-barrel glass capillary
210 20
123
Micropipette Holders & Half-Cells

WPIs microelectrode holder-half-cells couple fluid-filled glass micropipettes to high input impedance amplifiers. A Ag/AgCl pellet (or a silver wire) molded into the holder body provides stable potential. Electrical connection is made via male 2 mm pins or female 2 mm sockets. The pipette may be mounted axially or at right angles to the holder. Pipettes are held with screw-caps or rubber gaskets (without caps). Filling WPI microelectrode holders with electrolytes containing chloride results in stable electrode potential. Suitable electrolytes include KCl, NaCl and CaCl2. Holders are supplied for standard WPI single capillary tubing of 1.0, 1.2, 1.5 and 2.0 mm outside diameters. (Call WPI regarding custom designs for other glass diameters.) The holder style you select will depend on your experimental application, space, and instrumentation. Hints for selecting and ordering micropipette holders 1 . Determine the required electrical connection on the holder: for example, if you wish to connect the holder to a 2 mm pin you should select a holder equipped with a 2 mm jack. Most WPI probes require a holder equipped with a 2 mm jack. 2 . Decide on the required alignment of the electrical connection: either in-line with the glass pipette, or at a right angle to it. Space considerations in your experimental setup and requirements imposed by other pieces of equipment typically determine which alignment is appropriate. 3 . Determine if you want to hold the glass pipette by a rubber gasket (e.g., MEH1S) or a screw-cap (e.g., MEH3S). Rubber gaskets offer easier insertion and removal of glass pipettes whereas screw-caps provide more secure mounts for micropipetters. 4 . Choose a holder with either a silver wire or a silver/silver chloride pellet for the metal/liquid coupling. Silver/silver chloride pellets provide a more stable low-noise baseline which is important for low-noise DC recording. Pellets require the glass pipette and holder to be free of air bubbles to achieve a good connection. Silver wire holders are durable and are easier to use when the holder is equipped with a pressure port because the fluid in the pipette does not have to be filled to the top of the pipette to achieve a good electrical connection 5 . Choose a holder equipped with a pressure port only when you want to pressure inject liquid from the pipette. Two types of ports are available: 2.0 mm O.D. and standard syringe-style luer. The luer port is often recommended because it makes assembly and disassembly much easier. Quick-connect luer fittings for four common sizes of tubing (1/16", 3/32", 1/8", 5/32" I.D.) are included with each luer-equipped holder. 6 . Some non-WPI preamplifiers or headstages cannot be mounted on micromanipulators. In such cases, a holder equipped with a rod (e.g., MEH8) permits the holder to be conveniently mounted on a micromanipulator. 7 . Finally, remember to specify the O.D. of the glass you will be using when you place your order. MEH6RF/SF is designed primarily for use with the Model 900A Micropressure System; EHB1 for use in electrode beveling; and MEH3SW for microtitration of chloride with a silver wire as the electrode and a solution of silver nitrate filling the holder. MPH models do not contain Ag/AgCl half-cells and are used for pressure injection of substances through microelectrodes. PicoNozzle, used for pressure injection with PV800 Series PicoPumps, includes an MPH6S holder which may also be used to couple a micropipette to a syringe. APEH models are also designed for use in pressurized injection procedures.
2.500
2.500 1.2 mm
35.7 mm 35.7 mm
2 mm Pin to Ag/AgCl Pellet 9.5 mm DIA.
2 mm Pin to Ag Wire
APEH1
9.5 mm DIA.
APEH2
& ELECTRODES
35.
34.9 mm
25.4 mm 9.5 mm DIA. O-Ring O-Ring 2 mm Jack to Ag Wire
25.4 mm
9.5 mm DIA.
2 mm Pin to Ag Wire
EHB1
EHBF
1.2 mm 1.5 mm 0.250

0.250
MALE LUER PORT 1.5 mm
GLASS, HOLDERS
FOIMPH
Holder for P-5 and P-7 multibarrel glass (see al page 81) ion
126 mm 30 mm
FOIMPH-LF
t Op ndle Ha
20.7 mm
9.5 mm
6.3 mm DIA. 2 mm Pin to Ag/AgCl Pellet
Female Luer Port
for 3 mm OD glass 9.5 mm DIA.
MBMPH5-7
45
MEH145
20.7 mm
6.3 mm DIA.
20.7 mm Gasket
2 mm Jack to Ag/AgCl Pellet 45
MEH1F45
MEH1R
124
MICROELECTRODE HOLDERS
Order Number
Replace XX with glass diameter
APEH1xx APEH2xx EHB1xx EHBFxx FOIMPHxx FOIMPH-LFxx MBMPH5-7xx MEH145xx MEH1F45xx MEH1Rxx MEH1RFxx MEH1Sxx MEH1SFxx MEH2Rxx MEH2RFxx MEH2RFWxx MEH2RWxx MEH2Sxx MEH2SFxx MEH2SFWxx MEH2SWxx MEH345xx MEH3F45xx MEH3FW45xx MEH3Rxx MEH3RFxx MEH3RFWxx MEH3RWxx MEH3Sxx MEH3SBxx MEH3SBWxx MEH3SFxx MEH3SFWxx MEH3SWxx MEH3W45xx MEH6RFxx MEH6RFWxx MEH6SFxx MEH6SFWxx MEH7xx MEH7Wxx MEH8xx MEH900Rxx MEH900Sxx MPH1xx MPH3xx MPH4xx MPH6Pxx MPH6Rxx MPH6Sxx
Electric Connection Angle Right Right Straight Straight Straight Straight ---45 45 Right Right Straight Straight Right Right Right Right Straight Straight Straight Straight 45 45 45 Right Right Right Right Straight Straight Straight Straight Straight Straight 45 Right Right Straight Straight Right Right Right Right Straight Right Right
Connector Male Male Male Female Fiber Optic Fiber Optic None Male Female Male Female Male Female Male Female Female Male Male Female Female Male Male Female Female Male Female Female Male Male Banana Banana Female Female Male Male Female Female Female Female Male Male Male Male Male None None None Male Male None
Half-Cell Pellet Wire Wire Wire None None None Pellet Pellet Pellet Pellet Pellet Pellet Pellet Pellet Wire Wire Pellet Pellet Wire Wire Pellet Pellet Wire Pellet Pellet Wire Wire Pellet Pellet Wire Pellet Wire Wire Wire Pellet Wire Pellet Wire Pellet Wire Pellet Pellet Pellet None None None Pellet Wire None
Pressure Port No Port No Port No Port No Port No Port Male Luer Female Luer No Port No Port No Port No Port No Port No Port Male Luer Male Luer Male Luer Male Luer Male Luer Male Luer Male Luer Male Luer No Port No Port Port No Port No Port No Port No Port No Port No Port No Port No Port No Port No Port No Port 2.0-mm Port 2.0-mm Port 2.0-mm Port 2.0-mm Port 2.0-mm Port 2.0-mm Port No Port 2.0-mm Port 2.0-mm Port Female Luer Male Luer 2.0-mm Port Female Luer Female Luer Female Luer
Screw Cap 2 Caps 2 Caps N/A N/A w/Cap w/Cap w/Cap No Cap No Cap No Cap No Cap No Cap No Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap w/Cap
Designed for WPI Products
Price 59 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59 US$ 59
US$ US$
MBS, 48000 MBS, 48000 MBS, 48000 MBS, 48000
705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223
GLASS, HOLDERS
705, 773, 767, 721, FD223 705, 773, 767, 721, FD223
705, 773, 767, 721, FD223
705, 773, 767, 721, FD223 705, 773, 767, 721, FD223
ISO-80, ISO-DAM8A ISO-80, ISO-DAM8A 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223 705, 773, 767, 721, FD223
& ELECTRODES
900A 900A
Piconozzle Kit (5430-XX) Piconozzle Kit (5430-XX) Piconozzle Kit (5430-XX)
* Specify O.D. of glass (1.0, 1.2, 1.5 or 2.0 mm) by replacing XX in the Order Number with 10, 12, 15 or 20.
Handles and Accessories (not included) Handle #2505 is for use with WPI manipulators. The smaller diameter handle #5444 is required for use with Narishige and Zeiss manipulators. 2505 5444 GO1-100 GO2-100 GO3-100 GO4-100 1571 (6.3 mm) diameter handle (4.8 mm) diameter handle Replacement gasket 1.0 mm, Package of 100 Replacement gasket 1.2 mm, Package of 100 Replacement gasket 1.5 mm, Package of 100 Replacement gasket 2.0 mm, Package of 100 Clear Silicone Rubber Sealant (-4.7 oz-)
1 3
/4-in
/16-in
17 34 US$ 35 US$ 35 US$ 35 US$ 35 US$ 35

US$ US$
125
20.7 mm
33.5 mm 23.9 mm
23.9 mm
27.2 mm
Gasket 2 mm Jack to Ag/AgCl Pellet 6.3 mm DIA.
Gasket 2 mm Pin to Ag/AgCl Pellet 4.7 mm DIA.
2 mm Jack to Ag/AgCl Pellet 4.7 mm DIA.
Male Luer Port
MEH1RF
MEH1S
MEH1SF
MEH2R
& ELECTRODES
27.2 mm
27.2 mm
6.3 mm DIA.
27.2 mm 6.3 mm DIA.
36.7 mm 27.2 mm 6.3 mm DIA. Male Luer Port 2 mm Pin to Ag/AgCl Pellet
2 mm Jack to Ag/AgCl Pellet Male Luer port
Male Luer Port
2 mm Jack to Ag Wire 6.3 mm DIA.
Male Luer Port
2 mm Pin to Ag Wire
MEH2RF
MEH2RFW
MEH2RW
MEH2S
29 mm
6.3 mm DIA.
29 mm
36.7 mm 27.2 mm 6.3 mm DIA.
27.2 mm
6.3 mm DIA.
2 mm Jack to Ag/AgCl Pellet
Male Luer Port
Male Luer Port 6.3 mm DIA. 2 mm Jack to Ag Wire

2 mm Pin to Ag Wire
Male Luer Port
2 mm Pin to Ag/AgCl Pellet 45
MEH2SF
MEH2SFW
MEH2SW
MEH345
GLASS, HOLDERS
27.2 mm
6.3 mm DIA.
27.2 mm 6.3 mm DIA.
27.2 mm
27.2 mm
2 mm Jack to Ag/AgCl Pellet 45 45
2 mm Jack to Ag Wire
2 mm Jack to Ag/AgCl Pellet 6.3 mm DIA.
MEH3F45
MEH3FW45
MEH3R
MEH3RF
27.2 mm
27.2 mm
36.7 mm 27.2 mm 6.3 mm DIA.
35.2 mm 27.2 mm 6.3 mm DIA.
2 mm Jack to Ag Wire 6.3 mm DIA.
2 mm Pin to Ag Wire 6.3 mm DIA.
2 mm Pin to Ag/AgCl Pellet
MEH3RFW
MEH3RW
MEH3S
Mini-Banana Plug to Ag/AgCl Pellet
MEH3SB
126
35.2 mm 27.2 mm 6.3 mm DIA.
29 mm
29 mm 36.7 mm 27.2 mm 2 mm Jack to Ag Wire 6.3 mm DIA.
Mini-Banana Plug to Ag Wire
2 mm Jack to Ag/AgCl Pellet 6.3 mm DIA. 6.3 mm DIA.
2 mm Pin to Ag Wire
MEH3SBW
MEH3SF
MEH3SFW
MEH3SW
GLASS, HOLDERS
27.2 mm 6.3 mm DIA.
33.6 mm 29 mm 6.3 mm DIA.
33.6 mm 29 mm 6.3 mm DIA.
29 mm
6.3 mm DIA. 2.0 mm O.D. Port 2 mm Jack to Ag/AgCl Pellet
2 mm Pin to Ag Wire 45
2.0 mm O.D. Port
2 mm Jack to Ag Wire 2.0 mm O.D. Port
MEH3W45
MEH6RF
MEH6RFW
MEH6SF
29 mm
123.7 mm
6.3 mm DIA.
27.2 mm 2.0 mm O.D. Port
l na tio Op ndle Ha
123.7 mm
l na tio e Opandl H
123.7 mm
l na tio e Opandl H
27.2 mm 2.0 mm O.D. Port 2 mm Pin to Ag/AgCl Pellet 2 mm Pin to Ag Wire
27.2 mm
2.0 mm O.D. Port 2 mm Jack to Ag Wire
MEH6SFW
6.3 mm DIA.
MEH7
6.3 mm DIA.
MEH7W
6.3 mm DIA.
MEH8
& ELECTRODES
33.6 mm 29 mm
6.3 mm DIA.
36.7 mm 27.2 mm 6.3 mm DIA. 2.0 mm O.D. Port 2 mm Pin to Ag/AgCl Pellet
126 mm 30 mm
l na tio e Opandl H
123.7 mm
l na tio e Opandl H
27.2 mm
2.0 mm O.D. Port
Female Luer Port
Male Luer Port
MEH900R
MEH900S
9.5 mm DIA.
MPH1
6.3 mm DIA.
MPH3
42 mm
123.7 mm Optional Handle
42 mm
42 mm
27.2 mm 2.0 mm O.D. Port
6.3mm DIA. 4.7mm DIA.
Female Locking Luer Port 2 mm PIN to Ag WIRE 2 mm PIN to Ag WIRE 6.3 mm DIA.
Female Locking Luer Port
Female Locking Luer Port
6.3 mm DIA.
MPH4
6.3 mm DIA.
MPH6P
MPH6R
6.3 mm DIA.
MPH6S
127
BetterSkin Electrodes
ket soc lable! DIN avai now
WPIs unique Ag/AgCl pellet manufacturing process gives increased mechanical strength for extra durability Highly porous surface for low impendence, high current passing capability and stable, low noise measurements High flex cable comes in shielded and unshielded form (Carbon fiber cable for NMR environment is available upon request) Strong epoxy house increases durability and makes cleaning easy Ultra-high purity material for low offset and drift
sized electrodes (13-16 mm OD) are general purpose electrodes and appropriate for most applications. The 19-mm large size electrodes are designed for optimal surface skin contact for use during long-term biopotential recording. Three different connector and cable combinations are offered: a 2-mm pin with 1 meter unshielded cable; a 2-mm pin with 1 meter shielded cable (shielding is connected to an additional 2 mm grounding pin); and 1.5 mm DIN safety socket with 1 meter unshielded cable. All electrodes require adhesive disks (e.g., WPI's ADD200 series) and recording gel (GEL100). Bulk discount orders are possible and tradeinquiries are also welcome.
& ELECTRODES
GLASS, HOLDERS
WPI's new BetterSkinelectrodes are high quality Ag/AgCl reusable surface-mounted electrodes designed to be used for the acquisition of all biopotentials. Each electrode is fabricated using an optimum quality sintered Ag/AgCl pellet encased within a strong epoxy housing designed to have an extended lifetime. The result is a superior electrode that provides accurate and clear transmission of even the smallest surface biopotentials. In comparison to standard stamped metal electrodes and Ag/ AgCl disposable electrodes, WPI's BetterSkin electrodes provide increased stability, lower noise and lower offset voltage during surface biopotential recording. These features are particularly important during measurement of very small potential signals, such as EMG or EEG recording. Four BetterSkin electrode sizes are currently offered: 7-mm, 13-mm, 16-mm and 19-mm (OD). The 7-mm electrodes are designed for use where close spacing between biopotential recording sites is required. The medium
Skin Electrodes with 2 mm Gel Capacity and 1 m Lead

OD EL204 EL204S EL204D EL208 EL208WS EL208D EL208WD EL212 7 mm 7 mm 7 mm 13 mm 16 mm 13 mm 16 mm 19 mm
Discs
Sensor Housing Pin Ground DIN Electrode Adhesive Disc Shield Disc Price Diam. Height Diam. Pin Diam. Socket Price (pkg of 100) 4 mm 5 mm 2 mm ADD204 4 mm 5 mm 2 mm Yes 2 mm ADD204 4 mm 5 mm 1.5 mm ADD204 8 mm 6 mm 2 mm ADD208 8 mm 6 mm 2 mm Yes 2 mm ADD208 8 mm 6 mm 1.5 mm ADD208 8 mm 6 mm 1.5 mm ADD208 12 mm 7 mm 2 mm ADD212
Conductive Electrode Gel

A very high quality non-iritating conductive multipurpose electrode gel for use with skin electrodes that are not pregelled. Ideal for use in EEG, ECG, and EMG applications. Tube contains 8 oz. (250 g). Shipping weight: 1 lb. (0.5 kg). GEL100 Conductive Electrode Gel
Disposable Ag/AgCl Snap Electrodes

Disposable Ag-AgCl snap adhesive electrodes. Pre-gelled for simple peel and stick application. An ideal resting ECG electrode. Size: 0.875 x 1.75 inches. (Electrode lead available separately.) Ag/AgCl PROBES & Ag/AgCl SNAP ELECTRODES EL203 Disposable Snap Electrodes (package of 30) 500131 Snap Cable, 1m, 2mm pin (package of 5) 500330 Snap Cable, 7-lead, DIN (1.5 mm pin)
128
Ag/AgCl Half-Cells
EP05
EP08
New, improved sintered pellets with lower resistance and high strength. Stable and well balanced in the presence of current, these small and inexpensive half-cells are easy to work with as bath electrodes. RC1 RC1T RC2 RC2F RC3 RC4 RC5 RC6 EP05 EP08 EP1 EP2 EP4 EP8 EP12 3578 Reference Cell with 1.5 m lead Reference Cell, 1.5 m lead, 2 mm pin Reference Cell with 2.0 mm pin Reference Cell with female connector Reference Cell with epoxy body, 4.5 mm diam x 50 mm Reference Cell with glass body, 4.0 mm diam x 75 mm Reference Cell with glass body, 4.0 mm diam x 50 mm Reference Cell with glass body, 1.5 mm diam x 50 mm Ag/AgCl Electrode 0.5 mm diam x 20 mm Ag/AgCl Electrode 0.8 mm diam x 20 mm Ag/AgCl Electrode 1.0 mm diam x 2.5 mm Ag/AgCl Electrode 2.0 mm diam x 4 mm Ag/AgCl Electrode 4.0 mm diam x 1 mm Ag/AgCl Electrode 8.0 mm diam x 1 mm Ag/AgCl Electrode 12.0 mm diam x 1 mm Adapter Cable for Ag/AgCl Pellets
1 mm dia. 3 mm long Ag Wire 70 mm long
EP1
EP2
2 mm dia. 4 mm long Ag Wire 5 cm long
EP4
4 mm dia. 1 mm thick Ag wire 12 mm long
GLASS, HOLDERS
EP8
EP12
Ag wire 12 mm long
Ag wire 12 mm long
RC1 / RC1T
25.4 mm Insulator
15.9 mm 3.9 mm DIA.
13 mm
4 mm DIA.
8.5 mm #24 AWG insulated wire, 4 ft

RCI has an unterminated lead. RC1T is terminated with a 2 mm pin.
4 mm DIA.
2 mm DIA. Ag/AgCl Pellet
2 mm DIA. Gold Plated Pin to Ag/AgCl Pellet
RC2
RC2F
& ELECTRODES
25
mm
25
mm
50
mm
75
mm
glass body
epoxy body 3.5 mm diam. Ag/AgCl pellet 4.5 mm diam.
2.5 mm diam. Ag/AgCl pellet
RC3
4 mm diam.
RC4
25
mm
mm
1.5 m insulated lead
53
50
glass body
mm
glass body
2.5 mm diam. Ag/AgCl pellet
1 mm diam. Ag/AgCl pellet

4 mm diam. 3 mm
RC5
1.5 mm diam.
RC6
129
Epoxies
Carbon Epoxy (2 oz.) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133 Silver Epoxy (1 oz.). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
Adhesives
Scotch-Weld 4886 (2 oz.).. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132 Mini Glue Gun with hot melt glue sticks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133 Vetbond Adhesive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134
Silicone Adhesives
Kwik-Gard Sylgard in a mixing applicator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sylgard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kwik-Sil Silicone Adhesive Compound . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RTV Adhesive Sealant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RTV Coating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132 134 133 133 133
Sealants
Sylgard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 Kwik-Cast Silicon Casting Compound . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133 RTV Sealant. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
Primers
RTV Prime Coat. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
Super Adhesives
Cyanoacrylate adhesive, low viscosity. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 Cyanoacrylate adhesive, high viscosity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 Octyl Cyanoacrylate adhesive . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134
Specialty Wires
Carbon (with or without PVC coating) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Hastelloy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Indium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Micro Coaxial Cables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Platinum . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Platinum/Iridium (with or without Teflon coating) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Silver (with or without Teflon or PVC coating) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Stainless Steel (with or without Teflon coating) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Titanium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Tungsten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermocouple Iron plus Constantan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermocouple Chromel plus Alumel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 137 137 137 137 137 137 137 137 137 137 137 137
LAB SUPPLIES
Accessories
Barbed Tubing Assortment Kit ( polypropylene). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 138 Cables and Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 140 Clamps & Bases, Non-Magnetic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 142 Digital Caliper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 Digital Micrometer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 Glass Botom Culture Dishes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173 g-SPIN Microcentrifuge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 131 Lab Coat Light Weight, Medium Length . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 Luer-to-Tubing Coupler Assortment Kit (polypropylene) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 138 Luer-to-Tubing Coupler Assortment Kit (nylon). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 138 Luer Valve Assortment Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 138-139 Magnetic Heating Stirrer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 MicroFil Non-metallic Luer-tipped Tubing for Filling Micropipettes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 131 Rack Mount Hardware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136 Screwdriver Set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 Silicone Dissecting Pad Kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134 Wire Cutters. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135
130
g-SPIN
Microcentrifuge
l Small size with rubber feet keeps the centrifuge stable l Supplied with interchangeable rotors and adapters for 0.5mL-2.0mL microtubes and PCR strips l On/off switch lets you start and stop in seconds l Safety switch stops rotor without cover in place
g-SPIN SPEcIfIcAtIoNS
SPeed Range Max. RCF Tube CaPaCiTy ROTOR 6000 rpm, fixed 2000 g 6 x 0.5/2.0 mL tubes 2 x 0.2 mL strip tubes Fixed angle 6-place 0.52.0-mL tubes 2 strips PCR 0.2 mL tubes 6"W x 5"H x 7"d 110V 60 Hz or 220V 50 Hz
diMenSiOnS POWeR
Also available: 4,000 RPM and 10,000 RPM units call for details.
G-SPIN6 G-SPIN6-220 503529 503530 503531 503532 503537
Microcentrifuge, 6000 RPM, 110V 60 Hz Microcentrifuge, 6000 RPM, 220V 50 Hz, Ce Microcentrifuge tube, 0.5 mL, natural, bag/1,000 Microcentrifuge tube, 1.5 mL, natural, bag/1,000 Microcentrifuge tube, 2.0 mL, natural, bag/1,000 Microcentrifuge tube strips, 0.2 mL, and domed cap strips, bag of 250 Microcentrifuge tube strips, 0.2 mL, and flat cap strips, bag of 250
299 299 US$ 47 US$ 59 US$ 59 US$ 226 US$ 226

US$ US$
Microfil
WPis MicroFil fills micropipettes easily and reliably. its long and fine tip allows you to start the filling very close to the pipette tip, eliminating both air bubble formation and clogging due to the washing down of dust particles. The transparent amber MicroFil needle is constructed from a combination of plastic and fused silica no metal components are used. The MicroFil needle can be stored for days with the filling solution inside without clogging.
The MicroFils tip elasticity is sturdy and very flexible though not unbreakable. Since it is more flexible than stainless steel needles, moderate bending will not block or damage the MicroFil needle. The combination of plastic and fused silica in the MicroFil tip is sturdier than plastic tips, allowing easy and repeated insertions into micropipettes. MicroFils luer fitting allows easy coupling to syringes and syringe filters. 1-5 pkgs US$ 56 US$ 56 US$ 56 6-10 pkgs US$ 45 US$ 45 US$ 45
LAB SUPPLIES
Mf34G-5 Mf28G-5 Mf28G67-5
MicroFil, 34 ga., 67 mm long (pkg of 5) MicroFil, 28 ga., 97 mm long (pkg of 5) MicroFil, 28 ga., 67 mm long (pkg of 5)
Nonmetallic syringe needle for filling micropipettes
All MicroFil products, including custom orders, can be shipped immediately. Custom orders for special needs can be made using nine sizes of MicroFil tubing in lengths up to 50 cm except for CMF90UxxL which has a maximum length of 10 cm because of its high resistance to flow. Quantity discounts available. Specify length when ordering by inserting the length (in centimeter increments) into the catalog number in place of the XXs. US$ 137 cMf20GxxL MicroFil, 20 gauge, 700 m id, 850 m Od (pkg of 4) US$ cMf22GxxL MicroFil, 22 gauge, 530 m id, 700 m Od (pkg of 4) 137 US$ cMf23GxxL MicroFil, 23 gauge, 530 m id, 665 m Od (pkg of 4) 137 US$ cMf26GxxL MicroFil, 26 gauge, 320 m id, 430 m Od (pkg of 4) 137 US$ cMf28GxxL MicroFil, 28 gauge, 250 m id, 350 m Od (pkg of 4) 137 US$ cMf31GxxL MicroFil, 31 gauge, 100 m id, 238 m Od (pkg of 4) 137 US$ cMf34GxxL MicroFil, 34 gauge, 100 m id, 164 m Od (pkg of 4) 137 US$ cMf35GxxL MicroFil, 35 gauge, 75 m id, 144 m Od (pkg of 4) 137 US$ cMf90UxxL MicroFil, approx. 36 gauge, 20 m id, 90 m Od (pkg of 4) 137 131
cUStoM MIcrofIL
u.S. PaTenT 5,294,325
Adhesives Application Guide

Part No. Description
Epoxies 4898 7335 4886 Silver filled conductive Epoxy Carbon filled conductive Epoxy High performance Structural Epoxy
Curing time
12 hrs@50C; 5 min @150C 48 hrs@25C; 5 min @150C 12 hrs@25C.
Useful Applications and Characteristics

Form strong bonding. Used in wire bonding applications. Connecting conductors that can't be soldered. Constructing or connecting Ag/AgCl pellets. Constructing carbon electrode. Forms a strong and slightly flexible bond on plastic, metal, and glass. Bonds some low surface . energy plastic such as PEEK Easy to use for bonding, needs large gap filling Bonds wood, glass, metals, and many plastics. Good moisture resistant and elastic. Low toxic.
Hot melt (EVA) 13316 Mini Glue Gun with glue sticks Silicone Adhesives/Sealants/Primers 1571 Room temperature vulcanizing (RTV) adhesive. Acyloxy/moisture cure system. Acetic acid is cure by-product. 7128 SYLG184 RTV sealant. Alkoxy/Moisture cure system. Methanol as cure by-product. Sylgard, Two parts, vinyl/platinum cure sealant. Hydrogen as cure by-products. Very low toxic Two part, adhesive. Vinyl/platinum system, Hydrogen as cure by-products. Very low toxic.
As soon as it cools down
24hrs@25C 72hrs@25C
Has the best adhesion property in this silicone family. Will bond to many materials. Good for bonding or sealing electronics circuits (metal).
24hrs@25C, 15 min.@150C
Coating Patch Clamp electrodes, Cell culture dish, making dissection pads.
Kwik-Sil
< 5 min@25C
Live tissue and nerve studies. Medium strength adhesion.
Kwik-Cast
Two part sealant. Vinyl/platinum cure system. Hydrogen as cure by-products. Very low toxic. < 5 min@25C Primer for silicone N/A
Sealant for live tissues. Embedding peripheral nerves with electrodes. Enhances adhesion of silicone adhesives for difficult to bond plastic surfaces Forms an instantaneous bonding.
6820
Cyanoacrylate 7341 Ethyl Cyanoacrylate, low viscosity 90-120 cps 7342 Ethyl Cyanoacrylate, high viscosity 1100-1600 cps Butyl Cyanoacrylate, Low toxic Octyl Cyanoacrylate, Low toxic
<10 seconds <30 seconds <10 seconds <15 seconds
Mounting rat/mouse brain slices. Ideal for relatively small gaps and smooth surfaces.Bonds plastic, metals and rubber. Use on brain slice exp. Ideal for larger gaps, allows slightly longer bonding time. Bonds plastic, metals and rubber. Bonds tissues, alternative to suture, helps small wound healing. Antimicrobial effect. Used in forensic science. Suitable for surface wound bonding, protection, holding a sensor or other device on the tissue.
Vetbond 503763
LAB SUPPLIES
Kwik-Gard
Scotch-Weld 2216 Structural Epoxy
Kwik-Gard is specially packaged Sylgard 184 silicone for quicker and easier application, eliminating the messy procedure of preparing the mixture before application. Its special cartridge controls the precise mixing ratio to ensure proper curing. The disposable tip mixes resin and hardener as they are dispensed. Since no air is introduced during mixing, the resin does not need degassing for most applications. The mixed silicone is applied directly to the site, reducing preparation time and material waste. Each Kwik-Gard cartridge contains 37 mL of resin and hardener. The dispensing tip has a dead volume of 0.75 mL.
KWIKGARD Kwik-Gard Start-up Kit (incl. dispenser, 1 cartridge, 5 tips) US$137 KWIKGLUE Kwik-Gard Refill (2 cartridges, US$ 10 dispensing tips) 79 US$ KWIKMIX Dispensing Tips (pkg of 10) 35 US$ KWIKGUN Kwik-Gard Dispenser 114
Probably still the best epoxy for bonding plastic, often used as the benchmark for testing the binding strength of other adhesives. The slightly rubbery texture also makes it less easy to break off. It is the only epoxy known that can bond PEEK. Color: gray. Cures at room temperature.
Shipping weight: 1 lb. (0.5 kg) 4886 Scotch-Weld 2216 (2 oz.)

US$
56
132
Electrically Conductive Silver Epoxy

Two-component silver-filled epoxy for electrical connections which cannot be soldered, such as Ag/ AgCl pellets. This widely used silver-filled epoxy features low viscosity and smooth flowing character. Pure silver is dispersed in both resin and hardener. Cures in 15 minutes at 120 C. Mix ratio 1:1. May be premixed and frozen for later use. Shipping weight: 1 lb. (0.5 kg)
Silicone RTV adhesive (non-acidic)

Because it is non-corrosive, this material is ideal for use on metal, for encapsulating small circuits on connectors. After cure, will withstand -55 to 200 C. No mixing required. Shipping weight: 1 lb. (0.5 kg)
Silicone RTV adhesive

Clear silicone sealant provides good bonding to plastic. After cure, will withstand -55 to 200 C. No mixing required. A handy, general purpose laboratory sealant. (Releases acetic acid during curing.) Shipping weight: 1 lb. (0.5 kg)
4898
Silver Epoxy (1 oz.)
US$
213
Electrically Conductive Carbon Epoxy

Two-component carbon-epoxy, curable at room and elevated temperatures. Ideal for electrostatic discharge protection and EMI/RFI shielding. 1:1 mix ratio. May be premixed and frozen for later use. Shipping weight: 1 lb. (0.5 kg)
1571
US$
RTV Sealant (4.7 oz.)
US$
33
7128
RTV Coating (3 oz.)
56
RTV Prime Coat

Enhances adhesion of silicone adhesives to many difficult-to-bond plastic surfaces. Shipping weight: 1 lb. (0.5 kg)
Mini Glue Gun

Comes with three sticks of special formula hot melt glue. uL approved. 110V 60Hz only. Shipping weight: 1 lb. (0.5 kg)
US$
7335
Carbon Epoxy (2 oz.)
US$
155
6820
RTV Prime Coat, 400 ml (13.5 oz.)
52
13316
Mini Glue Gun
US$
20
Low toxicity 5-minute adhesives for live tissues!

Specially formulated for WPI Extremely low toxicity Excellent moisture resistance Cures at room temperature
The properties of this adhesive make it exceptionally useful for neuroscience applications, peripheral nerve studies and similar biomedical applications. These new silicone elastomers also eliminate the mess and time involved in pre-mixing other commonly used formulations (such as Wacker SilGel and Sylgard). Each silicone elastomer is packaged in a double barrel syringe and is automatically mixed when pressed out of the mixer tip provided. It can then be applied directly to the tissue without further mixing. The curing time of these silicones is short, reliable and reproducible thus eliminating potential costly guesswork when using other tissue adhesives. Furthermore, the curing process does not produce heat, which can otherwise cause tissue damage. WPIs silicone elastomers are much less toxic than dental silicone because they contain no surfactant additives. WPIs silicone elastomers are based on recently developed vinyl terminated siloxane and platinum complex catalysts. They exhibit exceptional low toxicity before, during and after curing. The traditional RTV silicone systems produce either acetic acid or alcohol during condensation; these compounds are toxic to living cells. In contrast, the only by-product of condensation from WPIs elastomers is a small amount of hydrogen gas, which was shown not to cause any effect on nerve activity in highly sensitive peripheral nerves. Both elastomers cure on contact with the tissue. Currently, WPI provides rapid-curing silicone elastomers in two different formulas: sealant. It is able to fill small spaces around nerves and creates a continuous mass ensuring longterm recording stability. KwikCast is color-coded so mixing is foolproof. It can be applied and cured underneath mineral oil. The slight longer curing time (approx. 3 minutes) makes it more suitable for stationary preparations and in vitro tissue studies.
10 mixing tips included

Kwik-Sil 1:1 2-10 minutes 15,000 90 ppi 650% 30 translucent 1x1015 0.5 lb Kwik-Cast 1:1 2-3 minutes 10,000 44 ppi 60% 36 green 1x1015 0.5 lb
KWIK-cASt & KWIK-SIL SPEcIfIcAtIoNS

Unmixed Mix Ratio Working Time, typically Viscosity, cps After Curing 24 hours: Tear Strength Elongation Durometer (shore A-2) Color Volume Resistivity, /cm Shipping Weight references Sivitz, et al., Effect of acute and antecedent hypoglycemia on sympathetic neural activity and catecholamine responsiveness in normal rats. Diabetes. 50:1119-1125, 2001. Andrews and Kunze. Voltage-gated K+ channels in chemoreceptor sensory neurons of rat petrosal ganglion. Brain Research, 897:199-203. April 2001.
LAB SUPPLIES
Kwik-Sil is a translucent silicone elastomer adhesive with medium viscosity. It has good adhesion 10 mixing tips and mechanical property (tear strength and elongation). included The very short curing time (approx. 1 minute) make it especially useful for moving preparations. Kwik-Cast is a very low
viscosity silicone elastomer
KWIK-SIL
KWIK-cASt
Silicone Adhesive Compound (two 5-mL syringes)

Silicone Casting Compound (two 5-mL syringes)
600009
Replacement Mixing Tips (pkg of 10) 1-5 pkg US$ 98 US$ 98 PrIcE BrEAK 6-9 pkg US$ 91 US$ 91
98 98 US$ 33
US$ US$
KWIK-cASt KWIK-SIL
More than 10 US$ 81 US$ 81
World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
133
Super Adhesives for Life Science research

Cyanoacrylate adhesives have been on the market since 1958. Most industrial or household grade cyanoacrylate is made of shorter alkyl chain derivatives such as methyl or ethyl cyanoacrylate (WPIs #7341 and #7342). They are very useful for temporarily holding tissues such as mounting specimens for microtome sectioning. However, they are not suitable for bonding wounds on live animals. The difficulties of using cyanoacrylate for bonding live animals are: (1) a strong, irritating odor; (2) quick loss of bonding strength due to breakdown of the bonding by hydration; (3) the breakdown products, cyanoacetate and formaldehyde, are toxic and can cause inflammatory reactions; and (4) they have low flexibility and tend to be brittle. To overcome these problems, several longer alkyl chain cyanoacrylates have been developed especially for veterinary and human use. The first longer alkyl chain product is butyl cyanoacrylate. This product has been used for animal and human applications outside the uSA since 1970. It is much less toxic and has a lower odor than the methyl or ethyl cyanoacrylate. The butyl cyanoacrylate offered by WPI is Vetbond. A family of adhesives containing octyl cyanoacrylate, a plasticizer and stabilizer, was developed In the 1990s (one of them approved by FDA for human use). When bonding to tissue, these new adhesives are four times stronger and less toxic than butyl cyanoacrylate. Compared with the traditional suture, the new super adhesive has several advantages. On average, it takes only one-tenth of the time to close an incision. The bonding strength is equal to 5-0 monofilament suture. It also has a mysterious antimicrobial effect that can decrease infection rates in contaminated wounds. Bonding will slough off naturally in 5 to 7 days. Cosmetic appearance of the healed incision is also better. Gluture Topical Tissue Adhesive #503763 forms a strong and flexible film and is thus more suitable for surface wound bonding, protection, and holding a sensor or other device on the tissue. Setting time is about 10 seconds, which gives ample time for application. It can also be used for temporarily holding a live tissue. For example, there is a report of using it to hold nematodes on a glass slide for patch-clamp neurons recording. All of the products offered by WPI are veterinary grade (not suitable for human application). Though very similar to the grade for human use, they are not sterile and do not have FDA approval. 503763 7341 7342 VETBOND
US$ Gluture Topical Tissue Adhesive (10 tips), 1.5 mL 56 US$ Cyanoacrylate Adhesive, low viscosity90-120 cps (pkg of 10) 40 Cyanoacrylate Adhesive, high viscosity1100-1600 cps (pkg of 10) US$40 US$ 3M Vetbond Adhesive (3 mL) 29
Sylgard
LAB SUPPLIES
A two-part silicone elastomer, ideal for potting and encapsulating applications. Very low dielectric constant sealing compound used in patch clamping and many other lab applications. After cure, will withstand -55 to 200 C. Shipping weight: 2 lb. (1 kg)
Silicone Dissecting Pad Kit
SYLG184
Sylgard (1.1 lb)
US$
114
Lab coat
LABcoAt-XS LABcoAt-S LABcoAt-M LABcoAt-L LABcoAt-XL Lab Coat, Extra Small Lab Coat, Small Lab Coat, Medium Lab Coat, Large Lab Coat, Extra Large
Light weight, medium length for the lab professional

29 29 US$ 29 US$ 29 US$ 29
US$ US$
Make your own silicone dissecting pads easily and quickly. Mix the 2-part silicone right in the plastic petri dishes and allow to cure 24 hours at room temperature. Kit includes enough silicone to prepare 20 dishes. Kit Includes: 2-Part Sylgard silicone elastomer 20 plastic petri dishes with lids, 65mm Pins 501986 Silicone Dissecting Pad Kit
US$
Quantity discount available 134
132
Digital caliper & Micrometer

The high quality electronic digital caliper and micrometer are useful tools no laboratory should be without one because they are more accurate and easier to use than the traditional analog units. Measure in either inches or millimeters at the touch of a button. The floating zero feature allows you to read the increment without calculation. Both of them have the SPC output 501601 503036 502157 for interface with external readout devices. The caliper is made from hardened stainless. The micrometer meets the IP54 as defined in the IEC529 standard that is resistance to dust and splashing water. The caliper measures up to 150 mm (6 inch) with 0.01 mm (or 0.0005") resolution. The micrometer measures up to 25 mm (or 1 inch) with 0.001 mm (or 0.00005") Digital Caliper Digital Micrometer Replacement Battery (package of 10) resolution. The micrometer is designed to be water-resistant to IP54 as defined in the IEC529 standard. The IP54 codes first digit 5 means dustprotected. The second digit 4 means that the caliper is protected against splashing water it has to withstand a shower from every direction for 10 minutes.
US$
75 148 US$ 35
US$
Digital Caliper
Digital Micrometer
Wire cutters
12cm long
Screwdriver Set
Notched blade
501321
Roger Wirecutting Scissors
US$
23 This production grade precision 5-piece screwdriver set is the highest quality tool you can find on the market. Made by German craftsmen, the chrome-vanadium tips will fit any screw securely without leaving marks. The set contains an ESD safe handle with 8 interchangeable blades. Phillips Sizes: 000, 00, 0, 1. Slotted Sizes: 1.5, 2.0, 3.0, 3.5 mm. The 000 size Philips blade is the smallest you can find anywhere it can fit smallest screw on a 35 mm camera. Weight: 0.24 lb
LAB SUPPLIES
Magnetic Heating Stirrer
501635
Professional Quality Screwdriver Set
US$
56
The Magnetic Heating Stirrer enjoys the advantages of convenience, stable and steady operation as well as indefinite speed regulation. It can carry out stable and precise agitation of solutions in a relatively common temperature range. It is especially suitable for agitation of small volume samples.
SPEcIfIcAtIoNS SPEED RANGE TRAy DIAMETER HEATING POWER POWER SuPPLy DIMENSIONS STIRRING POWER TEMPERATuRE 0-1400 rpm 12 cm 100 W AC 110 V / 50 Hz 23 x 16 x 10 cm 3-6W 20C - 210C
US$
501610
WPI-02 Magnetic Heating Stirrer
229
World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
135
rackmounting Hardware
Many instruments may be mounted in standard 19-inch instrument racks with the appropriate rackmount kit, as noted on the page featuring the instrument.
Brackets for instruments which are less than 17.5 inches wide have wings which extend to the standard rack width. (Pictured: #13024)
2932 3468
Rackmount Kit, 312-in. high Dual Rackmount Kit (705, A320, A362, A382, A385)
US$
114
3484
Rackmount Kit for DAM Series amplifiers
US$
114
US$
114
DAM Series amplifiers and Iso-DAM amplifiers may be mounted to the rack panels above by fastening bolts (included) through holes in the panel.
Rackmount Kit, 5 4-in. high

1 US$
2933 13025
114 114
2935
Rackmount Kit, 8 34-in. high
US$
114
Dual Rackmount Kit (TBM-4 & BP-1)
US$
LAB SUPPLIES
800283
Rackmount Kit with Handles
US$
114
3469
Single Rackmount Kit (705, A320, A362, A382, A385)
US$
114
13024
Single Rackmount Kit (TBM-4 & BP-1)
US$
114
Dual rackmount kits allow many smaller instruments to be joined by bolting the chassis together and mounting the pair into a standard rack. (Pictured: #2932)
136
Precious Metal and Specialty Wire

Catalog No.
AGt0510 AGt0525 AGt05100 AGt1010 AGt1025 AGt10100 AGt1510 AGt1530 AGW0510 AGW0530 AGW1010 AGW1030 AGW1510 AGW1530 AGW2010 AGW2030 AGW4010 AUW0170 AUW201 c3005 cPVc4050Y cPVc4050G cPVc4050r cPVc4050W cU7t44G IN1003 Pt1002 Pt0402 Pt0203 Pt0110 PtP101 PtP201 PtP401 PtP406 Ptt0502 Ptt0402 Ptt0203 Ptt0110 SS31605 SS31614 SSt30407-25 SSt30407-50 tcJ3050 tcK3050 tI2051 tI4024 tGW0325 tGW0515 tGW1510
Metal
Coating
AWG*
36 36 36 30 30 30 26-27 26-27 36 36 30 30 26-27 26-27 24 24 18 50 24 49 18 18 18 18 30 30 30 38 44 50 30 24 18 18 36 38 44 50 36 27 33 33 30 30 24 38 40 36 26-27
Diameter
Precut Length Price

10 ft (3 m) 25 ft (7.6 m) 100 ft (30 m) 10 ft (3 m) 25 ft (7.6 m) 100 ft (30 m) 10 ft (3 m) 30 ft (9.1 m) 10 ft (3 m) 30 ft (9.1 m) 10 ft (3 m) 30 ft (9.1 m) 10 ft (3 m) 30 ft (9.1 m) 10 ft (3 m) 30 ft (9.1 m) 10 ft (3 m) 70 ft (21 m) 1 ft (30 cm) 5 ft (1.5 m) 50 ft (15.2 m) 50 ft (15.2 m) 50 ft (15.2 m) 50 ft (15.2 m) 16.5 ft (5 m) 3 ft (91 cm) 2 ft (51 cm) 2 ft (51 cm) 3 ft (91 cm) 10 ft (3 m) 1 ft (30 cm) 1 ft (30 cm) 1 ft (30 cm) 0.5 ft (15.2 cm) 2 ft (51 cm) 2 ft (51 cm) 3 ft (91 cm) 10 ft (3 m) 50 ft (15.2 m) 30 ft (9.1 m) 25 ft (7.6 m) 50 ft (15.2 m) 50 ft (15.2 m) 50 ft (15.2 m) Call Call Call Call Call Call Call Call Call Call Call Call Call Call Call Call Call Call Call US$ 56 US$ 69 US$ 69 US$ 69 US$ 69 US$ 63 US$ 86 Call Call Call Call Call Call Call Call Call Call Call Call US$ 45 US$ 45 US$ 79 US$ 127 US$ 75
US$
Micro Coaxial Cables

New! Micro coaxial cables (MAXxxxx) are ideal for microelectrode fabrication and construction of similar research tools. The dual shielding eliminates electrical interference caused by radio frequencies (RF), electrostatic and microphonics (e.g., bending and vibration. Available with single or dual (twin) conductors. Thermocouple wire for temperature monitoring. TCJ3050, with an iron/constantan pair of wires, can be used in inert, vacuum, reducing or oxidizing atmospheres (iron conductor may rust in moist or low temperature applications). TCK3050 has a chromel/alumel pair, for use in inert or oxidizing atmosphere at 15001800 F. Teflon-coated stainless steel (type 304) wire (SSTxxxx) is available in 25-ft and 50-ft lengths. The Teflon coating is 150 micro-in. thick (4 m). Carbon wire (C3005) is a single 30-micron fiber of electrochemically activated carbon. This fiber is especially useful in micro-electrochemical experiments. Carbon filament wire (CPVCxxxx) is made of 3,000 microscopic carbon strands in a colored PVC jacket. 45.8 ohms/foot. Copper ultra-fine wire (CU7T44G) is made of seven individually insulated 44 AWG (50 micron) conductors twisted together. Total diameter with insulation is 200 microns. Resistance: 2.9 /m for all seven wires together. Dry dielectric strength: 1500V DC. Platinum/iridium wire uncoated (PTxxxx) and Teflon-coated (PTTxxxx) is an alloy of 90% platinum and 10% iridium, giving excellent tensile strength and corrosion resistance. uncoated pure platinum wire (PTPxxx) is 99.95% pure. Indium wire (IN1003) is 99.99% pure, with a melting point of 156.4C. Annealed silver wire (AGWxxxx), 99.99% pure, is available in five diameters; three of those sizes are also available with a Teflon coating (AGTxxxx). Tungsten wire (TGWxxxx), available in three diameters, is 99.95% pure. Gold wire (AUWxxxx) is 99.99% pure. Titanium wire (TIxxxx) is 98.9% pure, annealed, in two diameters. Stainless steel wire (SSxxxxx) is type 316.
Silver Teflon Silver Teflon Silver Teflon Silver Teflon Silver Teflon Silver Teflon Silver Teflon Silver Teflon Silver Silver Silver Silver Silver Silver Silver Silver Silver Gold Gold Carbon Carbon (46/ft) PVC (yellow) Carbon (46/ft) PVC (green) Carbon (46/ft) PVC (red) Carbon (46/ft) PVC (white) Copper Alloy Nylon/Polyurethane Indium Platinum / Iridium Platinum / Iridium Platinum / Iridium Platinum / Iridium Platinum Platinum Platinum Platinum Platinum / Iridium Teflon Platinum / Iridium Teflon Platinum / Iridium Teflon Platinum / Iridium Teflon Stainless Steel Stainless Steel Stainless Steel Teflon Stainless Steel Teflon Thermocouple Glass braid (Iron + Constantan) Thermocouple Glass braid (Chromel + Alumel) Titanium Titanium Tungsten Tungsten Tungsten Coaxial Twin Coaxial
2 4
0.005 in. (0.125 mm)1 0.005 in. (0.125 mm)1 0.005 in. (0.125 mm)1 0.010 in. (0.25 mm)1 0.010 in. (0.25 mm)1 0.010 in. (0.25 mm)1 0.015 in. (0.38 mm)1 0.015 in. (0.38 mm)1 0.005 in. (0.125 mm) 0.005 in. (0.125 mm) 0.010 in. (0.25 mm) 0.010 in. (0.25 mm) 0.015 in. (0.38 mm) 0.015 in. (0.38 mm) 0.020 in. (0.5 mm) 0.020 in. (0.5 mm) 0.040 in. (1.0 mm) 0.001 in. (0.025 mm) 0.020 in. (0.5 mm) 0.0012 in. (30 m) 0.040 in. (1.0 mm) 0.040 in. (1.0 mm) 0.040 in. (1.0 mm) 0.040 in. (1.0 mm) 0.010 in. (0.20 mm) 0.01 in. (0.25 mm) 0.010 in. (0.25 mm) 0.004 in. (0.102 mm) 0.002 in. (0.051 mm) 0.001 in. (0.025 mm) 0.010 in. (0.25 mm) 0.020 in. (0.5 mm) 0.039 in. (1.0 mm) 0.039 in. (1.0 mm) 0.005 in. (0.125 mm)1 0.004 in. (0.102 mm)1 0.002 in. (0.051 mm)1 0.001 in. (0.025 mm)1 0.005 in. (0.125 mm) 0.014 in. (0.36 mm) 0.007 in. (0.18 mm)3 0.007 in. (0.18 mm)3
0. 61 ! m m
LAB SUPPLIES
75
0.020 in. (0.5 mm) 0.040 in. (1.0 mm) 0.003 in. (0.075 mm) 0.005 in. (0.125 mm) 0.015 in. (0.38 mm)
24 ft (7.3 m)2 24 ft (7.3 m)2 25 ft (7.6 m) 15 ft (4.6 m) 10 ft (3 m) 20 ft (6 m)4 20 ft (6 m)5
US$ US$
316 183 US$ 79 US$ 79 US$ 79 102 114
Microcoaxial cables MAX3820 Tinned Cu Alloy MAX4020 Tinned Cu Alloy

*Brown & Sharpe
1 3 5
0.0173 in. (0.44 mm) 0.0158x0.024 in. (0.4x0.61mm)
US$ US$
Plus 0.002 in. for Teflon coating Teflon adds 0.00015 in. (4 m) to diameter
Furnished in bundles of 3-ft lengths.
Impedance: 50 ohm; capacitance: 95 pF/m; resistance: 5 ohm/m
Impedance: 100 ohm; capacitance: 54 pF/m; resistance: 1.9 ohm/m
137
Luer Valve Assortment Kit
A useful kit (above) for building your own liquid flow experiment. It provides the means to start, stop, add, divide and control a flow of liquid or gas. Included in the kit are over 200 assorted parts such as one-way and three-way stopcocks, manifolds, y-connectors, injection sites, male and female luer caps, check valves, syringe-activated check valves, slide clamps, roller clamps, and pinch US$ 14011 Luer Valve Assortment Kit 305 clamps. All (except clamps) have a luer fitting for quick and easy connecting and disconnecting. Includes assorted luer fittings for use with flexible tubing.
Barb-to-Tubing Coupler Assortment Kit
LAB SUPPLIES
Barb-to-Tubing Assortment Kit (at left) includes three different sizes of tubing and two boxes with different fittings, T-connectors, elbow connectors, check valves and plugs. 500890 Barb-to-Tubing Assortment Kit (polypropylene)
US$
190
Includes 25ft. each of three tubing sizes: 1/16" ID, 1/8" ID, 1/4" ID
Luer-to-Tubing Coupler Assortment Kit

Assemble quick-disconnect luer fittings for use with flexible tubing with internal diameters of 116", 332", 18" and 532". A variety of quick-disconnect connectors can be quickly made for connecting small diameter flexible tubing; 3-way connections can be made with the use of the 3-way luer tee; luer plugs, tees, connectors, bulk-head mounts, color coding rings, locking nuts, male and female luersare all included to enhance the versatility of this kit. The kit has 253 assorted parts and is offered in two different types of materials. Polypropylene fittings are chemically inert and resistant to most organic and inorganic solvents. Nylon fittings are strong and can be bonded with adhesive. US$ 14012 Luer-to-Tubing Coupler Assortment Kit (Polypropylene) 190 US$ 500895 Luer-to-Tubing Coupler Assortment Kit (Nylon) 190
14012
500895
138
#14034-40 Injection Site Male luer lock Pack of 40 US$ 68
# 14039-10 Check Valve Pack of 10 US$ 68 # 14044-5 Syringe Activated Dual Check Valve Pack of 5 US$ 68 # 14041-60 Roller Clamp 3 " Tubing 16 Pack of 60 US$ 68 # 14045-20 Syringe Slip Luer Valve Activated Check Pack of 20 US$ 68
# 13822-10 0.135/3.4 mm OD Tubing Pack of 10 US$ 68 # 14043-20 Roller Clamp Large Bore Pack of 20 US$ 68 # 14040-50 Pinch Clamp for 7mm Tubing Pack of 50 US$ 68
# 3742-20 Female T Luer Pack of 20 US$ 68
# 14047-10 4-Port Infusion y Swivel Thread Pack of 10 US$ 68 # 14057-10 4-Way Stopcock, Luer Lock Pack of 10 US$ 68
# 14048-20 3-Port Infusion y Swivel Thread Pack of 20 US$ 68 # 14058-10 4-Way Stopcock, Luer Lock Pack of 10 US$ 68
# 14036-15 4-Way Luer Stopcock Pack of 15 US$ 68
# 14035-10 3-Way Stopcock, Luer lock, Pack of 10 US$ 68
# 14051-100 Pinch Clamp for 5mm Tubing Pack of 100 US$ 68
Buy parts from Luer Valve Assortment Kit 14011 individually
Parts in kit may differ slightly in appearance from those pictured.

# 14055-2 4-Port Manifold (6 Female Ports) Pack of 2 US$ 68 # 14059-2 3-Port Manifold (5 Female Ports) Pack of 2 US$ 68 # 13158-100 Female Luer Fitting for
1 " ID Tubing 8 Pack of 100 US$ 68
#14038-10 1-Way Stopcock Luer Lock, Pack of 10 US$ 68
# 14054-10 1-Way Stopcock, Luer Slip Pack of 10 US$ 68
# 13156-100 Female Luer Fitting for

5/ " ID Tubing 32 Pack of 100 US$ 68
# 13160-100 Male Luer Fitting for

1 16" ID Tubing Pack of 100 US$ 68


1 " ID Tubing 8 Pack of 100 US$ 68

LAB SUPPLIES
World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com # 14061-60 Male/Female Luer Plug Pack of 60 US$ 68 # 14042100 Slide Clamp for 2.5 mm O.D. Tubing Pack of 100 US$ 68
Parts now sold individually
16" ID Tubing Pack of 100 US$ 68
3/
32" ID Tubing Pack of 100 US$ 68
139
cables and connectors

#13620 #1358 #5372
#3161
#3294
#3492 #2851
#3142 #3417-10 #3517 #3491 #5371 #5385 #5373 #3670 #5375 #13388 #13776 #13347 #500082 #5374 #3508
#13451
LAB SUPPLIES
#13324
#500131 #14254 #15975 #15976
#500081
#13854
#3578 #300040
#300102 #15623 #500256 #13685 #500128 #300344

140
PArt # 1358 2026-10 2851 3142 3161 3294 3417-10 3491 3492 3508 3517 3578 3670 5371 5372 5373 5374 5375 5385 13324 13347 13388 13451 13555 13620 13685 13776 13854 14254 15623 15624 15975 15976 300040 300344 500081 500082 300102 500128 500131 500184 500256 500257 500258 500259 501670 503301 503536 cBL100 cBL102 PoWEr corDS 3006 3301 3302 14088
APPLIcAtIoN/DEScrIPtIoN Beetrodes 2 mm socket, unwired (pkg of 10) (Not Shown) Standard BNC cable Mini-Banana Adapter Connector for input to TBM4M and BP-1 Ground wire for DAM80 probe 2 mm plug, unwired (pkg of 10) Extension for any 8-pin DIN Connector, adapts WPI transducers to non-WPI equipment Adapts BNC pH electrode to pH meter with U.S. Standard input DAM50, DAM60, DAM70, shielded (two cables/pkg) Adapter cable for Ag/AgCl pellets Double banana plug with solder turret terminals Low-noise cable for microelectrode holders Low-noise cable for microelectrode holders Low-noise cable for microelectrode holders Low-noise cable for microelectrode holders Low-noise cable for microelectrode holders Cable, shielded transducer stock Adapter ISO2 (chart recorder adapter) Electrode adapter for DAM probes Adapter: Iso-DAM, Iso-DAM8 Serial Cable (not shown) Low-noise cable for microelectrode holders SP Series pump-to-pump linking cable Adapts reference electrode to VF4 ground jack BNC T-connector, male to: BNC Straight Adapter Serial cable and adapter, SP Series pump Serial cable and adapter, SP Series pump Adapter Adapter Adapter Extension Cable Adapter IBM PC Comm Port Adapter BNC/RCA MM Adapter Extension BNC Zero Ohm Terminator Cable for Biode Snap Electrodes (assembly of 5) Standard BNC Cable BNC Right Angle Adapter Standard BNC Cable Standard BNC Cable Standard BNC Cable Coaxial Adapter Cable, Extension Cable, USB MiniPhone Patch Cable DAM Series, PM Series US 120 V, grounded European 240 V, grounded British 240 V, grounded Australian 240 V, grounded
coNNEctor A BNC (male) 2 mm socket BNC (male) Screw Terminals DIN (male) Clip 2 mm pin DIN (male) DIN (female) BNC (male) Modular phone plug, 4 wire 2 mm pin Dual Banana (male) 2 mm gold pin 2 mm gold jack 2 mm gold pin/jack BNC (male) BNC (male) none Double-banana (female) Double-banana (male) Miniature banana (male) BNC (female) DB9 (male) 2 mm gold pin Modular phone plug Banana (male) BNC (female) BNC (female) SP Pump SP Pump 2 mm socket 1 mm socket 2 mm socket DIN DB9 (male) BNC (female) 2 mm socket BNC (male) 2 mm pin BNC (male) BNC (male) BNC (male) BNC (male) BNC (male) Dual Mini-Banana (male) 8-pin miniDIN (male) USB (male) 3.5 mm MiniPhone plug 3.5 mmMiniPhone plug IEC Connector IEC Connector IEC Connector IEC Connector
coN NEctor B 2 mm pin unwired BNC (male) Dual Mini-Banana unwired none unwired DIN (female) unwired US Standard none none Dual Banana (female) 2 mm gold pin 2 mm gold jack 2 mm gold pin/jack 2 mm gold pin 2 mm gold jack none BNC (male) BNC (female) 2 mm jack two 2 mm pins DB9 (female) 2 mm gold jack Modular phone plug 2 mm jack BNC (female) BNC (female) IBM 9-pin D connector Macintosh connector 1 mm pin 2 mm pin 2 mm socket BNC DB9 (female) RCA (male) 0.31 socket none snap BNC (male) BNC (female) BNC (male) BNC (male) BNC (male) BNC (female) 8-pin miniDIN (female) USB (female) 3.5 mm MiniPhone plug BNC (male) 3-pin (M) US 3-pin (M) European 3-pin (M) UK 3-pin (M) Australian
cABLE LENGtH 3 ft (0.9 m) none 5'2" none none 3 ft (0.9 m) none 5 ft (1.5 m) none none 3 ft (0.9 m) 5 ft (1.5 m) none 2 ft (0.6 m) 2 ft (0.6 m) 2 ft (0.6 m) 4 ft (1.2 m) 4 ft (1.2 m) 25 ft (7.6 m) none none none 6 in. (15 cm) 6 ft (1.8 m) 2 ft (0.6 m) 7 ft (2.1 m) none none none 5 ft (1.5 m) 5 ft (1.5 m) none none 4 in. (10 cm) none none 4 in. (10 cm) none 39 in. (1 m) 10 ft (3 m) none 6 in. (15 cm) 12 in. (30 cm) 18 in. (46 cm) none 10 ft (3 m) 10 ft (3 m) 6 ft (1.8 m) 6 ft (1.8 m) 6 ft (1.8 m) 6 ft (1.8 m) 6 ft (1.8 m) 6 ft (1.8 m)
PrIcE 52 24 US$ 30 US$ 25 US$ 29 US$ 10 US$ 24 US$ 127 US$ 21

US$ US$
45 102 US$ 46 US$ 15 US$ 21 US$ 22 US$ 24 US$ 40 US$ 40 US$ 124 US$ 28 US$ 29 US$ 75 US$ 29 US$ 39 US$ 22 US$ 15 US$ 15 US$ 15 US$ 15 US$ 39 US$ 39 US$ 15 US$ 15 US$ 79 US$ 91 US$ 21 US$ 9 US$ 95 US$ 6 US$ 33 US$ 32 US$ 15 US$ 22 US$ 22 US$ 22 US$ 63 US$ 46 US$ 33 US$ 16 US$ 32
US$ US$
LAB SUPPLIES
21 26 US$ 32 US$ 32
US$ US$
#cBL100
#cBL102
#15624
141
frameWorks Non-Magnetic Bases, Stainless Steel rods, & clamps

These high quality components are made of stainless steel and polymer that resist organic solvents and corrosion. They can be easily assembled to make a stand-alone setup for student labs or to make a complicated frame for research labs.
43
503081-4 Vertical Surface Mount, M8 Threaded
m m
503085
Large V-base with M8 Thread Mount
LAB SUPPLIES
502190 Heavy Rectangular Base (with M8 thread mount ................... and thumbscrew mount), 2315.6 cm, 4 lb 503083 Light Rectangular Base (with M8 thread mount ...................... and thumbscrew mount), 2315.6 cm, 0.5 lb
503084
Small V-base with M8 Thread Mount
503088-10 Thumbscrew, M520 mm (pkg of 10)
503070 503071 503072 503073 502191 503075 503076 503077
Polished Stainless Steel Post, 12mm OD, 25cm long, no thread Polished Stainless Steel Post, 12mm OD, 50cm long, no thread Polished Stainless Steel Post, 12mm OD, 75cm long, no thread Polished Stainless Steel Post, 12mm OD, 25cm long, M8 thread Polished Stainless Steel Post, 12mm OD, 50cm long, M8 thread Polished Stainless Steel Post, 12mm OD, 60cm long, M8 thread Polished Stainless Steel Post, 12mm OD, 75cm long, M8 thread Polished Stainless Steel Post, 12mm OD, 80cm long, M8 thread
142
14073-4 Open-sided Frame Clamp (pkg of 4)
503082-4 Board Frame Clamp, opens up to 8.5 mm (pkg of 4) 503078-4 T-joint Frame Clamp (pkg of 4)
502193-4 Parallel Frame Clamp (pkg of 4)
503079-4
In-line Frame Clamp (pkg of 4)
38.7 mm
503080-4 Frame Clamp with Parallel Surface Mount (including two 10-32 mounting screws) (pkg of 4)
503041 Large Clamp with Rod (157 mm), opens up to 85 mm
LAB SUPPLIES
503042 Medium Clamp with rod (157 mm), opens up to 45 mm
503086
Small Clamp with rod (157 mm), opens up to 16 mm
143
Motorized Micromanipulators
PiezoPatchTM: Piezo-motorized Micromanipulator suitable for patch clamp and IVF . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .145
M ICROMAN I PU LATORS
MPM10: Piezo Controller for DC3001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .147 MPM20: Piezo Translator for M3301/DC3001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .147 SM325: Compact Programmable High Precision 3-D Micromanipulator System suitable for patch clamp and IVF . . . . . . . . . . .148 HS6-3: Solid Programmable Ultra High Precision 3-D Micromanipulator System suitable for patch clamp and IVF . . . . . . . . . .149 DC3314: 3-D Motorized Micromanipulator System with Manual Adjustment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 MM3-MS: Miniature Programmable 1-D Micromanipulator System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150
Manual Micromanipulators
MM1 & MM1-3: One & three-axis small miniature micromanipulators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150 MM3 & MM3-3: One & three-axis medium miniature micromanipulators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150 KITE: Economic 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .152 M3301: Most Popular 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .152 HS6: Solid High Precision 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .154 MMJR: Additional joystick controller on regular 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .154 MD4R: Dual Tool Holder 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .155 M325: Compact Backlash-Free 3-D micromanipulator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .155
Stands & Accessories

NEW! Vibration Isolation Platform . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .159
Vibration-Free Workstation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .159 Digital Micrometer Head with Non-rotating Spindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .146 UMS: Stable Universal Manipulator Stand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .146 TB-1 & M3: Compact Tilting Bases and Weight for Micromanipulators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .152 TBS: Solid Tilting Base for Micromanipulators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .153 Optional Mounting Devices: Clamps and Microscope Stage Adapter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .153 Magnetic Holding Devices: Easy to mount Micromanipulators at desired heights and angles . . . . . . . . . . . . . . . . . . . . . . . . 156-158 Non-Magnetic Bases, Rods & Clamps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .142
144
PiezoPatch Micromanipulator
PiezoPatchTM Micromanipulator (PPM5000) is a unique piezo-motor driven micromanipulator with ultra high resolution (<1 nm/step), super low drift (<4 nm/h), and long travel range (~10 mm/axis) . It is ideal for patchclamp, electrophysiology and other high precision applications within the life sciences . PiezoPatch establishes a new standard in micromanipulator design . At the heart of the PiezoPatch is WPIs proprietary SonicWaveTM piezomotor that is controlled at 1 arc-second (13600 of a degree) per step . This angular resolution translates to a theoretical linear movement of ~0 .4-nm per step, an ultra high resolution that is beyond normal measurement capability using standard methods . Another key advantage of the PiezoPatch motor is the extreme stability . When de-energized, the SonicWaveTM motor is completely locked with absolutely no rotation . This locking mechanism completely eliminates mechanical drift in the micromanipulator . This design is significantly different compared to all other types of electromagnetic motors or piezo-operated micromanipulators, which still require electric power to hold at the stopped position . Electric power can introduce electrical noise, which can interfere with experimental measurements . Furthermore, instabilities in electrical power supply can cause drift of the micromanipulator . Thermal drift is also caused by heat generated in the stopped motor . These problems are completely eliminated by the PiezoPatch SonicWaveTM motor, since it does not require power to maintain its stopped position during the experiment . One additional feature of the SonicWaveTM motor is its extremely high output torque compared to motors of same size . This enables skip free precise movement of the micromanipulator even under heavy load . PiezoPatch has three distinct movement modes: Step, Continuous, and Penetration . Continuous mode allows the micromanipulator to move quickly (continuously) from the starting position towards the object . Step mode enables ultra fine movements to be controlled by a single step in increments as small as 1 nm per step . Penetration mode is used when the glass micropipette is positioned close to the cell membrane and the x-axis piezo motor is then activated using the joystick button . This causes the micropipette to penetrate the membrane at high speed while minimizing membrane disturbance . The ergonomic joystick controller can move each axis or all axes in three coordinate directions simultaneously . The speed of the travel is determined by the deflection on the joystick . Since each movement is too
M3301EH Electrode Holder included
Headstage adapter included
501622 Universal Micromanipulator Stand available separately
Vibration-free Platform (VFP) not included
PPM5000 SPECIFICATIONS
TRAVEL DISTANCE VELOCITY RANGE PENETRATION MODE CONTINUOUS MODE STEP MODE RESOLUTION CONTINUOUS MODE STEP MODE DEPTH OF PENETRATION STEP SIZE MODE LONG TERM STABILITY: OPERATING VOLTAGE: SINGLE AXIS CONSUMPTION, MAX . SPEED: TOTAL CONSUMPTION, MAX . SPEED: DIMENSIONS: ELECROMECHANICAL MODULE: CONTROLLER: WEIGHT ELECTROMECHANICAL MODULE: CONTROLLER: 2 .2 kg 0 .65 kg 10 .4(h) x 4 .7(w)x 5 .1(l) in . 265(h) x 120(w) x 130(l) mm 3 .9(h) x 3 .9(w) x 4 .9(l) in . 165(h) x 100(w) x 125(l) mm 0 .5-5 m per step <4 nm drifting/hour @ 20 C 12V DC <300 mA <900 mA 0 .1 m 0 .001 m per step 10mm/s - 100mm/s 0 .5-500 m/s 0 .005- .5 m/s 10 mm each axis
fine to be visually observed, a specially designed acoustic feedback control is included to keep operators aware of the actuation of the manipulator . To improve the productivity during use, the micropipette can be exchanged rapidly without remounting the entire micromanipulator and spending hours repositioning the capillary . The Rotary Pivot Base allows the micromanipulator to rotate 360 horizontally . This base has a special mounting pattern allowing it to be mounted directly on to a standard Vibration-Free Platform (VFP), Vibration-Free Workstation (VFW), or a Universal Manipulator Stand (501622 or 501623) . The universal capillary holder and headstage adaptor can be easily rotated and adjusted to the desired height and angle . The headstage adaptor fits most headstages from Axon and HEKA and can be customized to fit other manufacturers headstages (contact WPI) . PiezoPatch is designed to be fully ambidextrous, therefore there is no need to purchase both left-handed and right-handed versions to fit everyone in the lab . PPM5000 PiezoPatch Micromanipulator with Joystick Control OPTIONAL ACCESSORIES M3301EH Replacement Electrode Holder, straight, 14cm 15873 Angled Electrode Holder, 13 cm long 501622 Universal Micromanipulator Stand, 30 cm high 501623 Universal Micromanipulator Stand, 45 cm high VFP Vibration-Free Platform Vibration-Free Workstation see page 159
145
Non-rotating Spindle Digital Micrometer Head

Build your own precision micro-positioning device
502102 SPECIFICATIONS
Total Travel Distance Resolution Accuracy 25 mm 0 .001 mm 0 .003 mm 8 mm 12 mm x 10 mm 166 mm Absolute and incremental mm or inch mm RS232 IP54 0 .51 kg (1 .12 lb)
Spindle Diameter Mounting Total Length Measurement Mode Digital Readout Analog Readout Data Output Environmental Protection Shipping Weight
The new non-rotating spindle digital micrometer head allows you to create your own micropositioning instrument . With micron-level accuracy, it gives higher precision than a normal micromanipulator . Since the spindle does not rotate as it advances,
instruments can be directly attached without the need for a complicated decoupling device . The digital display eliminates the need to squint at the notational scale . Readings can be clearly seen in either inches or millimeters . You can read both absolute position and the increment relative to a previously chosen point . 502102
Non-Rotating Spindle Micrometer Head
Universal Manipulator Stand

Universal Micromanipulator Stands enable scientists to mount their manual and motorized micromanipulators at variable angles and heights . A solid aluminum platform with a grooved tower allows the user to attach any micromanipulator of any size or shape to the post for infinite flexibility . Once mounted, the micromanipulator can be set at any height along the entire length (30 cm or 45 cm) . The platform base comes configured with industry standard pre-bored holes (1/4-20 x 1 or M6 x 25 mm), allowing direct mounting to any type vibrationfree table (for patch clamp recordings) or optical bench (for laser and optical measurements) . Using additional Rotation Clamps (one included with stand), two or more micromanipulators can be mounted on the stand simultaneously in a space-saving convenient manner . WPIs Universal Stand not only allows the user 360 flexibility in manipulations but also promotes independent angular transitions using a single feather-light tensioner/adjustment screw . This affordable stand is currently the preferred choice in micromanipulator stands head and shoulders above setups using multiple magnetic-based stands costing hundreds more when combined with antiquated heavy steel base plates .
UMS SPECIFICATIONS
DIMENSIONS Base plate Stand Mounting holes 10 .0 x 12 .5 x 1 .5 cm (LxWxH) 4 .0 x 4 .0 x 30 cm (LxWxH) (501622) 4 .0 x 4 .0 x 45 cm (LxWxH) (501623) English 1/4 20 x 1 (2 bolts supplied) Matrix M6 x 25mm grid (2 bolts supplied) SHIPPING WEIGHT 501622 501623 9 lbs (4 kg) 11 lbs (5 kg)
501622 501623 501624 VFP
Universal Micromanipulator Stand 30 cm high (includes one clamp) Universal Micromanipular Stand 45 cm high (includes one clamp) Optional Rotation Clamp Vibration-Free Platform Vibration-Free Workstation see page 159
Vibration-free Platform (VFP) not included

146
High speed penetration and precise control

The piezo-ceramic element in WPIs MPM10 provides high penetration speed over an extremely short distance (0 .5 to 10 .0 m) . Because the range of travel of a dedicated piezomanipulator is much too limited for it to be useful independently, it must be mounted on a manipulator . The MPM-10 piezo translator combined with a DC3001 motorized micromanipulator (available separately) provides a single electronically controlled system . When the piezo element is activated, the MPM-10 axis carrying the micropipette shoots forward at a rate which is set on the control panel, then immediately returns (at a slower speed) to its starting position . As soon as the piezo element begins its reverse travel, the motorized manipulator starts to travel forward . The complimentary opposition of these two travel sequences results in the micropipette tip remaining in its advanced absolute position . The three axes of the DC3001 are controlled by six buttons . Pressing a button for less than 0 .3 seconds activates one step, the size of which (0 .5 to 10 .0 micron) is set on the Step Size control . Pressing longer activates the continuous mode, at the rate set on the Motor Speed control . Pressing the button for the X axis forward direction activates the piezo mode . Advancement speed of the piezo element can be separately adjusted from 1 to 100 mm/sec . Precise construction and special vibration stabilizers ensure the MPM-10s excellent
MPM10
Piezo-Translator
Adapter MPH8 allows use of WPI electrode holders!
DC3001 micromanipulator and M-3 tilting base not included.

puncture characteristics . Lateral deviation from the ideal axis of puncture (measured at the tip of the electrode holder) is 5% of the step size . SYS-MPM10 PM5 PM6 14104 MPH8 M-3 Includes controller, piezo translator, electrode holder, cables and mounting bracket. Shipping weight: 6 lb (2.7 kg).
Piezo Controller for DC3001 Motorized Micromanipulator Remote Controller for MPM-10 Replacement Electrode Holder for MPM10 Record/Inject Electrode Holder for MPM10, MPM20 Electrode Holder Adapter for MPM10 & MPM20 80 Tilting Base 6mm x 1mm screw (Shipping Weight: 2 lb) Specify line voltage
Adapter MPH8 allows use of WPI electrode holders!
Piezo Translator
For use with M3301 and DC3001 micromanipulators
Especially recommended for use with the M3301 micromanipulator, the MPM20 is a very efficient tool for intracellular injection . High penetration speed and precise axial advance allows injection pipette to be brought to its target position with tremendous accuracy . Lateral escape of the cell is almost eliminated, and even tough membranes can be penetrated . Independently selectable reverse speed setting can be used for fast withdrawal, preventing adhesion of the injected cell to pipette tip . Mounts directly onto DC3001 and M3301 micromanipulators . Use with DC3001 requires MS314 controller (for the micromanipulator) . The combination of the MPM20, a micromanipulator, and the PV820 PicoPump (see page 194) constitutes an extremely efficient system for intracellular injection; cell penetration, injection and withdrawal are executed automatically with the press of a button . Shipping weight: 10 lb ( 4 .5 kg ) . SYS-MPM20 PM7 14106 Piezo Translator Replacement Electrode Holder for MPM20 Footswitch for MPM20 Specify line voltage
MPM20
Micromanipulator not included.
147
Programmable High Precision
Motorized Micromanipulator
suitable for patch clamp and IVF
WPI introduces a compact high precision motorized micromanipulator (SM325) . It features low noise, high stability, a userfriendly software interface and economy that are major concerns in IVF and patch clamp research . The SM325 is driven in all three axes through high resolution stepping motors, which can achieve 40,000 steps per revolution (25 nm/step) with completely vibration-free motion . In a normal lab environment, it can stay localized overnight without drifting . The 25mm long range of travel makes it unnecessary to have an additional manual coarse adjustment . Its compact construction makes mounting onto the stage plate of a microscope practical . The x-axis can be tilted by 90 that allows for a better positioning of the injection tool . An additional tilting fixture makes it possible to tilt the tool holder for fast and easy cleaning and exchange of the injection tool . The MCL3 controller features a dynamic micro-step function that makes very quick positioning possible with maximum accuracy . Motor control is achieved with a linear output amplifier, which also drastically reduces electronic noise . Users can control the micromanipulators by joystick, keyboard, mouse or computer . The user-friendly software program can be enabled to remember up to 999 position coordinates from previous procedures and can robotically repeat this same positioning sequence .
SM325-M
MCL3-SM325 Universal Manipulator Stand not included.
SM325 SPECIFICATIONS
CONTROL METHOD TRAVEL DISTANCE RESOLUTION MAXIMUM SPEED POWER SUPPLY DIMENSIONS SM325-M MCL3 SHIPPING WEIGHT SM325-M MCL3 6 lb . (2 .7 kg) 11 lb . (5 kg) 5x7x5 .5 in . (13x18x14 cm) (WxLxH) 9 .8x9x3 .7 in . (25x23x9 .5 cm) (WxLxH) Joystick, software, or both 25 mm each axis 25 nm/step or 40,000 steps/rev 4 mm/second 120/240V, 50/60Hz
SM325
High Resolution 3-D Motorized Micromanipulator (SM325-M) & Controller (MCL3) SM325-M High Resolution 3-D Motorized Micromanipulator MCL3 Controller with Joystick and software for SM325-M OPTIONAL M3301EH 15873 501622 501623 VFP ACCESSORIES Replacement Electrode Holder, straight, 14cm Angled Electrode Holder, 13 cm long Universal Micromanipulator Stand, 30 cm high Universal Micromanipulator Stand, 45 cm high Vibration-Free Platform Vibration-Free Workstation see page 159
148
Programmable Ultra High Precision Motorized Micromanipulators

HS6-3
The HS6-3 is supplied with manual controls and stepper motor drives in all 3 axes . The extremely solid construction eliminates the vibrations and drifts . With the utmost precision and long travel distance in all three directions, HS6-3 is the ideal tool for patch-clamp or electrophysiological applications . The tilting device is mounted on the base plate serves as coarse height adjustment as well and the tool holder can be swiveled in all directions . The MCL3 controller features a dynamic micro-step function that makes very quick positioning possible with maximum accuracy and free of vibration . Motor control is achieved with a linear output amplifier, which also drastically reduces electronic noise . Users can control the micromanipulators by joystick, keyboard, mouse or computer . The user-friendly HS6-3 SPECIFICATIONS software program can be enabled to CONTROL METHOD: Joystick, software, or both remember up to 999 position coordinates TRAVEL (X-Y-Z): 25 mm from previous procedure and can robotically repeat this same positioning sequence . RESOLUTION: 10 nm/step
MAXIMUM SPEED: STABILITY: POWER SUPPLY: DIMENSIONS: HS6-3: MCL3: WEIGHT: HS6-3: MCL3: 13 .2 lb . (6kg) 7 .7 lb . (3 .5kg) 6 .1x9 .7x9 .9 in (15 .5x24 .6x25 cm) (WxLxH) 9 .8x9x3 .7 in (25x23x9 .5 cm) (WxLxH) 4 .5 mm/sec . 1 nm/hour at 24C 120/240 V, 50/60 Hz
MCL3-HS6
HS6-3
High Resolution Motorized HS6 Micromanipulator and Controller includes HS6-3M and MCL3 HS6-3M High Resolution Motorized HS6 Micromanipulator MCL3 Controller with Joystick and software for HS6-3M OPTIONAL ACCESSORIES M3301EH Replacement Electrode Holder, straight, 14cm 15873 Angled Electrode Holder, 13 cm long 501622 Universal Micromanipulator Stand, 30 cm high 501623 Universal Micromanipulator Stand, 45 cm high VFP Vibration-Free Platform Vibration-Free Workstation see page 159
Manual coarse controls use cross roller bearing slides . Vernier scales allow readings to 0 .1 mm . All controls are closely grouped so adjustments can be made in any plane with minimum effort . The DC3001 features DC motor drives and fine control micrometers in all three axes . Left- or right-handed versions of the DC3001 are supplied with a standard 12 mm clamp . Standard accessories provided include one microelectrode holder and a securing bolt and wrench . The sophisticated MS314 Controller allows control of all three axes . Movements may be continuous through the use of cross switches, or the controller can cause the DC3001 to step in defined increments . Steps as small as 0 .5 are possible . A popular joystick controller, STM3, allows control of the X, Y and Z axes .
DC3001
15873 Electrode Holder not included
TBS Tilt Base not included
SYS-DC3314R Manipulator (right-handed) & MS314 Controller SYS-DC3314L Manipulator (left-handed) & MS314 Controller Specify line voltage. Also see magnetic stands. System components also available separately: Motorized Manipulator, right-handed DC3001R DC3001L Motorized Manipulator, left-handed SYS-MS314 Controller for DC3001 STM3 Joystick Controller for DC3001 OPTIONAL ACCESSORIES Tilt Base with Screw Adjustment TBS PM5 Remote controller for MS314 and MPM-10 5464 5-lb Weight for Tilting Base (shipping weight: 7 lb [3 kg]) M2 Additional 12 mm Clamp M-3 80 Tilting Base 6mm x 1mm screw (Shipping Weight: 2 lb) M4C Microscope Stage Adapter M5 Additional 10 mm Clamp M6 Additional 12-in . Clamp M3301EH Replacement Electrode Holder (14 cm long) 15873 Angled Electrode Holder (13 cm long) 501607 Cable for MS314 and DC3001
MS314 Controller STM3 Controller (available separately)
DC3001 SPECIFICATIONS
TRAVEL RANGE MANUAL: X-axis 37 mm Y-axis 20 mm Z-axis 20 mm TRAVEL RANGE MOTORIZED: X-axis 10 mm Y-axis 10 mm Z-axis 10 mm SHIPPING WEIGHT: DC3001: MS314: STM3: 3 lbs (1 .4 kg) 1 .8 lbs (0 .9 kg) 2 .8 lbs (1 .3 kg) RESOLUTION 0 .1 mm 0 .1 mm 0 .1 mm RESOLUTION 0 .5 m 0 .5 m 0 .5 m MAXIMUM SPEED 0 .2 mm/sec 0 .2 mm/sec 0 .2 mm/sec
149
MM3-3 micropositioner
MM3-C clamp
opens 0-7 mm
MM3-A adapter MM1-3 micropositioner and MM1-C clamp

opens 0-4 mm
MB2 magnetic base available separately

(see page 156)
MM1-A adapter
150
MM1-C clamp
MM3-3
MM1-3
MM1-A adapter
Mini Micropositioner
(MM1 and MM1-3)
Micropositioner
(MM3 and MM3-3)
Single stage measures only 5 11 26 mm with 3 mm travel . Provides precise and smooth motion with no backlash, positive spring loaded carriage, straight within 1 micron and less than 1 micron maximum wobble . Features fine 80 TPI screw adjustment . 10 mm square mounting surface has a 3 .9 mm tapped center hole for transmission and/or mounting . Available in single X (MM1), X-Y, and X-Y-Z (MM1-3) axis configurations .
Single stage measures only 7 17 44 mm with 13 mm travel . Offers precise and smooth motion with no backlash, positive spring-loaded carriage, straight within 1 .5 microns, and less than 1 .5 microns maximum wobble . Features fine 80 TPI screw adjustment . 13 mm square mounting surface has a 7 mm tapped center hole for transmission and/or mounting . Available in single X (MM3), X-Y, X-Y-Z (MM3-3) axis configurations .
MINI-MICROPOSITIONER SPECIFICATIONS
MM1
AXIS X Within 1 micron over 3 mm travel STRAIGHT LINE ACCURACY CLEAR APERTURE LOAD CAPACITY FINISH WEIGHT TYPE TRAVEL
MM1-3
X-Y-Z Within 1 micron over 3 mm travel
MM3
X Within 1.5 micron over 13 mm travel 7 mm tapped hole, 5/16-16 thread 340 g Normal Black Anodized 14 grams/axis Fine Screw 13 mm
MM#-3
X-Y-Z Within 1.5 micron over 13 mm travel 7 mm tapped hole, 5/16-16 thread 340 g Normal Black Anodized 48 grams/axis Fine Screw 13 mm
MM3
3.9 mm tapped 3.9 mm tapped hole, 8-32 thread hole, 8-32 thread 255 g Normal Black Anodized 3 grams/axis Fine Screw 3 mm 255 g Normal Black Anodized 12 grams/axis Fine Screw 3 mm
MM1
MM1 MM1-3 MM1-A MM1-C MM3 MM3-3 MM3-A MM3-C MM3-ALL MM1-ALL
Mini Micropositioner, one axis, 3 mm travel Mini Micropositioner, three axes, 3 mm travel Mounting Adapter for MM1 and MM1-3 Clamp for MM1 and MM1-3 Micropositioner, one axis, 13 mm travel Micropositioner, three axes, 13 mm travel Mounting Adapter for MM3 and MM3-3 Clamp for MM3 and MM3-3 Complete 3-Axis Micropositioner & Magnetic Stand Complete 3-Axis Mini Micropositioner & Magnetic Stand
151
KITE
M3301 Manual Micromanipulator

The worlds most widely used micromanipulator
Weighing just 550 grams and employing a slim space-saving design, this well-built micromanipulator outsells all others worldwide for high precision experiments where magnification is in the range of up to 250 . Its design allows units to stand tightly grouped since all control knobs project to the rear . And because control knobs are clustered within an 8 cm area in a single vertical plane, resolution is quick the hand works blindly while the eye monitors the microscopic image . Vernier scales allow readings to 0 .1 mm; x-axis fine control allows readings to 10 microns .
KITE-R
The instrument employs rack-and-pinion drive, V-shaped guideways, and cross roller bearings, so all movement is sure and repeatable, without drift, sideplay, backlash, or sticking . Contact parts are milled of hardened steel for high performance and long life . Left- or right-handed versions of the M3301 are supplied with a standard 12 mm clamp (M2) and one microelectrode holder (M3301EH) .
Economy Manual Micromanipulator

Vernier scales allow readings to 0 .1 mm . X-axis fine control allows readings to 10 m . Left- or right-handed versions of the KITE micromanipulator are supplied with a standard 12 mm clamp and electrode holder M3301EH . KITE-R KITE-L KITE-M3-R KITE-M3-L Kite Manual Manipulator (right-handed) Kite Manual Manipulator (left-handed) Kite (right-handed) + Tilting Base Combo Kite (left-handed) + Tilting Base Combo
15873 Electrode Holder not included
KITE SPECIFICATIONS
TRAVEL RANGE RESOLUTION X-axis Fine X-axis Y-axis Z-axis SHIPPING WEIGHT 10 mm 35 mm 20 mm 20 mm 3 lbs (1 .4 kg) 0 .01 mm 0 .1 mm 0 .1 mm 0 .1 mm
Shown on optional M-3 Tilting Base with optional 5-lb Weight #5464
M3301R M3301L M3301-M3-R M3301-M3-L 502105
Manual Manipulator, right-handed Manual Manipulator, left-handed Manual Manipulator (right handed) & Tilting Base Manual Manipulator (left handed) & Tilting Base Axis Adjustment Tool
OPTIONAL M3301EH 15873 M-3 5464 500475 500476 M4C
ACCESSORIES Replacement Electrode Holder (14 cm long) Optional Angled Electrode Holder (13 cm long) 80 Tilting Base M6 x 1mm screw 5-lb Weight for Tilting Base Shipping weight: 7 lb (3 kg) Ball Joint, 7 cm long, for 8 mm Holder Ball Joint, 4 cm long, for 4 mm Holder Microscope Stage Adapter Also see magnetic stands.
M3301 SPECIFICATIONS
TRAVEL RANGE RESOLUTION X-axis Fine X-axis Y-axis Z-axis SHIPPING WEIGHT 10 mm 37 mm 20 mm 25 mm 3 lbs (1 .4 kg) 0 .01 mm 0 .1 mm 0 .1 mm 0 .1 mm
152
es le: r He ng a w ne a
Ball-joint holder attachment

7 cm 7.9 mm diam.
500475 500476 Ball Joint, 7 cm long, for O .D . 5-9 mm Electrode Holder (shown) Ball Joint, 4 cm long, for O .D . 2 .8-4 .5 mm Electrode Holder
Mount a manipulator on your microscope stage

80 mm
Interchangeable clamps allow manipulators to be mounted on a variety of supports. Quick, secure mounting to any microscope stage (maximum opening: 20 mm).
12 mm diameter support arm
M5 10 mm clamp
M2 12 mm clamp
M6 12-in. clamp M2 M5 M6 12 mm Clamp 10 mm Clamp 1/2-in . Clamp
M4C Microscope Stage Adapter clamps onto microscope stage to provide a stable support for any manipulator with a 12 mm clamp.
M4C
Microscope Stage Adapter
At last a tilt base you can operate with one hand!

High Precision, High Stability
Tilt angle may be set at up to 35.
r to . ula ded nip nclu a M t i no
Adjust tilt angle easily by simply turning knob of threaded shaft. 6.5 in.
Tighten locking screw to lock platform angle.
Manipulator mounting bracket included. Two sets of mounting holes are predrilled for WPI manipulators (M3301R shown) but steel platform may be drilled for mounting other devices.
3.5-pound steel base provides additional stability for your micromanipulator. Holes also allow permanent mounting to your benchtop.
TBS
Tilt Base with Screw Adjustment Shipping Weight 7 lb
5 x 6 footprint saves space in your work area.
153
High Resolution Manual Micromanipulators

Engineered for stability, and built on a twelve-pound steel plate, this instrument is chosen worldwide for high resolution micro-recording . such as patch clamping, and other research requiring solid, drift-free performance . A superior tool in its own right, HS6 serves equally well as a base for other precision microdrives . HS6 can be bolted directly to a lab fixture or vibration-free platform . Resolution is extremely high each graduation on its large micrometer barrels indicates just 5 micron movements . Rack and pinion drive, V-shaped guideways, and cross roller bearings give sure, repeatable movements without sideplay, slipping, or sticking . All contact parts are milled of hardened steel . A flexible ball-joint assembly allows the electrode to be positioned at any angle relative to the x, y, or z axis . The entire manipulator tilts forward to 25 degrees allowing rapid coarse adjustment of the electrode, and allowing cell penetration along the axis of any of the micrometers . Simple, precise, and durable, the HS6 will provide years of dependable performance .
HS6 Micromanipulator
Rock-solid superb resolution
M3301EH electrode holder included
HS6 SPECIFICATIONS
TRAVEL RANGE X-axis Y-axis Z-axis SHIPPING WEIGHT DIMENSIONS 25 mm 25 mm 25 mm 25 lbs (11 kg) 9 .9 x 6 .6 x 9 .9 in . (H x W x L) RESOLUTION 5 m 5 m 5 m
SYS-HS6 M3301EH 15873 VFP
Micromanipulator Replacement Electrode Holder (14 cm x 7 .2 mm) Optional Angled Electrode Holder (13 cm long) Vibration-Free Platform Vibration-Free Workstation see page 159
Joystick-Controlled Micromanipulator
Specially adapted for use with the Nanoliter Injector (page 196) for oocyte injection and similar applications, this joystickcontrolled micromanipulator allows an easy steering motion that translates normal hand movement into smooth submillimeter shifts . Viewed microscopically, movement of the tooltip corresponds naturally to hand movement, so accurate M3301EH resolution is intuitive and quick . All fine adjustment can electrode holder be controlled by the joystick . Pivoting forward, backincluded ward, or laterally gives precise x-y adjustment . For added convenience, a separate coarse control lever is also provided for quick raising and lowering . A stop screwwhich is set once resolution is achievedeliminates refocusing and streamlines repetitive work by guiding the tip to its previous focussing plane . The stop screw also prevents the tool-tip from being broken during sudden lowering and eliminates downward driftplacement is stable enough for even extended use . Because the probe holder tilts a full 90, the tool-tip pivots easily for precise positioning . Rack-and-pinion drive, V-shaped guideways, and cross roller bearings eliminate backlash, slipping, and sticking . All contact parts milled from hardened steel for precise performance and long life . Joystick travel: 0 .35 mm to 3 .5-mm, depending on reduction gear ratio setting (adjustable between 1:15 and 1:150) . . MMJR MMJL OPTIONAL M3301EH 15873 M4C 500475 500476 Joystick Micromanipulator (Right-Handed) Joystick Micromanipulator (Left-Handed) ACCESSORIES Replacement Electrode Holder (14 cm 5 7 .2 mm) Angled Electrode Holder (13 cm long) Microscope Stage Adapter Ball Joint, 7 cm long, for 8 mm Holder Ball Joint, 4 cm long, for 4 mm Holder
X-axis Y-axis Z-axis
to 0
90
JR co M M handed ht(rig
ntrol
s)
MMJ SPECIFICATIONS
TRAVEL RANGE 37 mm 20 mm 25 mm 0 .35~3 .5 mm 4 lbs (1 .8 kg) RESOLUTION 0 .1 mm 0 .1 mm 0 .1mm
JOYSTICK (X,Y axis) SHIPPING WEIGHT
Also see magnetic stands.

154
Micrometer Slide Micromanipulator

The M325 can be configured from left- to right-handed version in 60 seconds! Toolholder rotates around two axes, can hold tools from 3.0 mm to 12.7 mm.
M3301EH electrode holder included
Mounts onto horizontal or vertical rods any diameter from 10 mm to 12.7 mm.
The M325 three-axis manual micromanipulator is built of precision micrometer-actuated linear slides . Each slide is comprised of a large micrometer head and a spring-return linear slide . The micromanipulator has been carefully designed to minimize wear in the moving components to achieve a long operational life without the necessity for frequent maintenance or adjustment . The micrometer head is graduated in 10 micron steps which enable repeatable positioning to an accuracy of 2 microns . A unique spring return mechanism is used to transmit movement of the micrometer spindle to the slide carriage eliminating backlash, lost motion and reducing thread wear . Each linear slide utilizes ball bearings which enable the M325 to carry loads of up to 1 kg . The toolholder can clamp onto tools with shaft diameters of 3 .0 mm to 12 .7 mm and allows rotation around two axes . This provides a wide range of options for incorporating the manipulator into your workstations . The M325 can also be configured very easily in left- or right-handed versions to allow several units to be positioned in close proximity . A quick-release clamp allows easy mounting onto any rod from 10-mm to 12 .7 mm diameter . M325 3-Axis Fine Controlled Manual Micromanipulator OPTIONS AND ACCESSORIES M3301EH Replacement Electrode Holder (14 cm long) 15873 Optional Angled Electrode Holder (13 cm long) 14444 Optional Differential Micrometer Head (per axis) 500475 Ball Joint, 7 cm long, for 8 mm Holder 500476 Ball Joint, 4 cm long, for 4 mm Holder Also see magnetic stands. Also see Universal Manipulator Stands.
M325 SPECIFICATIONS
TRAVEL RANGE X-axis Y-axis Z-axis SHIPPING WEIGHT 25 mm 10 mm 10 mm 4 lbs (1 .8 kg) RESOLUTION 10 m 10 m 10 m
Dual Tool-Holder Micromanipulator

A small and compact micromanipulator for manual manipulation in all three axes (x, y and z), the MD4 is equipped with a mounting bracket for a second tool or electrode holder which can be positioned in the x and y axes independent of the manipulator and may also be tilted and swiveled by two fine-adjust screws . Scales allow readings of coarse adjustment with an accuracy of 100 m . Additional x-axis fine control is achieved with a micrometer screw with a resolution of 10 m . Supplied with one M3301EH electrode holder and a 12 mm clamp for mounting on M10 Stand or other 12 mm supports . May also be mounted on optional M-3 Tilting Base . Travel, standard electrode: x-axis, 37 mm (fine, 10 mm); y-axis, 20 mm; z-axis, 25 mm. Additional electrode: x-axis, 7 mm; y-axis, 10 mm. MD4R MD4L MD4-M3-R MD4-M3-L Double-Holder Micromanipulator (right) Double-Holder Micromanipulator (left) Double-Holder Micromanipulator (right) + Tilting Base Double-Holder Micromanipulator (left) + Tilting Base M3301EH electrode holders included
MD4L (left-handed controls)
OPTIONAL ACCESSORIES M3301EH Replacement Electrode Holder (14 cm long) 15873 Optional Angled Electrode Holder (13 cm long) M2 Additional 12 mm Clamp M-3 80 Tilting Base 6mm x 1mm screw M4C Microscope Stage Adapter M5 Additional 10 mm Clamp M6 Additional 12-in . Clamp 5464 5-lb Weight for Tilting Base* 500475 Ball Joint, 7 cm long, for 8 mm Holder 500476 Ball Joint, 4 cm long, for 4 mm Holder *Shipping weight: 8 lb (3.6 kg) Also see magnetic stands. Also see Universal Manipulator Stands.
M-3 Tilting Base not included
MD4 SPECIFICATIONS
TRAVEL RANGE X-axis Fine X-axis Y-axis Z-axis SHIPPING WEIGHT 10 mm 37 mm 20 mm 25 mm 3 lbs (1 .4 kg) RESOLUTION 10 m 100 m 100 m 100 m
155
Magnetic Holding Devices

10 mm 10 mm 10 mm
5-6.5 mm
M1
A precision base providing stable support for such devices as electrodes and manipulators. Adjustable second arm adopts a variety of angles. (Optional M5 10 mm clamp should be added for use with M3301, DC3001, MD4 and MMJ manipulators.) Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf (176 lb force) Main Pole: diameter: 12 mm (0.47 in.) length: 176 mm (6.9 in.) Sub Pole: diameter: 10 mm (0.39 in.) length: 165 mm (6.5 in.) Clamp Hole: diameter: 4.5 mm and 6.5 mm Weight: 1.8 kg (4 lb) M1 M5 Magnetic Stand 10 mm Clamp
M1L
Same base and support arm as M1, but equipped with a longer (14-inch) vertical post. (Optional M5 10 mm clamp should be added for use with M3301, DC3001, MD4 and MMJ manipulators.) Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf (176 lb force) Main Pole: diameter: 12 mm (0.47 in.) length: 356 mm (14 in.) Sub Pole: diameter: 10 mm (0.39 in.) length: 165 mm (6.5 in.) Clamp Hole: diameter: 4.5 mm and 6.5 mm Weight: 1.8 kg (4 lb) M1L M5 Magnetic Stand 10 mm Clamp
Mechanical clamping type tightens three joints simultaneously just by on-tough operation. Arm is freely adjustable without distortion. Equipped with fine adjuster and medium size magnet for stabilizing the base. Suitable for performing precision operation. Magnetic Base: 30 ( w ) x 30 ( l ) x 30 ( h ) mm ( 1.2 x 1.2 x 1.2 in. ) Vertical Holding Power: 17 kgf (37 Ib force) Arm: L1: 46 mm (1.8 in.) L2: 46 mm (1.8 in.) L3: 39 mm (1.5 in.) Clamp Hole: Adjustable from 5 to 6.5 mm Weight: 0.38 kg (0.83 Ib) MB2 Compact Magnetic Stand
MB2
M8
A ball joint at the base of the main post allows 360 rotation, offering considerable versatility. The second arm adopts angles up to 75. (Optional M5 10 mm clamp should be added for use with M3301, DC3001, MD4 and MMJ manipulators.) Magnetic Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf (176 lb force) Main Pole: diameter: 12 mm (0.47 in.) length: 194 mm (7.6 in.) Sub Pole: diameter: 10 mm (0.39 in.) length: 165 mm (6.5 in.) Clamp Hole: Adjustable from 4.5 mm to 6.5 mm Weight: 1.8 kg (4 lb) M8 M5 Magnetic Stand 10 mm Clamp
Mounting your Micromanipulator

Three of the stands above M1, M1L, and M8 have 10 mm diameter mounting rods . The standard mount on several WPI manipulators (DC3001, KITE, M3301, MMJ, and MD4) M5 M5 10 mm clamp
accommodates a 12 mm rod . In order to use one of these three stands, you will need to replace the manipulator's standard 12 mm mounting clamp with the optional M5 clamp . 10 mm Clamp
156
The base of each stand exerts a powerful magnetic force that holds it solidly on ferrous metal surfaces even vertically or upside-down
12 mm x 25mm 12 mm
12 mm
6-8 mm
Useful as a probe holder, the M11 is not suitable for heavier items such as micromanipulators.
M9
Mechanical clamp tightens three rotatable joints simultaneously with one locking knob. Arm adjusts without distortion. Base exerts a magnetic force of 100 kilos for greatest stability. Equipped with fine adjustment for precise operations. Magnetic Base: 50 ( w ) x 60 ( l ) x 55 ( h ) mm ( 2.2 x 2.4 x 2.2 in. ) Vertical Holding Power: 100 kgf ( 220 lb force ) Arms: L1: 119 mm (4.7 in.) L2: 106 mm (4.2 in.) L3: 25 mm (0.98 in.)
12 mm (0.472 in.)
M10
Similar to M1 but with a 12 mm diameter sub pole (fits 12 mm clamp supplied with M3301, DC3001, MD4 and MMJ manipulators). Magnetic Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf ( 176 lb force ) Main Pole: diameter: 14 mm (0.55 in.) length: 178 mm (7 in.) Sub Pole: diameter: 12 mm (0.47 in.) length: 165 mm (6.5 in.) Clamp Hole: Adjustable from 4.5 mm to 6.5 mm Weight: 1.8 kg (4 lb) M10 Magnetic Stand
M10L
Same as M10 but equipped with a taller (14-inch) vertical main pole. Magnetic Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf ( 176 lb force ) Main Pole: diameter: 14 mm (0.55 in.) length: 356 mm (14 in.) Sub Pole: diameter: 12 mm (0.47 in.) length: 165 mm (6.5 in.) Clamp Hole: Adjustable from 4.5 mm to 6.5 mm Weight: 1.8 kg (4 lb) M10L Magnetic Stand
M11
Bends freely for maximum flexibility. The connecting arm twists and bends like a snake. Lock the arm in position with a flick of the controlling lever. Magnetic Base: 50 ( w ) x 58 ( l ) x 55 ( h ) mm ( 2.0 x 2.3 x 2.2 in. ) Vertical Holding Power: 80 kgf ( 176 lb force ) Main Pole: diameter: 16 mm (0.63 in.) length: 315 mm (12.4 in.) Sub Pole: none Clamp Hole: Adjustable from 6 mm to 8 mm Weight: 1.4 kg (3 lb) M11 Magnetic Stand
Clamp Hole: none Weight: 1.8 kg (4 lb) M9 Magnetic Stand
Powerful Ball Joint Rare Earth Magnet

Use in constructing your own holding device for small parts/equipment
Small but very powerful: holds 2 kilograms (~5 pounds)! Steel ball rotates freely 360 on a 180 axis M3 mounting screw on ball for attachment to equipment Magnet base threaded (M3) for mounting onto a base or equipment
This novel magnetic ball joint has phenomenal holding power for up to 2 kg of attached weight while permitting the ball a full 360 rotation on a 180 axis . You can freely orient your equipment to an infinite number of positions within this rotation . This is made possible by the combination of a steel ball (10 mm diameter) and a powerful rare earth magnet contained in the magnet cylinder ( 10 x 20mm) . Convenient M3 attachment sites are provided on
both the ball (male) and the magnet base (female) . For use with micromanipulators for the positioning and holding of optical instruments including various lighting sources and lasers, pipettes and any small parts that would benefit from the flexibility offered by this new magnetic ball joint .
M3 x 12 mm
28 mm
M3 x 5 mm 10 mm
500871
Magnetic Ball Joint
157
Magnetic Holding Devices

An ideal accessory for optical tables and vibration-free platform. Reduces experimental set-up time by allowing free positioning and instant clamp down of optical components. Switchable ON/OFF magnetic circuit permits fine adjustment and precise positioning. Easy ON/OFF operation using lever Thin and powerful magnetic force Generous array of tap holes Holding Power: 20 kgf (44 Ib force) Dimension: 75 (OD) x 20 (h) mm 2.9 (OD) x 0.8 (h) in. Mounting Hole: 4-M4 x 0.7, depth 6mm * M8 x 1, depth 6mm Span 35mm Weight: 0.7 kg (1.5 Ib) 501651 503568 Magnetic Base, 75mm diameter Magnetic Base, 50mm diameter
Round Base
An ideal accessory for optical tables and vibration-free platform. Reduces experimental set-up time by allowing free positioning and instant clamp down of optical components. Switchable ON/OFF magnetic circuit permits fine adjustment and precise positioning. Easy ON/OFF operation using lever Thin and powerful magnetic force Generous array of tap holes Holding Power: 20 kgf (44 Ib force) Dimension: 65 (w) x 65 (l) x 20 (h) mm 2.6 (w) x 2.6 (l) x 0.8 (h) in. Mounting Hole: 8-M4 x 0.7, depth 6mm * M8 x 1, depth 6mm Span 25mm Weight: 0.6 kg (1.3 Ib) 501653 503569 503570 503571 Magnetic Base, 65x65mm Magnetic Base, 45x45mm Magnetic Base, 90x90mm Magnetic Base, 120x120mm
Square Base
MOBITYTM is a new magnetic clamping system. With its ease of use, only one hand is needed to operate the attractive power. The MOBITYTM has a strong 88lbf pull, yet weighs only 1.5 lbs. MOBITYTM meets various applications with 4 tapped holes on the top surface. Requires (1) 9V alkaline battery (included).
MOBITY
A small holder ideal for use where space is limited. Main post unscrews from base which may then be used alone as a switchable magnetic holder. Magnetic Base: 30 (w) x 35 (l) x 35 (h) mm 1.2 (w) x 1.4 (l) x 1.4 (h) in. Vertical Holding Power: 20 kgf (44 Ib force) Main Pole: Diameter: 7mm Length: 52mm Screw threads Clamp Hole: Diameter: 6mm Weight: 0.36 kg (0.8 Ib) M7 Compact Magnetic Stand
M7
Holding Power: 40 kgf (88 Ib force) Dimension: 55 (w) x 73 (l) x 50 (h) mm 2.2 (w) x 2.9 (l) x 2.0 (h) in. Mounting Hole: 3-M4, depth 20mm * M8, depth 15mm Weight: 0.7 kg (1.5 Ib) 501652 MOBITY Magnetic Clamping System
* Posts with M4-threads not available from WPI. See posts with M8 threads on page 142.
812"x12" Steel Base Plate #5052
BASE PLATES: A magnetic stand requires a steel mounting surface. WPIs steel base plates have plenty of mass to give stability to your experimental setup. Beveled edges make them easy to handle; rubber feet hold them off the benchtop, making them easier to grasp when moving; and the special black coating provides a durable protective finish.
158
12"x24" Steel Base Plate #5479
ACCESSORIES 5052 Steel base plate, 812 x 12 in. (10 lb) 5479 Steel base plate, 12 x 24 x 38-in. (32 lb)
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. Germany: Tel: 030-6188845 wpide@wpi-europe.com
Vibration Isolation Platform

Passive, mechanical and maintenance free No air hoses or supporting hardware required Isolates both horizontal and vertical vibrations Six degrees of freedom Compact design
This platform eliminates the transmission of vibrations from a table top or counter to the instrument that is mounted to it . This includes microscopes, sample preparation tools and hardness testers . The platform is comprised of a black powdercoated, steel plate and three or four vibration isolation bearings . It comes in two styles: Series 320 VIP Rectangular shaped platforms with three or four vibration isolation bearings . Available in the following sizes: 12" x 18", 16" x 16", 18" x 24" and 24" x 30", supporting weights of 15-300 lb (7-136 kg) . All platforms are less than 2" high . Series 3200 VIP The platform design matches the footprint of the isolated instrument . (Microscopes by Carl Zeiss, Leica Microsystems, Nikon and Olympus; Hardness testers by Wilson Instruments)
Call for more information and prices for the configuration you require.
Vibration-Free Tables
All buildings vibrate activities of people, machinery, heating and ventilation systems, and nearby truck or rail traffic cause all types of vibrations . These vibrations, though, acceptable to occupants, cannot be tolerated by equipment used in patch clamping, cell injection, analytical balances, and optical microscopes . The short-term effects of such vibrations include inconsistant and unreliable performance . The long-term effects are excessive wear, maintenance, and fatigue failures . In order to protect sensitive instruments and equipment from faulty operation or failure this vibration must be significantly reduced . This can be efficiently accomplished by using Vibration-Free Platform and Vibration-Free Workstation .
Vibration-Free Workstation
Vertical and horizontal vibration isolation High performance Active-Air Suspension Automatic leveling VibraDamped Steel Class 100 Cleanroom compatible Leveling feet
Additional tabletop sizes and finishes are available, as well as optional accessories such as side rails and casters.
Call for more information and prices for the configuration you require.
VFW9101-xxxx Vibration-Free Workstation

159
Surgical Microscopes
PSMB Binocular SurgioScope, floor stand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161 PSMT Trinocular SurgioScope, floor stand, video adapter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161
Stereomicroscopes
PZMIV Precision Stereo Zoom Microscope (Model IV), Binocular . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
MICROSCOPES, CAMERAS
PZMTIV Precision Stereo Zoom Microscope (Model IV), Trinocular . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162 PZMTIV-CCTV Precision Stereo Zoom Microscope Video System (Model IV) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162 PZMIII Precision Stereo Zoom Microscope (Model III) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164 PZMTIII Precision Stereo Zoom Trinocular Microscope (Model III) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164
Inverted Microscopes
INV-101 Trinocular Inverted Microscope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166
Upright Microscopes
GPL-T Research Grade Microscope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 167 W30S Professional Grade Microscope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 167
Microscope Cameras and Photo/Video Adapters

Digital Microscope Cameras, USB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 170 Color CCD Video Camera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171 Eyepiece Adapters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171
Illuminators and Optical Fiber Light Guide

NOVAFLEX Fiber Optic Illuminator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 168
Miscellaneous
Air-Therm ATX Heater Controller . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169 FluoroDish Glass-Bottom Sterile Cell Culture Dishes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 172 Cover Slips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173 Microscope Slides . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173
160
Precision SurgioScope
Ideal for small animal surgery
SURGIOSCOPE SPECIFICAtIOnS
TOTAL MAGNIFICATION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 .8 40 ADJUSTABLE DIOPTER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Diopter ADJUSTABLE INTERPUPILLARY DISTANCE . . . . . . . . . . . . . . . . . . . . . . . min . 50 mm max . 70 mm WORKING DISTANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 mm 344 mm EYEPIECE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 .5x LENS CHARACTERISTICS Objectives Objective Focal Distance 100 mm 200 mm 250 mm 300 mm 350 mm Working Distance 94 mm 195 mm 246 mm 294 mm 344 mm Total Magnification 6 .4 10 16 26 40 3 .2 5 8 13 20 2 .6 4 6 .4 10 .4 16 2 3 .3 5 .3 8 .6 13 .3 1 .8 3 4 .5 7 .5 11 .5 Field of View 33 mm, 20 .5 mm, 13 mm, 8 mm, 5 mm 58 mm, 38 mm, 24 mm, 15 mm, 10 mm 72 .5 mm, 47 .5 mm, 30 mm, 19 mm, 12 .5 mm 87 mm, 57 mm, 36 mm, 22 .5 mm, 15 mm 99 mm, 65 mm, 42 mm, 27 mm, 17 mm
5 th ion wi at w c No gnifi ps! ma ste
F100 (Optional) F200 (Included) F250 (Optional) F300 (Optional) F350 (Optional)
FINE FOCUS ADJUSTMENT RANGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 mm WORKING HEIGHT (Arm Movement Range Above Floor) 89 cm Post . . . . . . . . . . . . . . . . . . . . . . . . . . Focus on specimens 34 .5" (88 cm) to 51" (130 cm) above floor * 103 cm Post . . . . . . . . . . . . . . . . . . . . . . . . Focus on specimens 40 .5" (103 cm) to 57" (146 cm) above floor * * Subtract Working Distance for height above specimen, 103 cm post recommended for F350 objective. RANGE OF MOTION Maximum Stretch Radius of Arm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 870 mm Vertical Movement Range . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 700-1100 mm Adjustable Range of Small Arm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 mm ILLUMINATION Dual lamp housing with quick-change spare and internal coaxial fiber optic cable . HALOGEN-TUNGSTEN LAMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12V, 100W, with cold reflection OPTIONAL CAMERA
1 /2 CCD camera (e.g., COLCAM (75%) or DC2000M (57%))
FEAtURES: Motorized focusing system, allows handsfree operation . Light weight, compact and easy to maneuver . Weighs only 70 lb . Dual bulbs prevent illumination failure during surgery . Optional video adapter . Improved view field . Convenient handles . Five magnification steps .
POWER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110V, 50-60 Hz, or 220V, 50-60 Hz SHIPPING WEIGHT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 lb (43 kg)
WPIs improved precision SurgioScope (now with five magnification steps) is a portable high quality surgical microscope offering outstanding image quality and value . Incorporating an agile extension arm and excellent working distance objectives, the SurgioScope provides convenient movement and maneuverability necessary for accurate positioning . These important features, together with a high quality optical system, provide sharp image contrast and enhanced large field of vision . The SurgioScope comes fully equipped with a foot-controlled motorized focusing system, normally only found in more expensive surgical microscopes . A unique dual lamp housing enables safe and rapid changing of the lamp during an operation, without the need to power down . The optional video
port on the T version permits operational procedures to be monitored or recorded simultaneously using a video recorder and a
COLCAM video camera or digital stills with DC2000M The mobility of the DC2000M is limited to 2 .5 m (7 ft .) by its USB cable .
PSMB5 PSMt5
Binocular SurgioScope, F200 objective (Specify post height .) Trinocular SurgioScope, beam splitter, std video adapter, F200 objective (Specify post height.) Specify 89 cm or 103 cm post Specify line voltage
OPtIOnS AnD ACCESSORIES 1 501636 /2" CS-mount Adaptor (requires Beam Splitter 501637) 501637 Beam splitter 501669 Objective lens F100 501638 Objective lens F250 501639 Objective lens F300 501640 Objective lens F350 500162 Replacement lamp, 12V, 100 W
161
Precision Stereo ZOOM Microscope

Modular, two parallel beam design Planachromatic objectives, no optical distortion High-contrast imaging, ideal for observing transparent, low-contrast objects Large zoom ratio: 8:1 Large zoom range: 0.62x to 5.0x Long working distance Step and continuous zoom 5-year warranty
The fourth generation of WPIs precision stereo zoom microscopes uses modular, two parallel beam path design and high quality optical system . The advanced optical design with planachromatic objectives provides sharp and distortion-free contrast image throughout the entire zoom range and comes with an impressive 5-year warranty . The PZMIV is available in a binocular or trinocular version . In addition, an extensive list of optional accessories is available that makes the PZMIV suitable for integrated optical and biological research . The microscope comes with a track stand, standard 10x eyepieces (wide-field, distortionfree and high eye point), 1x planachromatic distortion-free objective . See the Table on next page for all optical options .
All PZ M micro IV and PZ M sco T 10x ey pes come w IV epiece ith s, 1x au xiliar y built-in le light r ing ad ns, and apter.
COLCAM Video Camera or DC2000M digital camera available separately #500028 Camera Coupler, available separately
Shown: PZMtIV with COLCAM and 0.5X cmount adapter (camera and c-mount not included) The trinocular version is a true trinocular, with continuous operation of both eyepieces and photo tube simultaneously. There is no need to block the right eyepiece to use the photoport. Max. Working Distance: 25 cm
502160 Lighted Fan Base
PZMIV Precision Stereo Zoom Binocular Microscope (Model IV), on Track Stand PZMIVBS PZMIV Microscope on Boom Stand PZMtIV Precision Stereo Zoom Trinocular Microscope (Model IV), on Track Stand PZMtIVBS PZMTIV Microscope on Boom Stand PZMtIVCCtV PZMTIV Microscope Video System, including PZMTIV, COLCAM Color Video Camera, 0 .5x CCD Camera Coupler, Novaflex Optical Illuminator, Bifurcated Optical Fiber Light Guide, and 13 Color TV Monitor (NTSC format) PZMtIVBSCCtV PZMTIV Microscope Video System on Boom Clamp Stand Please see web site for complete configurations
162
PZMIV
21 in.
PZMtIVBS
15 in.
#502007 Articulated Arm
Base 11.25 x 10.25 in.
Clamp opens to 50 mm max.
PZMIV & PZMtIV Eyepieces and Objectives

10x Eyepiece Objective 0.32x 0.5x 0.63x 1.0x (inc) Mag 1.9x - 16x 3.1x - 25x 3.9x 31.5x 6.2x - 50x Field (mm) (Video Field) 106 -13.1 (49.8 - 6.1) 67.7 - 8.4 (31.8 - 3.95) 53.8 - 6.7 (25.3 - 3.15) 33.9 - 4.2 (15.9 - 1.97) 16x Eyepiece Mag 3.2x 25.6x 5x - 40x 6.2x 50.4x 9.9x - 90x Field (mm) (Video Field) 70.6 - 8.8 (49.8 - 6.1) 45.2 - 5.6 (31.8 - 3.95) 35.8 - 4.4 (25.3 - 3.15) 22.6 - 2.8 (15.9 - 1.97) 20x Eyepiece Mag 3.9x - 32x 6.2x - 50x 7.8x -63x 12.4x 100x Field (mm) (Video Field) 55.4 - 6.9 (49.8 - 6.1) 35.5 - 4.4 (31.8 - 3.95) 28.2 - 3.5 (25.3 - 3.15) 17.7 - 2.2 (15.9 - 1.97) 25x Eyepiece Mag 5x - 40x 7.8x - 62.8x 9.8x - 78.8x 15.5x 125x Field (mm) (Video Field) 45.4 - 5.6 (49.8 - 6.1) 20 - 3.6 (31.8 - 3.95) 23 -2.9 (25.3 - 3.15) 14.5 - 1.8 (15.9 - 1.97) Working Distance 296 mm 187 mm 149 mm 80 mm
The Video Field is based on a 1/2-inch CCD (8 mm diagonal) and a 0.5x camera adapter.
OPtIOnAL ACCESSORIES 502000 PZMIV Binocular Body With 10X Eyepieces, 1X Objective, Eye guards 502001 PZMTIV Trinocular Body With 10X Eyepieces, 1X Objective, Eye guards 502004 Boom Stand W/O Focus Mount (requires 502009 Focus Mount for PZMIV) 502005 Ball Bearing Boom Stand W/O Focus Mount (requires 502009 Focus Mount for PZMIV) 502006 Boom Clamp Stand (requires 502009 Focus Mount for PZMIV) 502007 Articulated Arm and Table Clamp w/o Focus Mount (requires 502009 Focus Mount for PZMIV) 502009 Universal Focus Mount for 76 mm PZMIV (Required for BS, AAC, BBS, and BCS) (5/8 pin) 502160 Lighted Fan Base, Fluorescent base, Tungsten Halogen beam 502010 10X Wide Field Eyepiece for PZMIV (pair) 502011 16X Wide Field Eyepiece for PZMIV (pair) 502012 20X Wide Field Eyepiece for PZMIV (pair) 502013 25X Wide Field Eyepiece for PZMIV (pair) 502015 Ring Light Adapter for PZMIV (For R-8-8-WPI01 Ring Light Guide) 502016 0 .32x, Planachromatic Objective (Distortion-free) (296 mm WD) 502017 0 .50x, Planachromatic Objective (Distortion-free) (187 mm WD) 502018 0 .63x, Planachromatic Objective (Distortion-free) (149 mm WD) 502019 1 .0x, Planachromatic Objective (Distortion-free) (80mm WD) 500261 0 .35x CCD Camera Coupler, C-Mount (Use with USBCAM33) 500262 0 .5x CCD Camera Coupler, C-Mount (Use with COLCAM) 500028 1x CCD Camera Coupler, C-Mount (Use with COLCAM) 502163 Wall Mount Plate for Articulated Arm System nOVA NOVAFLEX Fiber Optic Illuminator 500186 Bifurcated Light Guide with Lenses R88WPI01 Ring Light Guide nOVA186 NOVAFLEX Fiber Optic Illuminator with Bifurcated Light Guide and Lenses EJA Replacement Lamp for NOVAFLEX 502167 Replacement Fluorescent lamp for Lighted Fan Base (502160) 502168 Replacement Tungsten Halogen lamp for Lighted Fan Base (502160) COLCAMntSC Video Camera 1/2" CCD (8 mm diagonal) COLCAMPAL Video Camera 1/2" CCD (8 mm diagonal) DC2000M Digital Camera 1/3" CCD (6 mm diagonal)
CCD Camera Couplers C-Mount, available as 0.3x, 0.5x and 1x.
PZMIV SPECIFICAtIOnS
EYEPIECES AUXILIARY LENSES ZOOM RANGE TOTAL MAGNIFICATION ZOOM RATIO FIELD OF VIEW WORKING DISTANCE BINOCULAR TUBE INTERPUPILARY DISTANCE DIOPTER ADJUSTMENT MICROSCOPE BODY OPTIONAL ACCESSORIES Eyepieces Auxiliary lenses Total Magnification Field of view Working Distance SHIPPING WEIGHT WFH 10 1 0 .62 - 5 6 .2 - 50 8:1 33 .9- 4 .2 mm 80 mm Inclined 45 50 75 mm 5 Diopter Rotatable 360 16, 20, 25 0 .32, 0 .5, 0 .63 1 .9 - 125 106 - 1 .8 mm 80 296 mm 23 lb.
163
Precision Stereo ZOOM Microscope
Quality and Precision to Improve Your Vision

WPIs third-generation stereomicroscope, PZMIII, is an ideal tool for tissue dissection, cell injection, specimen manipulation, electrode inspection, and many other applications that require a magnified, stereo viewing and ample working distance . It offers the leading brands quality and performance at an affordable price . Advanced optics provide the sharpest image that can only be found among the best of this class . It is superior to many stereomicroscopes costing almost twice as much . Zooming is achieved by a spring-loaded nub that is smooth and effortless . The compact size and light weight make it more stable and easily manipulated on the boom stand . A specially designed photo/ video module can easily upgrade the binocular PZMIII to a trinocular microscope at any time for photo, video, or digital imaging . In addition, an extensive list of optional accessories is available that can make the PZMIII suitable for almost any bio-research applications requiring a stereomicroscope . See next page for options .
PZMtIIICCtV (ntSC format)
Monitor may vary from pictured.
Actual base wider than pictured here. See example at left.
NEW LOW PRICES!

PZMIII PZMIIIBS PZMIIIAAC PZMtIII PZMtIIICCtV PZMIII Precision Stereo Zoom Microscope (Model III), on Post Stand PZMIII Microscope on Boom Stand PZMIII Microscope on Articulated Arm with Table Clamp Precision Stereo Zoom Trinocular Microscope (Model III) PZMTIII Microscope Video System, including PZMTIII, COLCAM Color Video Camera, 0 .5X CCD Camera Coupler, Novaflex Optical Illuminator, Bifurcated Optical Fiber Light Guide, and 13" color TV monitor (NTSC format) PZMtIIIBS PZMTIII Microscope on Boom Stand PZMtIIIAAC PZMTIII Microscope on Articulated Arm with Table Clamp PZMTIII-BS-CCTV PZMTIII Microscope, Boom Stand, Video System PZMTIII-AAC-CCTV PZMTIII Microscope, Articulated Arm, Video System COLCAMntSC Video Camera 1/2" CCD (8 mm diagonal) COLCAMPAL Video Camera 1/2" CCD (8 mm diagonal) All PZMIII and PZMTIII microscopes come with 10x eyepieces and built-in 1x auxiliary lens.
164
PZMIII
#502163 Wall-Mount Plate Mount the microscope on the wall for convenient storage when space is tight.
40 cm
PZMIIIBS
#502007 Articulated Arm
#502005 Ball Bearing Boom Stand Dual Arm Ball Bearing Boom Stand for increased stability and smoother horizontal movements.
qwertyuiopas PZMIII Eyepieces and Objectives

10x Eyepiece
Objective
0 .3x 0 .5x 0 .75x 1 .0x 1 .5x 2 .0x
15x Eyepiece
Mag.
3x - 20 .3x 5x - 33 .8x 7 .5x - 50 .6x 10x - 67 .5x 15x - 101 .3x 20 .1x - 135x
20x Eyepiece
Mag.
4x -27x 6 .7x - 45x 10x - 67 .5x 13 .4x - 90x 20 .1x - 135x 26 .8x - 180x
25x Eyepiece
Mag.
5x - 33 .8x 8 .4x - 56 .3x 12 .6x - 84 .4x 16 .8x - 112 .5x 25 .1x - 168 .8x 33 .5x - 225x
Mag.
2x - 13 .5x 3 .4x - 22 .5x 5x - 33 .8x 6 .7x - 45x 10x - 67 .5x 13 .4x - 90x
Field (mm) (Video Field)*

114 - 17 (53.6 - 8) 69 - 10 (32.4 - 4.7) 45 - 7 (21.1 - 3.3) 34 - 5 (16 - 4.7) 23 - 3 .4 (10.8 - 1.6) 12 - 2 .5 (5.6 - 1.17)

84 -13 (53.6 - 8) 51 - 7 (32.4 - 4.7) 34 - 5 (21.1 - 3.3) 25 - 3 .7 (16 - 4.7) 17 - 2 .5 (10.8 - 1.6) 13 - 1 .8 (5.6 - 1.17)

69 - 10 .3 (53.6 - 8) 42 - 6 .2 (32.4 - 4.7) 28 - 4 .2 (21.1 - 3.3) 21 - 3 .1 (16 - 4.7) 14 - 2 .1 (10.8 - 1.6) 10 - 1 .5 (5.6 - 1.17)
Field (mm) Working (Video Field)* Distance (mm)

44 .8 - 6 .7 (53.6 - 8) 26 .9 - 4 .0 (32.4 - 4.7) 17 .9 - 2 .7 (21.1 - 3.3) 13 .4 - 2 .0 (16 - 4.7) 9 .0 - 1 .3 (10.8 - 1.6) 6 .7 - 1 .0 (5.6 - 1.17) 287 mm 177 mm 117 mm 100 mm 47 mm 26 mm
#501381 0.5x C-mount CCD Camera coupler Use with cameras which have 0.5-in. CCD.
* The video field of view is based on a 1/2-inch (8 mm diagonal) CCD camera and a 0.5x camera adapter.
OPtIOnAL ACCESSORIES 501352 PZMIII Binocular Body, pair of 10x eyepieces and eyeguards 13338 Ring Light Adapter NOT included 501353 Fan Post Stand with 76mm Focus Mount 502009 Universal Focus Mount, 76 mm ID for PZMIII Body 502004 Boom Stand without Focus Mount 502005 Ball Bearing Boom Stand without Focus Mount 502007 Articulated Arm with Table Clamp, without Focus Mount 502163 Wall-Mount Plate, 6 x 6 (or 15 .24 cm x 15 .24 cm) 501367 Universal Focus Mount, 83mm ID for PZM Body 501369 Wide Field 10x Eyepieces (pair) 501370 Wide Field 15x Eyepieces (pair) 501371 Wide Field 20x Eyepieces (pair) 501372 Wide Field 25x Eyepieces (pair) 501373 0 .3X Long Working Distance Objective Lens 501375 0 .5x Long Working Distance Objective Lens 501376 0 .75x Long Working Distance Objective Lens 501377 1 .5x Long Working Distance Objective Lens 501378 2 .0x Long Working Distance Objective Lens 501379 PZMTIII Trinocular Body, pair of 10x eyepieces and eye guards 13338 Ring Light Adapter NOT included 501381 0 .5x C-Mount CCD Camera Coupler 13338 Ring Light Adapter for PZMIII Series (included with all microscope configurations on previous page) 503051 Manual Stage for PZMIII 500264 Reticle in 10x Eyepiece, 30 mm version, 100 divisions 500266 Reticle in 20x Eyepiece, 0-90, 200 divisions 503102 76mm Rectangular Base Post Stand for PZMIII
#503051 Manual Stage Mounts in the circular opening in the PZMiii base. XY travel distance: 75 x 56 mm. Glass size: 116 x 96 mm. Active diameter: 37.6 mm. Dimensions: 180 x 155 x 27 mm. Fits 503102 base only.
PZMIII SPECIFICAtIOnS
EYEPIECES ZOOM RANGE TOTAL MAGNIFICATION FIELD OF VIEW WORKING DISTANCE BINOCULAR TUBE INTERPUPILLARY DISTANCE DIOPTER ADJUSTMENT MICROSCOPE BODY AUXILIARY LENSES Total magnification Biggest Field of View Working Distance SHIPPING WEIGHT WFH 10x 0.67x - 4.5x 6.77x - 45x 34 MM - 5 MM 100 mm Inclined 45 Adjustable 47-70 mm 5 Diopter (both eyepiece tubes) Rotatable 360 2x - 225x 110 mm 26-287 mm 23 lb.
165
Inverted Trinocular Microscope

Video camera available separately see page 171
Trinocular Head
Ideal for video/photography Centering eyepiece for phase objective EW 10X /22 extra wide field eyepieces
Condenser
Abbe condenser with 20X phase
Racks
Adjustable condenser rack Adjustable illuminator rack
Stage
160x260mm Inserts: 35 mm round, 50 mm round, 87x46 rectangular Auxiliary stage, 70x180mm Coaxial drive controls Optional mechanical stage: X-Y coaxial control; 120x78 mm range of traverse
Nosepiece
Quintuple nosepiece
Objectives
Infinity Optical System Objectives: Plan 4X and 40x, Plan Phase 10x and 20x
Illumination
6V/30W halogen bulb
Fixed Stage
Optics move during focusing - excellent for patch clamp and brain slice recording
Focus
Coarse adjustment: range of 37.7mm Fine adjustment: 0.2mm per rotation Vertical objective movement INV-101 Trinocular Inverted Microscope 503510 30 mm 10X Eyepiece with 100/10 reticle 503520 Replacement lamp 503512 Deluxe Optical Cleaning Kit All necessary tools are included for routine adjustments, alignments, and assembly: 8 oz. Air Duster, 280 sheets lint-free lens paper, 1 oz. no-residue lens cleaning fluid, 100 cotton-tipped applicators, 9x9 microfiber lens cloth, soft-bristled dusting brush, micro-glide gear lubricant, allen wrenches, doublesided friction collar wrench, precision screwdriver set, nylon carry case
Accessories Included
Green, blue and neutral filters, dust cover, immersion oil.
Options
Multiple photo options
Weight
24 lb (10.9 kg)
166
Research Grade Microscope

GPLt
The GPL-T Modular Lab Scope features exceptional optical quality and expandability for top-notch performance in the lab . The 10x/20 high-point Plan eyepieces on super-wide eyetubes offer an extremely broad field of view, with ample eye relief for users who wear eyeglasses . The Infinity Plan optics match quality with value within any labs budget .
GPLt SPECIFICAtIOnS
HEAD True Trinocular (Seidentopf) with 0 .40x C-mount Diopter adjustment Inclined 30, rotates 360 10X/20 high point eyepieces Interpupillary distance range 50-75 mm Reverse quadruple nosepiece Infinity Plan 4X, 10X, 40XR, 100XR (oil) Anti-fungal, parfocal, parcentric, color-coded Mechanical stage (160 mm x 140 mm) XY Movement: 77 mm x 50mm Slow-close hydraulic slide finger, Dual slide holder Coarse adjustment: range of 20 mm Fine adjustment: graduation of 2 m
NOSEPIECE OBJECTIVES
STAGE
FOCUS
ILLUMINATION Koehler Illumination, Moveable Abbe condenser, NA 1 .25 Dual Iris diaphragms Variable Halogen light source (12V/20W bulb) Input 90-240V / 50-60Hz automatic switching
Camera not included GPLt 503510 503511 503512 Research Grade Microscope Trinocular 30 mm 10X Eyepiece with 100/10 reticle Replacement lamp Deluxe Optical Cleaning Kit
ACCESSORIES INCLUDED One 2-amp fuse, spare 12V/20W bulb, blue, green, and yellow filters, dust cover, immersion oil, manual and warranty card DIMENSIONS AND WEIGHT 16 .5 (42cm) x 10 .625 (27cm) x 7 .875 (20cm) 19 .5 lb . (9 kg)
All necessary tools are included for routine adjustments, alignments, and assembly: 8oz. Air Duster, 280 sheets Lint-Free Lens Paper, 1 oz. No-Residue Lens Cleaning Fluid, 100 Cotton-Tipped Applicators, 9x9 Microfiber Lens Cloth, Soft-Bristled Dusting Brush, MicroGlide Gear Lubricant, Allen Wrenches, Double-Sided Friction Collar Wrench, Precision Screwdriver Set, Nylon Carry Case
W30 ProfessionalGrade Microscope

The W30 professionalgrade microscope is a best-seller in universities, medical schools, and reseach laboratories . Equipped for performance, its features include titanium-finished DIN or Semi-Plan optics and a 30year anti-fungal coating . The W30 is the choice for superior performance at a great price .
W30S SPECIFICAtIOnS
HEAD Binocular (Seidentopf) True Trinocular Inclined 30, rotates 360 Dual diopter adjustment, Interpupillary distance range 55-75 mm 10X/18 wide field eyepieces Quadruple forward-facing nosepiece DIN Plan, anti-fungal 4X, 10X, 40X, 100XR (oil) Parfocal, parcentric, color-coded Mechanical stage (140 mm x 140 mm) Coaxial drive controls XY Movement: 73 mm x 43 mm Coarse adjustment: range of 30 mm Fine adjustment: graduation of 2 m Tension control knob
NOSEPIECE OBJECTIVES
STAGE
FOCUS
Moveable Abbe condenser, NA 1 .25, Iris diaphragm Variable halogen light source (12V/20W bulb) 110V/220V switchable electronics ACCESSORIES INCLUDED Three 0 .5 amp fuses, mirror attachment (for field use), blue and green filters, dust cover, immersion oil, spare bulb 15 (38 cm) x 9 (23 cm) x 7 (17 .8 cm) 14 lb . (6 .4 kg)
ILLUMINATION
DIMENSIONS AND WEIGHT
W30S W30St 503513 503514
Binocular Microscope Trinocular Microscope 21 mm 10X Eyepiece with 100/10 reticle Replacement Lamp 167
The NOVAFLEX Fiber Optic Illuminator provides reliable, uninterrupted high-intensity light for microscopes and fiber optic spectrometers . The most widely used halogen light source, NOVAFLEX allows a continuous range of subdued or concentrated lighting controlled by a rotary dimmer on the front panel . NOVAFLEX may be used with a ring light and single or bifurcated flexible fiber bundles, enabling the light beam to be placed exactly where needed . Forced air cooling prolongs lamp life . EJA lamp color temperature is 3350K . An interlock switch automatically cuts off power when front panel is opened to replace bulb . Rugged aluminum case .
High intensity source for fiber optic illumination
21" (53 cm)
Bifurcated Light Guide 500186 available separately
Size: 24 x 13 x 16 cm (9.375 x 4.75 x 6.25 in.) Weight: 4.8 kg (9 lb) nOVA NOVAFLEX Fiber Optic Illuminator (115 V, 60 Hz) nOVAZ NOVAFLEX Fiber Optic Illuminator (230 V, 50 Hz) nOVA186 NOVAFLEX Illuminator & Bifurcated Light Guide LIGHt GUIDES AnD ACCESSORIES 500186 Bifurcated Light Guide (with lenses) R88WPI01 Ring Light Guide for PZM and PZMIII Series* *Requires adapter #13338 for use with PZM, PZMII and PZMIII. 13338* Ring Light Adapter (48 mm ) for PZM, PZMII, PZMIII 502015* Ring Light Adapter for PZMIV SI728 Flexible Light Guide, 72 in . (183 cm) Requires L-32-32 SI408 Flexible Light Guide, 40 in . (102 cm) Requires L-32-32 L3232 Lens for SI-40-8 and SI-72-8 5475 Adapter for SMA-terminated Fiber Optic Cables EJA Replacement Lamp, 150 Watt * A ring light adapter is included with each PZMIII and PZMIV microscope. Flexible light guides SI-72-8 and SI-40-8 are not self-supporting
nOVA SPECIFICAtIOnS
LAMP SIZE POWER 150 W quartz halogen 241316 cm (9 .3754 .756 .25 in .) 115 VAC, 50/60 Hz, 3 A 4 .8 kg (9 lb)
Light guides available separately
WEIGHT
Flexible Light Guides SI408 and SI728, with 8 mm diameter fiber and nonmetallic sheath, are suitable for use in a Faraday cage. (Lens L3232 available separately.) Ring Light R88WPI01 can be used with PZM Stereo Microscope for shadowfree illumination. 18in. (46 cm) flexible cable
ID: 58 mm
L3232
168
Precision Heater Controller

Smart, electrically quiet air heater for live cell imaging systems and custom incubators
Maintenance of the desired temperature set-point can now be achieved through the use of a precision, shielded temperature probe coupled to a peripheral Air-Therm heating unit . Precision: Noise is a major concern in any experimental application . WPI's Air-Therm is electrically quiet as well as acoustically quiet) . Since the Air-Therm can be placed away from the incubator, any residual electrical and vibrational interference from the heater is virtually eliminated . Accuracy of 0 .1C can be routinely maintained at the sample site (using a fully programmable differential algorithm to automatically adjust the temperature on the Air-Therm unit) . AirTherm maintains a uniform temperature across the microscope stage (allowing for uniform heating of multiwell dishes) . These tight tolerances result in minimal focal drift once sample/incubator equilibrium has been achieved . Glass Bottom Dishes: For high numerical aperture (NA) live-cell imaging, cells must be plated on glass (e.g., WPIs FluoroDish Glass Bottom Dishes, spotting 0 .17 mm glass thickness) or standard cover slips . Since cover slips inherit other problems associated with sterility and accidental damage to expensive microscope condensers, WPI designed new and improved glass bottom dishes (35 mm x 10 mm or 35 mm X 22 mm) that are not cytotoxic . A special adhesive in conjunction with an advanced dish design makes the FluoroDish the only non-cytotoxic glass dish in the world . (See page 210.) This means that cells can actually be cultured
for 4 to 5 days in the same dish and then carry the complete cell culture with media from the incubator directly into the (Air-Therm controlled) recording chamber . This is a comfort level that hitherto was unattainable by scientists and clinical researchers since cells will have to be transported from the culture dishes on to cover slips just prior to imagery or attaching patch electrodes . Chamber: The most problematic aspect of any live cell imaging procedure or patch clamp approach is the thermal drift of high magnification lenses caused by temperature fluctuations in the microscope's environment . It is necessary to constantly readjust the focus during image acquisition due to this thermal-drift, introducing artifacts during quantitative microscopy due to the photo-bleaching that occurs during refocusing . The optimal solution to this problem is to use WPIs AirTherm temperature controller connected to a Plexiglas or acrylic chamber that encloses the entire imaging area (or at least the objectives and the stage) . Using such a chamber will result in highly stable temperature control and minimal thermal drift .
AIRtHERM SPECIFICAtIOnS
AIR FLOW RATE CONTROL TEMP . RANGE TEMPERATURE RESOLUTION TEMPERATURE ACCURACY CONTROL MODES ANALOG OUTPUT FOR CHART RECORDER HEATING VOLUME POWER (CE) DIMENSIONS SHIPPING WEIGHT 20 to 50 CFM (0 .55 to 1 .4 cubic meter/M) Ambient to 60C 0 .1 C 0 .2 C (a) Auto (PID set manually, or Self-Tune) (b) Manual tune 0 .5C resolution 0-10V, 0 to 100 C (default, adjustable via controller) More than 4 cu ft (85 liter), non-circulating 300 W, 95-135 V or 220-240 V, 50/60 Hz 612 x 8 x 712 in . (15 .5 x 21 x 19 cm) 10 lb (4 .5 kg)
AIRtHERMYAtX Air-Therm Heater 120 V, U .S . AIRtHERMZAtX Air-Therm Heater 240 V Specify line cord 2 pieces of 4.5 ft clear, coil-reinforced heater hose included with Air-Therm. Specify Line (Mains) Voltage OPtIOnAL ACCESSORIES 15590 Clear hose, 2 .5 diam ., 4 .5 ft 300276 Replacement platinum temperature probe 3491 5 ft (1 .5m) probe extension cable
169
Digital Microscope Cameras
USBCAM100
This high performance camera incorporates a half-inch 20481536 CMOS image sensor (3.1 Megapixels) capable of operating up to 12 frames per second (fps) with full resolution and at near video quality (27fps) at XGA (1024768) resolution . That is nearly three times faster than a CCD . By combining the speed of this camera and a proprietary driver with Twain for Windows XP and Vista, you get real-time imaging . That means no offline processing . Using USB 2 .0 connectivity to transfer images to a computer, the simple plug-and-play software allows the resolution to be easily modified . The USBCAM100 includes XLICap software that features: Simple layout with toolbar Pan and Zoom Selectable image resolutions Mirror/Flip/Rotate image Variety of file formats Record live video Email a screen shot On-screen annotation and time/date stamping Freeze image at any time Copy to clipboard and paste into other applications Automatic one-touch white balance Color or black and white mode Save and restore Custom Preference Profiles USBCAM100 Digital Microscope Camera, 1/2-in . CMOS
USBCAM33 IMAGE SENSOR MAX RESOLUTION SIZE SPEED (PC DEPENDENT)
USBCAM33 / USBCAM50
Record images directly to your computer . These digital microscope cameras offer flexibility, with a range of configurations for image capture, a choice of mount option (C or CS) and file output alternatives . Since both cameras connect via the USB port, installing the image capture software is simple . Either camera can be used on WPIs stereo microscopes PZMTIV, PZMTIII, compound microscopes W30ST and GPL-T and also the PSMT5 Surgical Microscope . Choose from the one third-inch CCD with 1024768 resolution and 30 frames per second (USBCAM33) or one half-inch CCD with 13601024 resolution and 15 frames per second (USBCAM50) . These cameras include IC Imaging Control 3 .0 software that features: Real-time video preview Text and graphics can be drawn on a live video stream Scroll and Zoom Acquisition of single frames Capture pause, for intermittent image capture Timestamps USBCAM33 USBCAM50 503536 Digital Microscope Camera, 1/3-in . CCD Digital Microscope Camera, 1/2-in . CCD Cable, USB Extension (male-female)
USBCAM100 1/2-in . CMOS, 3 .1 M pixels 2048 x 1536, 1024 x 768 3 .2 m x 3 .2 m up to 12 fps @ 2048 x 1536; up to 27 fps @ 1024 x 768 400-1000 >52 dB 1 v/lux-sec BMP, TIFF, JPG Automatic/Manual Automatic/Manual Image size, brightness, gain, exposure time -50C ~ 70C USB cable, 2 m Windows XP, (SP2), 2000, Vista Image-processing software: XLICap, Driver for USB 2 .0 C-Mount 86 x 30 x 60 mm 136 g (4 .8 oz) Tungsten, Fluorescent
USBCAM50 1/2" Sony CCD, progressive scan 1360x1024 4 .65 m x 4 .65 m 15fps, 7 .5fps or 3 .75fps @ 1280x960BY8; 7 .5fps or 3 .75fps @ 1280x960UYVY 450-700 ADC: 10 bit, output: 8 bit 0 .5 lux @ 1/7 .5 s BMP, JPG Automatic/Manual Automatic/Manual Toolbar options for time image sequencing and recording -5C ~ 45C USB 2 .0 cable Windows XP, Vista (32 & 64 bit) or Windows 7 (32 & 64 bit) IC Imaging Control Software C/CS-Mount 50 .6 x 50 .6 x 50 mm 265 g (9 .5 oz) Automatic/Manual
1/3 Sony CCD, progressive scan 1024x768 4 .65 m x 4 .65 m 30fps, 15fps, 7 .5fps or 3 .75fps @1024x768BY8; 15fps, 7 .5fps or 3 .75fps @ 1024x768UYVY 450-700 ADC: 10 bit, output: 8 bit 0 .5 lux @ 1/15 s BMP, JPG Automatic/Manual Automatic/Manual Toolbar options for time image sequencing and recording -5C ~ 45C USB 2 .0 cable Windows XP, Vista (32 & 64 bit) or Windows 7 (32 & 64 bit) IC Imaging Control Software C/CS-Mount 50 .6 x 50 .6 x 50 mm 265 g (9 .5 oz) Automatic/Manual
WAVELENGTH (nm) DYNAMIC RANGE SENSITIVITY FILE FORMAT EXPOSURES SHUTTER CONTROL PROGRAMMABLE CONTROL WORKING TEMPERATURE INTERFACE SYSTEM REQUIREMENT SOFTWARE LENS MOUNT CAMERA BODY WEIGHT WHITE BALANCE
170
Color Video Camera for Microscopy

Sensitivity of 0 .2 lux @ f1 .2 Resolution of 470 TV lines No burn in, no image lag, no geometric distortion . Magnetically shielded . Composite video out at 1 Vpp @ 75 ohms . Power consumption under <2W @ 12VDC S/N ratio 52 dB, typ ., 60 dB max . Gamma of .45 . Operating temperature range of 20 to 50C . White balance color temperature switchable Includes standard tripod mount, power supply, 6-ft (~2m) BNC cable, RCA adaptor .
COLCAM
Specifically chosen for its high quality video imaging and large 12 CCD (8mm), the Colcam is the clear choice for WPI Trinocular microscopes . This camera was specifically detailed for use with WPI standard C-mount couplers to assure the quality capture of still images and video . COLCAM incorporates the latest CCD image sensor for color signal output to NTSC (North American) or PAL (European) video systems . A
COLCAM SPECIFICAtIOnS
ntSC
Image Device Picture Elements Scanning System Min. Illumination Resolution Dimensions Weight 1/2-inch CCD 811 x 508 525 lines, 60 fields / sec
PAL
1/2-inch CCD 795 x 596 625 lines, 50 fields / sec
high signal-to-noise ratio of 50 dB permits clear images with low light levels . A C-mount is required for use with microscopes . Includes a standard tripod mount, power supply and 6-ft BNCterminated cable with an RCA adaptor . (Lens not included.)
COLCAMNTSC COLCAMPAL
Color CCD Video Camera, NTSC (120 V, US plug) Color CCD Video Camera, PAL (240 V, Specify British or Euro plug)
0 .2 Lux/F1 .2 (5600K) 470 TV lines 35 x 35 x 42 mm (1 .4" x 1 .4" x 1 .7") < 300 g
Microscope Mount: Please specify model of microscope when requesting a quote. If PAL is needed in 120-volt systems or NTSC in 240-volt systems, please specify.
C-Mount Eyepiece Adapters

For 1/4-inch (4mm diagonal), 1/3-inch (6 mm diagonal) and 1/2-inch (8mm diagonal) video cameras and eyepiece camera conversion, this lens and its accessories make it possible to connect a typical video or C-mount camera to almost any microscope on the market . The lens fits right into the ocular socket of standard 23 .2mm microscopes and the 30mm adapter allows for use on the typical stereo zoom microscope . If you already have a trinocular microscope you can add the included C-Adapter to the top of an existing 1X C-mount (no lens) adapter . For a list of 1X C-mounts for popular microscopes, visit WPIs website and search for C-mounts . 503097 503098 * Adapter, 0 .45X for 1/3-in . and 1/2-in . video cameras, 30 mm Stereo adapter, 1X C-mount adapter Adapter, 0 .28X for 1/4-in . video cameras, 30 mm Stereo adapter, 1X C-mount adapter
SLR Digital Camera-to-Microscope Eyepiece Adapter

This adapter connects T-mount SLR digital cameras to almost any microscope on the market . The adapter is built to 23 .2 mm ocular tubes that are found on most high magnification (upright, inverted, standard) microscopes . The 30 mm adapter allows mounting on most Stereo zoom microscopes that use 30 mm oculars . If you already have a trincocular microscope you can add this adapter to the top of an existing 1X C-mount adapter . For a list of 1X C-mounts for popular microscopes, visit WPIs website and search for C-mounts The 2X magnification of this microscope adapter yields an approximate 65% field of view from the visual field as measured on a Canon 10D Digital camera . (CCD Sensor size = 22 .7 x 15 .1 mm) . 35 mm film reference size is 24 x 36 mm . Please contact your camera dealer for a suitable T-mount to bayonet adapter for your camera . 503099 Adapter, 2 .0X for SLR digital Cameras (includes 30 mm Stereo adapter, 1X C-mount adapter )
* For adapter 503098 to mount properly, the 1/4-inch CCD camera must have a minimum of 13 mm clearance, measured from the front of the C-mount ring to the CCD surface.
503097
era Cam not in clud ed.
503099
503098
171
FluoroDish
Cover-glass bottom for observing and growing cells in imaging related research
Optical quality glass bottom for better imaging quality (RI=1.525) Low sample volume for expensive chemicals Lowest access angle for micropipette Low toxicity adhesive for embryo research
WPIs FluoroDish tissue culture dishes are now available in a larger range of sizes and coatings . These polycarbonate dishes provide exceptional imaging quality for many applications requiring the use of inverted microscopes such as high resolution image analysis, microinjection and electrophysical recording of fluorescent-tagged cells . Taking advantage of WPIs extensive experience with low toxicity adhesives, FluoroDish uses a specially formulated adhesive that is optically clear, durable and with extremely low toxicity . Tests by an independent laboratory have shown that the 96-hour surviving rate of embryos is 100% when kept in FluoroDish, substantially better than some other brands . The bottom glass has superior UV transmission (30% transmission at 300 nm, compared to less than 7% for the most popular German glass) . Stringent quality control ensures that glass thickness stays within the 0 .17 0 .01 mm range .
brighter images for fluorescence and higher resolution in Image Analysis . The glass bottom permits the use of immersion objectives with medium such as water, glycerin or oil for the highest magnification possible . To optimize heatexchange, WPIs glass-bottom dish is designed to be flush (flat) with the microscope stage or heating unit, therefore eliminating the air gap that exists with modified plastic dishes in which a glass cover slip has been inserted . Three different sizes of FluoroDish are offered, one type of 50 mm diameter dish and two types of 35 mm diameter dishes . An inner well is created within the dish by the glass bottom and the tissue culture grade polystyrene which forms the sides of the dish . All WPI dishes have the advantages of low toxicity and good UV transmission bottom glass . They are individually packed and gamma sterilized . The 35 mm dish has outside dimensions similar to that of a Corning 35 mm dish and has 23 .5 mm glass window (FD35) or 10 mm glass window (FD3510) . Most heaters and perfusion adapters designed for the Corning 35 mm dish will also fit this dish . The 23 .5 mm glass window dish is available uncoated, poly-D-lysine-coated, or collagen-coated . Certain types of cell lines
(e.g., PC3 and HEK) adhere well to the uncoated glass bottom dish . The poly-D-lysine coating has been reported to improve the adhesion of neuron cells, and type I rat tail collagen has been reported to improve the adhesion of muscle cells . The users can also apply to the uncoated dish any special coating that is best for their cell line . The 10 mm glass window dish (FD3510) has low sidewall for easy microelectrode access and low solution volume . The low microelectrode access angle is the lowest among all of 35 mm dishes on the market (very close that of a 50 mm dish) . The dish needs only 100 ~ 200 mL to cover the bottom well, an important feature when using expensive drugs and chemicals . The 50 mm dish (FD50) has a large growth area (35 mm well diameter), a low access angle for microelectrodes, and grips for easy handling .
OD ID
Conventional plastic dishes and chambers limit the utility of the inverted scope for many applications because the thick plastic bottom Access h requires a long working distance objective Angle H available only in lower magnifications . Each WPI dish has a flat (0 .17 mm thick) optical quality glass bottom, allowing the use of a much Glass shorter objective working distance, larger numerical Part number ID (mm OD (mm) Glass (mm) height (inside) Height (outside) Access Angle aperture (NA), and a FD35 33 35 .5 23 .5 7 .8 9 29 higher magnification FD3510 10 35 .5 10 1 .5 4 .65 17 (up to 100x) . The FD5040 47 .5 49 .82 35 7 .25 7 .4 17 larger NA and higher magnification provide superior quality imaging for both classical FD35100 FluoroDish Sterile Culture Dish, clear wall, 35 mm, 23 mm well, box of 100 and fluorescence FD35COL100 FluoroDish Sterile Culture Dish, Collagen Coated, clear wall, 35 mm, 23 mm well, box of 100 microscopy . Higher FD35PDL100 FluoroDish Sterile Culture Dish, Poly-D-Lysine Coated, clear wall, 35 mm, 23 mm well, box of 100 effective NA yields FD3510100 FluoroDish Sterile Culture Dish, clear wall, 35 mm, 10 mm well, low sidewall, box of 100 FD5040100 FluoroDish Sterile Culture Dish, clear wall, 50 mm, 35 mm well, box of 100
Choose from poly-D-lysine or collagen coated, or uncoated
172
Cover Slips
These cover slips made of German glass can be used for growing and culturing cells that normally have poor adhesion to plastic surfaces . They are small enough to be placed in the micro plate or other cell culture devices . The 5 mm size will fit inside the 96-well culture plate and leave enough room to pick it up from the bottom of the well with forceps . The 8 mm size fits inside the 24-well plates .
Order number 502040 502041 503508
Diameter 5 mm 8 mm 25 mm
thickness #1 .5 (0 .16 - 0 .19 mm) #1 .5 (0 .16 - 0 .19 mm) #1 .5 (0 .16 - 0 .19 mm)
Quantity 100 100 100
Slides
These clean glass microscope slides are 25 x 75mm, 1 .0~1 .2mm thick with 90 grounded edges . and are available plain, frosted, and red ended . The frosted end slides feature
a fine 20mm frosted area on both sides of one end for easy marking . The red frosted slides feature a 20mm colored end useful for identifying hazardous materials .
503505
503507
503506
503505 503506 503507
Plain Glass Microscope Slides, Box of 144 Frosted Glass Microscope Slides, Box of 144 Red frosted Glass Microscope Slides, Box of 144 173
Microforges
DMF1000 Complete Microforge System ................................................................................................................................176
MICROFORGES, PULLERS, BEVELERS
MF200 Complete Microforge System ......................................................................................................................................175
Microbevelers
48000 Microbeveler ....................................................................................................................................................................179 MBS MicroBeveler System ..........................................................................................................................................................179 1300M Microelectrode Beveler .................................................................................................................................................178
Impedance Meters
Omega-Tip-Z Millivolt and Megohm Meter ..........................................................................................................................103
Pullers
PMP-107 Programmable Multipipette Puller ........................................................................................................................180
Application Guide
P/N Description Complete Microforge System; includes Programmable Digital Controller and Microscope Application Fabrication of special shapes of glass micropipettes, e.g., pressure polishing of patch clamp pipettes and making of holding pipettes. Unique for pipette tip calibration and microinjection pipettes. Use to fire polish glass micropipettes and prepare special shapes Bevels micropipette tips larger than 1 micron at 4000 rpm for applications such as microinjection. Glass micropipette beveler for submicron tips. Not for cell injection. Glass micropipette beveler for submicron tips. Not for cell injection. Includes all necessary accessories. Measures impedance of metal and glass capillary microelectrodes. Produces two symmetrical 4- or 7-barrel glass pipettes Comes with probe, probe handle and cables. Upgrade from model PMP-100. Equipped with microcomputer, pneumatic pulling arm, pneumatic rotator, optical-digital ruler. Pulling process is programmable and under control of a preset sequence. Features Most sophisticated and only microforge on the market with built-in pressure polishing capability. Programmable controller with 10 user-selectable memory storage (of heat and time) for reproducibility. Comes with W30S Microscope, a 40x objective and three filament sizes. Uses exclusive Kohler illuminator instead of industry standard frosted glass illuminator for less glare and sharper image. Solid surface unit beveler with rotating disk. Includes basic kit with abrasive alumina lapping film. Includes M3301R Manipulator and M10 magnetic stand.
DMF1000
MF200
Complete Microforge System, with analog controller
48000 1300M MBS Omega-Z
Microbeveler System Microelectrode Beveler and Start-up kit Microelectrode Beveler System Omega-Tip-Z with Probe and Holder
PMP-107
Programmable Multipipette Puller
174
Sometimes the simplest designs work best.

The MF200 Microforge is a versatile instrument designed specifically for the fabrication of glass micropipettes and other related tools. The system was developed in collaboration with Dr. Ming Li of the Department of Pharmacology, University of South Alabama. It is perfect for patch pipette tip polishing, tip size reduction, contact stretching, in vitro fertilization pipette production and a variety of other pipette configurations. The MF200 simple, reliable and is priced economically.
MF200 Microforge
Features of the MF200

The MF200 system includes: An easy to use analog temperature controller, a specially configured WPI model W30S research grade compound microscope, 40x long-working distance objective and 10x eyepiece. 40x magnification is essential when polishing pipettes as small as half a micron (0.5 m) in diameter. Compared to a conventional 40x objective, the long working distance objective reduces the danger of damage to the pipette and/or objective lens during the polishing process. It is also the only commercial microforge using the Kohler illuminator and Abbe condenser for illumination. This provides less glare and sharper image of the pipette than frosted glass illuminator, which was used on all of the other commercial Microforge.
MF200 SPECIFICAtIONS
MF200-1 Complete Microforge System, incl. W30S Microscope (110 v) MF200-2 Complete Microforge System, incl. W30S Microscope (220 v) MF200-M1 MF 200 without microscope (110v) MF200-M2 MF 200 without microscope (220v) *Above MF200 microforges include 40X long working distance objective OPtIONAL ACCESSORIES 500292 Optional 15 Eyepieces (pair) Note: No reticle available for 15 eyepieces 500329 25 Long-Working Distance Objective (fits most microscopes with a 160 mm Focal Length) 13142 Optional foot switch REPLACEMENt ACCESSORIES MF200-H2 Replacement heating filament (large gauge) MF200-H3 Replacement heating filament (medium gauge) MF200-H4 Replacement heating filament (small gauge) 75070 Filament Adjustment Assembly for 22mm OD Objectives 75050 Replacement Micropipette Slide 75040 Replacement Filament Cable
AC POWER MODULE FILAMENTS (3) FILAMENT ON 100-240 VAC 50/60 Hz H2, H3, H4 Pushbutton Controlled or Optional Foot Switch Controlled
FILAMENT ADJUSTMENT ASSEMBLY For 40 and 25 Long-Working Distance Objectives: mounts on objective OBJECTIVE OPTIONAL EYEPIECE RETICLE (10 eyepiece only) OPTIONAL EYEPIECE GLASS HOLDER DIMENSIONS: Control Unit SHIPPING WEIGHT MICROSCOPE SHIPPING WEIGHT 40 Long-Working Distance (3 mm) 25 Long-Working Distance (5 mm) 10 (pair) 1.25 m/division (at 40) 0-90 Angle at 5/division 15 (pair) Mounts on Microscope Stage 4 7 178 in. (10.2 17.8 4.8 cm) 3 lb. (1.4 kg) See W30S 16 lb. (7.3 kg)
MICROFORGE FEAtURE COMPARISON

W30S Microscope 40x Long Working Distance Objective Analog Controller Digital Controller Pressurized Air Control Microinjection Capability Optional Foot Switch Memory Auto-sense of Filament Type Digital Temperature Control
MF200
DMF1000
175
Microforging, Micropipette Calibration and Microinjection in a single device!

The DMF1000 is a state-of-the-art microprocessorcontrolled microforge offering unmatched performance. Designed for fabrication of both small patch clamp glass pipettes and larger injection pipettes, the DMF1000 should find many uses in the laboratory. The DMF1000 is based on a design similar to that first used in WPIs extremely popular microforge model, the MF200. The extensive improvements incorporated into the DMF1000 greatly increase its versatility and performance, making it one of the most powerful microforges on the market.
Digital Signal Processor (DSP) technology

The DMF1000 is powered by the latest digital signal processor (DSP) technology. A digital timer is used to precisely control the polish heating time. Ten memories can be used to store settings of the heating power and heating duration. All of the settings are controlled and displayed digitally for better accuracy and reproducibility. Two different operating modes are provided: Manual and Auto. In the Manual mode, the DSP will memorize the duration of the time that is used to achieve a desired polishing. In Auto mode, the heat will be applied for the duration of the timer setting.
Unique Features of the DMF1000 System

The DMF1000 system includes a specially configured WPI model W30S research grade compound microscope equipped with a high quality metallurgic 40x long-working distance objective and a pair of 10x eyepieces. It is the most powerful long-working distance objective currently available on any commercial microforge. The long working distance objective reduces the danger of damage to the objective lens during the heating process. Other benefits of the DMF1000 design include the use of a Kohler illuminator and Abbe condenser, which provide the reduced glare and sharper image contrast necessary when polishing pipettes as small as half a micron (0.5 m) in diameter.
Filament Holder mounts directly to objective to provide precise control of heating element position.
Ease of use
the Heating Filament
With a conventional microforge often the most difficult and time-consuming part of using a high magnification objective is being able to move both the heating filament and the pipette into the same viewing area. Finding and moving both the heating filament and the pipette without collision can be a challenge. However, this difficulty is eliminated with the DMF1000 because the heating filament is directly attached to the microscopes objective. Hence it can be easily adjusted to any position within the viewing area.
Pressure Polishing
The DMF1000 incorporates a unique digital pneumatic pressure feature that enables pressurized air to be delivered through the pipette during fire polishing. In the fabrication of patch pipettes, the pressurized air can be used to blunt the taper at the pipette tip without changing the size of the tip opening. This reduces electrical resistance of the tip, leading to lower noise during patch-clamp recordings (Goodman & Lockery, 2000).
polishing temperatures without excessive heat. This permits the user to bring the pipette tip close to the filament during polishing without fear of collapsing the pipette tip. Low heat capacity eliminates the need for an auxiliary air-cooling system. The low coefficient of expansion characteristic of the filament ensures minimal displacement of the filament during heating. This feature eliminates much of the guesswork out of tip placement in relation to the filament.
Two different heating filaments are provided with the DMF1000 to accommodate various applications. The H5 filament is large gauge and can be reformed into a U for fabrication of pipettes, air forming of patch pipettes and other applications. The H4 is a smaller gauge filament and is ideal for polishing patch clamp pipettes.
The low heat capacity and low thermal coefficient of linear expansion of the filaments are key design features of the DMF1000. The low heat capacity of the filament allows it to reach fire-
the Pipette and Microscope Stage

The pipette rests on a specially designed holder that sits on top of the microscope stage. The position of the pipette, relative to the heating filament, is controlled by the (X, Y, Z) adjustment of the stage. This unique design makes locating and polishing the pipette extremely easy. The stage of the microscope has a high quality rail that gives precise, smooth and stable control of the pipettes movement. This configuration also eliminates the need and expense of an additional micromanipulator to control pipette movement.
Fire Polishing
Large Tip Sharpening (contact stretching)
Tip Sealing
Tip Reducing (holding pipettes)
Tip Bending
Carbon Fiber Sealing in Plastic Sensor
176
typical applications of the DMF1000

Polishing the Patch Pipettes
It is well known that the proper fire polishing of patch pipettes is the single most important factor for forming a stable giga-seal in patch clamp recording. This is even more important than the type of glass capillary used. Difficulties often arise in forming giga-seals because the polishing of patch pipettes using a conventional low magnification microforge is inadequate. However, since the DMF1000 uses a 40X long-working distance objective, pipette polishing is much more accurately controlled. Pipettes polished using the DMF1000 achieve excellent stable giga-seals with a wide variety of cells. Both whole cell patch pipettes and single channel patch pipettes can be conveniently polished with the DMF1000 to the highest quality and reproducibility achievable with any microforge. For the single-channel patch clamp pipettes the pipette needs to be pre-coated with Sylgard 184 before polishing. For this procedure the user can follow a simple and effective coating method described previously (Li, 1999)
ProfessionalGrade Microscope
The W30 professional-grade microscope is a best-seller in universities, medical schools, and reseach laboratories. Equipped for performance, its features include titaniumfinished DIN or Semi-Plan optics and a 30-year anti-fungal coating. The W30 is the choice for superior performance at a great price. W30S W30St 503513 503514 Binocular Microscope Trinocular Microscope 21 mm 10X Eyepiece with 100/10 reticle Replacement Lamp
Microforging Holding Pipettes

A holding pipette with a large blunt tip and a small opening is used to hold a floating cell in place prior to microinjection by applying suction to the rear of the pipette. The procedure for making holding pipettes involves three steps: squaring off, large bore flame polishing, and tip reducing. These steps are accomplished with a larger heating filament.
Microforging Beveled Injection Pipettes

Occasionally, a beveled large bore pipette is not sharp enough to penetrate a cell without damaging the area around the pipette. With the DMF1000 and the large heating filament, a sharp point can be formed on the beveled tip to assist the penetration of the cell. This process is referred to as contact stretching.
Pipette tip Calibration & Microinjection

The integrated digital pneumatic pressure system can be used to calibrate the precise diameter (I.D.) of a micropipette tip, based on a technique described previously (Hagag & Randolph 1990, Bowman & Ruknudin 1999). The pressure system can also be used separately as a simple but highly accurate controller for microinjection applications.
DMF1000 SPECIFICAtIONS
AC POWER MODULE TIMER RANGE (for heater & timer) NUMBER OF MEMORYS PRESSURE ADJUSTING RANGE PRESSURE RESOLUTION FILAMENTS 100-240 VAC 50/60 Hz 0.01 to 360 sec 10 0.5 60 PSI (3.5 414 kPa 0.1 PSI (0.7 kPa) H4 Small filament for working with 40 long working distance objective. H5 Large filament for working with 10 objective. Filament adjustment assembly provided for both objectives. Auto or Manual via Pushbutton, TTL, or Optional Foot switch. 4 7 178 in. (10.2 17.8 4.8 cm) 4 lb. (1.8 kg) See W30S, page 205 16 lb. (7.3 kg)
HEATER AND TIMER CONTROL DIMENSIONS: Control Unit SHIPPING WEIGHT MICROSCOPE SHIPPING WEIGHT
W30S SPECIFICAtIONS
HEAD Binocular (Seidentopf) Inclined 30, rotates 360 Dual diopter adjustment, Interpupillary distance range 55-75mm 10X/18 wide field eyepieces Quadruple forward-facing nosepiece DIN Plan, anti-fungal 4X, 10X, 40X, 100XR (oil) Parfocal, parcentric, color-coded Mechanical stage (140mm x 140mm) Coaxial drive controls XY Movement: 73mm x 43mm Coarse adjustment: range of 30mm Fine adjustment: graduation of 2m Tension control knob Moveable Abbe condenser, NA 1.25, Iris diaphragm Variable halogen light source (12V/20W bulb) 110V/220V switchable electronics
NOSEPIECE
DMF1000-1 Complete Microforge, incl W30S Microscope (110 v) DMF1000-2 Complete Microforge, incl W30S Microscope (220 v) DMF1000-M1 Microforge without microscope (110v) DMF1000-M2 Microforge without microscope (220v) *Above DMF1000 microforges include 40X long working distance objective OPtIONAL ACCESSORIES 500329 25x Long Working Distance Objective, 5 mm 0.50NA 500292 Optional 15x Eyepiece (pair) 13142 Optional foot switch REPLACEMENt ACCESSORIES 800292 40x Long Working Distance Objective, 3 mm 0.25NA 503513 21 mm 10X Eyepiece with 100/10 reticle DMF1000-H5 Replacement heating filament (large gauge) MF200-H4 Replacement heating filament (small gauge) 75050 Replacement Micropipette Slide 75040 Replacement Filament Cable
OBJECTIVES
STAGE
FOCUS
ILLUMINATION
DIMENSIONS AND WEIGHT 15 (38cm) x 9 (23cm) x 7 (17.8cm) (h x l x w) 14 lbs. (6.4kg)
177
Glass Micropipette Beveler for submicron tips
Easier cell impalement results in less damage and longer cell life
An optically-flat mirrored glass disk, wetted with an abrasive slurry, spins at 60 rpm (120 V), producing sharply beveled tips on fluid-filled glass microelectrodes of one micron or smaller. This eases cell impalement and improves the electrode's linearity. The microelectrodes resistance can be monitored during beveling with WPIs mega-Tip-Z megohm meter (see page 103). The beveler is permanently mounted on a precision magnetic plate that gives stable support for the optional 1350M Micropositioner shown. Start-up kit includes 0.05 m alumina abrasive powder #3531, wick electrode, and wick support. SYS-1300M Microelectrode Beveler & Start-Up Kit (micropositioner not included) Specify line voltage. Model 1350M Micropositioner This package (shown with beveler above) includes WPIs M3301R Manipulator and an M10 magnetic stand. The stand-manipulator assembly mounts directly onto the beveler baseplate, allowing convenient positioning of electrodes onto the beveling surface. Three axes of adjustment, including coarse and fine control in the axis of the electrode.
1300M SPECIFICAtIONS
BEVELING SURFACE MAXIMUM BEVEL ALUMINA ABRASIVE POWDER RPM MOTOR POWER REQUIREMENTS DIMENSIONS Steel base plate Overall height Height of abrasive surface SHIPPING WEIGHT 7.8 cm diameter, optically flat reflective glass 0.5 , I.D. 0.05 size supplied (0.3 also available) 60 rpm at 120 V, 60 Hz; 50 rpm at 240 V, 50 Hz AC synchronous 95-135 V or 220-240 V, 50/60 Hz 8.5 x 11 x 0.375 in. (22 x 28 x 1 cm) 4 in. (10 cm) 2.75 in. (7 cm) above base plate 20 lb (9.1 kg)
OPtIONAL ACCESSORIES 2478 Replacement Mirrored Disk 3531 Alumina Abrasive, 0.05 m (5 g) fine 3551 Alumina Abrasive, 0.30 m (5 g) 2479 Replacement O Ring SYS-OMEGAZ mega-Tip-Z with Probe & Holder 711P Replacement Probe 5468 Adapter to connect metal microelectrodes to probe, 2 mm socket to .031 in. receptacle NOVA Novaflex Fiber Optic Illuminator (115v, 60HZ) NOVA-Z Novaflex Fiber Optic Illuminator (230v, 80HZ) 500186 Bifurcated Light Guide with lenses NOVA-186 Novaflex Illuminator and bifurcated light guide MES Microelectrode Beveler System
MES includes: 1300M Microelectrode Beveler; 1350M Micropositioner & Magnetic Stand; OmegaZ; 5052 Steel Base Plate; 5468 Adapter; 3485 Ringstand Mount. Shipping Weight: 59 lb. (27 kg)
178
the only microbeveler system
with Guided Light!
System now includes PZMIII stereo microscope Bevel micropipette tips larger than 1 micron, for applications such as microinjection
l Tool holder on microscope keeps pipette in focus during beveling l Steel base provides solid support for beveler and other magnetic stands l Includes stereo zoom microscope PZMIII with up to 90x magnification l Variable speed, reversible l Abrasive surface can be easily replaced by several types of Diamond and Alumina Lapping Film l Pipette tip illuminated internally via fiber optic illuminators
MBS MicroBeveler System Includes all components pictured above: 48000 MicroBeveler, NOVA illuminator, fiber optic cable, PZMIII Stereo Zoom Microscope with tilting base especially adapted for use with MicroBeveler, two clear 20x eyepieces, one 20x eyepiece with reticle, tool holder, and pipette holder FOIMPH. SYS-48000 MicroBeveler Specify line voltage OPtIONAL 48015-03 48015-10 48015-30 48014-01 48014-05 48014-10 48014-30 48025 15934 48300 48200 ACCESSORIES Lapping Film, Alumina, 0.3 micron (50-pack) Lapping Film, Alumina, 1 micron (50-pack) Lapping Film, Alumina, 3 microns (50-pack) Lapping Film, Diamond, 0.1 micron (3-pack) Lapping Film, Diamond, 0.5 micron (3-pack) Lapping Film, Diamond, 1 micron (3-pack) Lapping Film, Diamond, 3 microns (3-pack) Fiber Optic Cable for Pipette Illumination Replacement Beveler Disk Plate Tilt Base Assembly for PZMIII binocular head PZM Tool Holder
The advantage of WPIs MicroBeveler over other types of solid-surface bevelers is that the abrasive surface can be easily refreshed. Instead of using a conventional solid abrasive disk, the MicroBeveler abrasive surface is made of a high quality lapping film, widely used in the fiber optics industry. When the surface is damaged or loaded up with glass particles, the abrasive film can be easily replaced. The solid polishing surface of WPIs new MicroBeveler, turning at 6,000 rpm, provides sufficient cutting force for a very sharp tip in a very short time. The cutting surface is very flat and turns very smoothly, ensuring an undamaged tip.
48000 SPECIFICAtIONS
BEVELING SURFACE ABRASIVE MATERIAL SPEED OF ROTATION MOTOR POWER REQUIREMENTS 3.5 inch diameter disk alumina, diamond 100 to 6000 rpm Reversible Direction 120 volts, 60 Hz or 240 volts, 50 Hz, 20 VA to supplied power supply 8.7 11 0.4 in. (22 28 1 cm) 3 in. (8 cm) 16 lbs. (7.6 kg.) 35 lbs. (16 Kg.)
DIMENSIONS Base Plate Overall Height SHIPPING WEIGHT (48000) SHIPPING WEIGHT (MBS)
179
Programmable Multipipette Puller

PMP-107
l Double top panel structure. l Automatic 4-Barrel or 7-Barrel Pipette Puller. l Exclusive Optical-Digital Ruler Measurement. l Computerized Real-Time Feedback Heater Control. l Pneumatic Pulling Force and Compact Size. l Programmable and Savable Sequences for Creation and Reproduction. l Manufacture Preset Pulling Programs for 4 and 7-Barrel
PIPETTES EACH BARREL O.D. PULLING FORCE HEATER HEATER CONTROL HEATING NUMBER OF SEQUENCES STEPS PER SEQUENCE TAPER LENGTH SETTING PRESSURE 1 PRESSURE 2 COOLING PRESSURE GAS INPUT PRESSURE ACTIONS DISPLAY POWER INPUT POWER CONSUMPTION DIMENSIONS WEIGHT
PMP-107 SPECIFICAtIONS
Single- to 7-Barrel 1 mm (2 mm for single-barrel) Pneumatic Nichrome coil or foil Microcontroller 74 general heat levels (24-99), 64 automatic heat levels (45-98) 25 18 0.5 - 20 mm Adjustable 0.1 - 10 psi Adjustable 0.1 - 60 psi Adjustable for rotation speed 30-60 psi Pull 1, Pull 2, Pull2/Cool, Rotation, Cool Air, Return 20x4 LCD 110 / 240 VAC Maximum 150 watts 14 x 11 x 7 in. (35.6 x 27.9 x 17.8 cm) 15 lb (6.8 kg)
The PMP-107 Programmable Multipipette puller can pull a one to 7-barrel pipette with easy push-button processing. Equipped with a microcomputer, pneumatic pulling arm, pneumatic rotator, optical-digital ruler and specially designed clamp, the PMP-107 can automatically heat, twist and pull a multibarrel pipette. There is no need for any manual rotation or any inconsistent timing interrupt control. The whole pulling process is programmable and under control of a preset sequence. The PMP-107 is a new upgrade model from the PMP-100 multipipette puller. The rotation (twist) speed is adjustable. 180
PMP-107 Programmable Multipipette Puller (110 V) PMP-107-Z Programmable Multipipette Puller (240 V)
Fluid Range
Channels
Special features
Page
Peristaltic Pumps
Peripro-2HS Peripro-4HS Peripro-4LS Peripro-8LS MityFlex MINISTAR 0.8 - 300 mL/min 0.8 - 300 mL/min 0.01-80 mL/min 0.01-80 mL/min 1.7-800 mL/min 0.006- 37 mL/min 2 4 4 8 1 1 Calibrated output, replaceable tubing cartridges Calibrated output, replaceable tubing cartridges Calibrated output, replaceable tubing cartridges Calibrated output, replaceable tubing cartridges High volume Compact design, remote control 182 182 182 182 184 184
Laboratory Syringe Pumps

AL-1000 AL-2000 SP100i SP101i SP200i SP220i SP250i SP210iw SP230iw SP120p SP260p SP210c SPLG200 SPLG210 SPLG212 SPLG270 SPLG272 VSP1 0.000073-1699 mL/hr 0.000073-1699 mL/hr 0.0001-519 mL/hr 0.001 L/hr 35mL/min 0.001L/hr - 145 mL/min 0.001L/hr - 21 mL/min 0.001L/hr - 21 mL/min 0.001L/hr - 145 mL/min 0.001L/hr - 21 mL/min 0.1 L/hr 127 mL/hr 0.001L/hr - 86 mL/min 0.001L/hr - 86 mL/min 0.5pL/min to 220.97mL/min 0.5pL/min to 220.97mL/min 0.5pL/min to 220.97mL/min 0.5pL/min to 220.97mL/min 0.5pL/min to 220.97mL/min 0.1 mL/hr - 600 mL/hr 1 2 1 2 2 10 4 2 10 1+1 2+2 2+2 2 2 2 2 2 1 Push/pull Push/pull (2 networked pumps) Basic single channel Micro dialysis application RS232 TTL/Footswitch RS232 Infuse Only RS232 Infuse Only RS232 Infuse/Withdraw RS232 Infuse/Withdraw Push pull, single cycle RS232 push pull, single cycle RS232 push pull, continuous Infuse only Infuse/withdraw Infuse/withdraw programmable Push-pull Push-pull programmable Safety features include two-hour battery operation 185 185 186 186 187 187 187 188 188 189 189 189 190 190 190 190 190 202
PUMPS, MICROINJECTION
Micro Syringe Pump / Stereotaxic Injection

UMP3 MMP DMP 0.03nL/min - 10 L/sec Manual 100 L-1mL syringe Manual 100 L-1mL syringe 1 1 1 Ultra micro infuse/withdraw RS232 Manual Digital readout micrometer 194 199 199
Oocyte Injection
B203XV Bolus, 2.3-69 mL/Injection 1 Oocyte injector, infuse only 198
Single and Multi-channel Micro Pressure Injection

PV820 PV830 Bolus/Continuous Pressure, Duration and Pipette dependent Bolus/Continuous Pressure, Duration and Pipette dependent 1 1 Injection pressure and holding pressure Injection pressure and holding pressure and vacuum 196 196
Microfluidics Control
FL-MFxx FL-FLOWELL 2, 4 or 8 channels. Ranges 25-7000 mBar. Resolution at min. flow 1.8 nL/min. Response time 40ms. Negligible dead volume. Systems include Microfluidics Control Box and software. Items not sold separately Flow monitoring for FL-MFxx systems. For use with the microfluidics control system, not sold separately. 204 204
Supplies & Tools

Syringes for SP Series and Aladdin Series Syringes, Microvolume, for UltraMicroPump III Pressure Manometers NanoFil Specialty Microsyringe NanoFil Application Kits 189 195 199 200 202
181
Peri-Star Pro
High performance digital peristaltic pump at an affordable price!
l Display either rotation speed (RPM) or flow rate (mL/min) l Wide flow range: 0.01 280 mL/min
l Accuracy of flow rate: 0.5% using self calibration function l Accuracy of speed: 0.1 rpm l Large backlit digital LCD display l Programmable for all tubing sizes between 0.8 mm and 6.4 mm ID l Easy and fast tubing replacement using snap-on cartridges l Membrane keypad allows easy programming while protecting controls from fluid entry l Actively driven rollers by planetary gears for long lasting tubing life
Peri-Star Pro peristaltic pumps provide accurate and precise pumping with convenience and versatility. Peri-Star Pro can be run in either flow rate mode (mL/min) or rotation speed mode (rpm). For good laboratory practice, pumps must be calibrated after changing the tubing and solution. Users can easily calibrate Peri-Star Pro to deliver flow as accurate as 0.5% in a wide flow range from 0.01 mL/min to 280 mL/min. Under rotation speed mode, the digitally controlled stepping motor provides accurate and reproducible operation with 0.1% rpm both forward and in reverse. Large backlit digital LCD display provides readouts of rotation direction, flow rate or rotation speed, tubing ID, drive status and 182
remote control mode simultaneously. Water resistant membrane keypad allows easy programming while protecting LCD display and controls from fluid entry. Built-in Human Machine Interface (HMI) with screen instructions in plain English steps users through initial setup, calibration and operating procedures. The user-friendly interface reduces the need to frequently check the printed manual for instruction and reference. Peri-Star Pro is available in two versions: a
4-roller version for high flow and an 8-roller version for lower volumes which provides high pressure with minimal pulsations. A unique planetary gear design with eight actively driven rollers (four rollers for higher flow rate model), together with independent tubing compression fine adjustment, greatly increases flow accuracy and prolongs tubing life. Snap-on cartridges allow tubing to be changed quickly without cross contamination of solutions.
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. China: Tel: 21 68885517 chinasales@china.wpiinc.com
Available in 2-, 4- and 8-channel versions
Pump head for PERIPRO-2HS (2 channels, 4 rollers)
Pump head for PERIPRO-4LS (4 channels, 8 rollers)
Pump head for PERIPRO-4HS (4 channels, 4 rollers)
Pump head for PERIPRO-8LS (8 channels, 8 rollers)
PERI-STAR PRO SPECIFICATIONS

Peri-Star Pro 2H / 4H (High Rate) Number of rollers Number of chaNNels rotor speed raNge fluid flow raNge tubiNg raNge self-calibratioN workiNg eNviroNmeNt power dimeNsioNs shippiNg weight 4 24 1100 rpm 0.8280 ml/min #17 tubing: 3.5280 ml/min 3.16.4 mm id Yes 045c, humidity < 80% 110 v or 220 v ac, 50 - 60 hz 190 x 162 x 275 mm 11 lb / 5 kg Peri-Star Pro 4L / 8L (Low Rate) 8 48 1100 rpm 0.0180 ml/min #14 tubing: 0.218 ml/min 0.52.4 mm id Yes 045c, humidity < 80% 110 v or 220 v ac, 50 - 60 hz 190 x 162 x 275 mm 11 lb / 5 kg
NEW PERI-STAR PRO PUMPS PERIPRO-2HS peri-star pro, 2-channel, high rate, large tubing (110-220v) PERIPRO-4HS peri-star pro, 4-channel, high rate, large tubing (110-220v) PERIPRO-4LS peri-star pro, 4-channel, low rate, small tubing (110-220v) PERIPRO-8LS peri-star pro, 8-channel, low rate, small tubing (110-220v)
OPTIONAL ACCESSORIES 503049 replacement tubing cartridge, large 503050 replacement tubing cartridge, small 503022 replacement silicone tubing, 1m, 1.6 mm i.d., #14, with stops 503023 replacement silicone tubing, 1m, 6.4 mm i.d., #17 503120 ttl control module
183
MityFlex Peristaltic Pump
The MityFlex is an economical, variable speed, peristaltic pump that can handle a wide variety of viscosities from air to gases to heavy slurries, with consistent displacement. This pump can be used for fluid transfer or for metering applications. By varying the tubing a wide range of flow rates can be achieved. This is a great value for medium to high flow applications.
MITYFLEX SPECIFICATIONS
NUMBER OF ROLLERS FLOW RATE RPM RANgE FLOW RATES 2 1.7 to 800 mL/min. Variable speed-reversible 8-228 Tubing I.D. /16 in. 1 /8 in. 3 /16 in. 1 /4 in.
1
Flow Rate 1.7-48 mL/min* 7-190 mL/min 16-456 mL/min 28-800 mL/min
Masterflex Equiv. #14 #16 #25 #17
POWER DIMENSIONS SHIPPINg WEIgHT
115 VAC / 60 Hz or 220 VAC / 50 Hz 22.6 x 14.2 x 19 cm (8.9 x 5.6 x 7.5 in.) 3.6 kg (8 lb)
* To use
/8 -in. or 1/16 -in. tubing, MITY-KIT is required.
Included with the MityFlex are four short lengths of Norprene tubing to fit into the roller mechanism 1/16", 1/8", 3/16", 1/4" and black rollers for use with 3/16" to 1/4" tubing. The optional MITY-KIT includes replacement tubing and a set of red rollers for use with 1/16" and 1/8" tubing. Norprene is a trademark of Saint-Gobain Performance Plastics Corp.
500282 500283 MITY-KIT
MityFlex Peristaltic Pump (110 V) MityFlex Peristaltic Pump (220 V) Replacement Parts Kit with Rollers
MITY-KIT includes 4 short lengths of Norprene tubing to fit into the roller mechanism 1/16", 1/8", 3/16", 1/4" and red rollers for use with 1/16" tubing.
MiniStar Miniature DC Peristaltic

Pump
This compact and lightweight peristaltic pump fits just about anywhere. It can be mounted directly on the bench, in a regular rack or to a post. The MiniStars speed can be adjusted from 1rpm to 50 rpm. With recommended silicone tubing, the volume can be set from 0.06 mL/min to 14.0 mL/min. The MiniStar also features a hand held remote control that allows users to start and stop the pump, purge or adjust its speed and direction.
MINISTAR SPECIFICATIONS
CHANNEL SPEED FLOW RANgE RESOLUTION SPEED CONTROL DISPLAY POWER WORKINg CONDITION TUBINg Wall Thickness Outer Diameter DIMENSION OF DRIVER WEIgHT OF DRIVER 1 1-50.0 rpm, forward/reverse 0.06~14.0 mL/min 1 rpm (0.1 rpm computer control) Remote control Indicators for status and speed 12 V DC (110/220 VAC adapter incl.) Temperature 0-40C, humidity < 80% Two-stop Silicone 0.8~1.0 mm 4.8mm 1357272 mm (LWH) 0.5 Kg
DIMENSION OF REMOTE CONTROL 1055016 mm (LWH)
MINISTAR 503120 503121 503122
Miniature Peristaltic Pump, 1-channel TTL Control Module silicone tubing w stops, 2.4mm id x 0.8mm wall x 1 m (5-pk) silicone tubing w stops, 1mm id x 1mm wall x 1 m (5-pk)
184
Aladdin
Programmable Syringe Pump
l Economical
l Versatile l More Features l Dual Pumping Action

1-60 mL, or 0.5-5 L micro syringes 1 Step Motor, 1/8 to 1/2 step modes 400 0.21 m to 0.850 m 15/28 5.1 cm/min / 0.0042 cm/hr 1699 mL/hr with 60 mL syringe, to 0.73 L/hr with 1 mL syringe 35 lb at min. speed, 18 lb at max. speed 41 100 pumps maximum Wall adapter 12V DC @ 850 mA 22.9 x 14.6 x 11.4 cm (8.75 x 5.75 x 4.5 in.) 1.6 kg (3.6 lb)
ALADDIN SPECIFICATIONS
SYRINgE SIZES NUMBER OF SYRINgES MOTOR TYPE STEPS PER REVOLUTIONS STEPPINg (max. min.) MOTOR TO DRIVE SCREW RATIO SPEED (max./min.) PUMPINg RATES MAXIMUM FORCE NUMBER OF PROgRAM PHASES RS-232 PUMP NETWORK POWER SUPPLY DIMENSIONS WEIgHT
Need a pump for two syringes? Two Aladdin pumps when daisy-chained are more efficient and affordable than any competitors dual syringe models. Two Aladdins (AL-2000) will perform as a dual infusion/withdrawal pump, a double pump for infusing at different rates, a push/pull pump with one infusing and one withdrawing at the same or different rates, two independent pumps, or a master/slave pump. One Aladdin can even control the second for continuous pumping with optional check valve set. The Aladdin pump series will accept syringes from Becton Dickinson, Monoject, Terumo, and Air-Tite.
AL-1000 Programmable Syringe Pump AL-2000 Two AL1000 Syringe Pumps Includes GN-TTL Interconnecting Cable for push/pull or continuous pumping. Valves not included. Specify line voltage When ordering 220V models, specify UK, Euro or Australian line cord. OPTIONAL ACCESSORIES GN-PC7 PC to pump cable, 7 ft GN-PC25 PC to pump cable, 25 ft GN-NET7 Pump-to-pump network cable, 7 ft GN-NET25 Pump-to-pump network cable, 25 ft GN-TTL Pump-to-pump reciprocating cable ADPT2 Footswitch
185
Syringe Pumps
Microprocessor-controlled syringe pumps for applications requiring high metering precision at low, pulse-free rates
Sturdy and reliable, extremely simple to set up and use and surprisingly affordable. Liquid crystal displays (LCDs) prompt you through setup: 1. Select syringe from table stored in the pumps memory and displayed on the LCD. 2. Enter the volume to be dispensed. 3. Enter the flow rate, press start. Its fast and simple. Your settings are permanently stored in memory theres no need to re-enter them each day. SP pumps feature preset rate and volume control. Just set the volume you want dispensed. Volume is tracked continuously on the LCD display. Then, when the preset volume has been dispensed, the pump shuts off automatically. The easy-to-read digital display provides realtime readings using both parameters and values for clearer, mistake-free readings. The SP200 Series pumps offer TTL and RS-232C interfaces and automatic shutoff under stall conditions.
Mode Syringe Size Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate
SP100i SPECIFICATIONS
infusion 10 l to 60 ml (one) 519 ml/hr (60 ml syringe) 0.1l/hr (10 l syringe) 20 ib (9 kg) 0.529 micron (1/2-step) 400 steps/sec (1/2-step) 1 step/30 sec < 1% error 0.1% 9 x 6 x 5.5 in. 23 x 15 x 14 cm 7.5 ib (3.4 kg)
Single-Syringe Infusion Pump SP100i

This inexpensive single-syringe infusion pump combines precision and simplicity with outstanding ease of use and durability. l Holds any size syringe, 10 L to 50 mL l Automatic volume control and shutoff l Simple menu-driven setup: dispense volume, dispense flow rate, syringe diameter (selected from displayed table) l Last settings stored in permanent memory l Continuous dispense volume display
Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight
Available 95-135 V or 220-240 V, 50/60 Hz
Two-Syringe Microdialysis Pump SP101i

SPECIFICATIONS SP101i
Mode Syringe Size Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight infusion (microdialysis) 10 l to 10 ml (two) 0.351 ml/min. (10 ml syringe) 0.001l/min (10 l syringe) 40 ib (18 kg) 0.088 micron (1/2-step) 400 steps/sec (1/2-step) 1 step/30 sec < 1% error 0.1% 9 x 6 x 5.5 in. 23 x 15 x 14 cm 7.5 ib (3.4 kg) Developed especially for use in microdialysis experiments, these pumps produce very fine syringe movement. The modified SP100i gearing features a sixfold gear reduction compared to standard models, allowing pumping at much smaller flow rates. (See sensors such as ISO-NO and Micro-C for detection of dialysates.) The SP101i is a dual barrel infusion only pump. l Holds two syringes, 10 L to 10 mL
SP100i SP100iZ SP101i SP101iZ ####-A
syringe pump, infusion (single), 95-135 v syringe pump, infusion (single), 220-240 v syringe pump, microdialysis (double, slow speed), 95-135 v syringe pump, microdialysis (double, slow speed), 220-240 v All 240-volt pumps are CE-approved. audible alarm (add a to end of pump part number when ordering)
186
Two-Syringe Infusion Pump This feature-laden two-syringe infusion pump SP200i

SP200i Mode Syringe Size Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight infusion 10 l to 140 ml (two) 145 ml/min (140 ml syringe) 0.001l/hr 40 ib (18 kg) 0.165 micron 1600 steps/sec 1 step/100 sec < 1% error 0.1% 11 x 9 x 5.5 in. 28 x 23 x 14 cm 12 ib (5.4 kg) l Holds two syringes, 10 to 140 mL l Backlit LCD display l Knob locks/unlocks drive block for effortless, drag-free adjustment l Simple menu-driven setup: Syringe diameter (selected from displayed table), Dispense volume, Dispense flow rate l Continuous dispense volume display
combines a broad speed range and holds a wide range of syringe sizes to meet the requirements of virtually any laboratory application.
l Preset volume control and automatic shutoff l Settings can be reviewed or changed during operation l Optical encoder stall detection l Choice of unit selection l Last settings stored in permanent memory l Built-in RS-232C interface for computer linking or daisy chaining up to 100 pumps. l TTL interface for foot switch, timer, relay control; outputs for run indicator, valve control. Mode Syringe Size
SP220i infusion 10 l to 10 ml (ten) 10 l to 60 ml (six) 10 l to 140 ml (four)* 21 ml/min (10 ml syringe) 0.001l/hr (10 l syringe ) 40 lb (18 kg) 0.165 micron 1600 steps/sec (1/2-step) 1 step/100 sec < 1% error 0.1% 11 x 12 x 5.5 in. 28 x 30 x 14 cm 12.5 ib (5.7 kg)
Maximum Flow Rate
Multi-Syringe Infusion Pump SP220i

Ideal for applications requiring multiple syringes, the SP220i is an adaptation of the SP200i and has been modified to hold up to 10 syringes. l SP220i has all features of SP200i l The multiple syringe holder accommodates 10 syringes up to 10 mL, or six syringes up to 50 mL, or four syringes up to 140 mL.
Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight
Four-Syringe Nanoliter Infusion Pump SP250i Each syringe can be sized differently and is
clamped independently
SP250i Mode Syringe Size infusion 10 l-10 ml (four) (syringes may be different sizes) 20.91 ml/min (10 ml syringe) 0.001l/hr 40 ib (18 kg) 0.165 micron 1600 steps/sec 1 step/100 sec < 1% error 0.1% 11 x 9 x 6 in. 28 x 23 x 15 cm 12 ib (5.4 kg)
l Holds four syringes, up to 10 mL each. l Separate clamping accommodates different sizes. l Syringes may be positioned independently for sequential dispensing by the pusher block.
Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight
SP200i SP200iZ SP220i SP220iZ SP250i SP250iZ ####-A ####-P OPTIONAL 15623 15624 13685 13962
Syringe Pump, Infusion (double), 95-135 V Syringe Pump, Infusion (double), 220-240 V Syringe Pump, Infusion (multiple), 95-135 V Syringe Pump, Infusion (multiple), 220-240 V Syringe Pump, Infusion (multiple, mixed volumes), 95-135 V Syringe Pump, Infusion (multiple, mixed volumes), 220-240 V All 240-volt pumps are CE-approved. Audible Alarm (add A to end of pump part number when ordering) programmable ramp option (sp200 series) (add p to pump part number when ordering) CABLES Serial cable and adapter, SP Pump-to-IBM 9-pin D connector Serial cable and adapter, SP Pump-to-Macintosh connector SP Pump-to-Pump Daisy-Chain linking cable, 7 ft Footswitch for SP200 Series Pumps 187
Two-Syringe Infusion/Withdrawal Pump SP210iw

The SP210iw offers you more advanced features than any other infusion/withdrawal pump in its price rangeincluding five operating modes plus independent rate and volume settings for both infusion and withdrawal. l All features of SP200i l Independent rate and volume settings for infusion and withdrawal l Multiple mode selection: infusion, withdrawal, infusion then withdrawal, withdrawal then infusion, or continuous cycle.
SP210iw SPECIFICATIONS
Mode Syringe Size Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight infusion/withdrawal 10 l to 140 ml (two)* 145 ml/min (140 ml syringe) 0.001l/hr 40 ib (18 kg) 0.165 micron 1600 steps/sec 1 step/100 sec < 1% error 0.1% 11 x 9 x 5.5 in. 28 x 23 x 14 cm 12 ib (5.4 kg)
Multi-Syringe Infusion/Withdrawal Pump SP230iw

Ideal for applications requiring multiple syringes, the SP230iw is an adaptationas of the SP210iw, and has been modified to hold up to 10 syringes. l SP230iw has all features of SP210iw l The multiple syringe holder accommodates 10 syringes up to 10 mL, or six syringes up to 50 mL, or four syringes up to 140 mL.
SP230iw SPECIFICATIONS
SP230iw Mode Syringe Size infusion/withdrawal 10 l to 10 ml (ten) 10 l to 60 ml (six) 10 l to 140 ml (four)* 21 ml/min (10 ml syringe) 0.001l/hr (10 l syringe ) 40 lb (18 kg) 0.165 micron 1600 steps/sec (1/2-step) 1 step/100 sec < 1% error 0.1% 11 x 12 x 5.5 in. 28 x 30 x 14 cm 12.5 ib (5.7 kg)
Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight
SP210iw SP210iwZ SP230iw SP230iwZ ####-A ####-P
syringe pump, infusion & withdrawal (double), 95-135 v syringe pump, infusion & withdrawal (double), 220-240 v syringe pump, infusion & withdrawal (multiple), 95-135 v syringe pump, infusion & withdrawal (multiple), 220-240 v All 240-volt pumps are CE-approved. audible alarm (add a to pump part number when ordering) programmable ramp option (sp200 series)
OPTIONAL 15623 15624 15676 13685 13962
CABLES Serial cable, SP Pump-to-IBM 9-pin D connector Serial cable, SP Pump-to-Macintosh connector Serial cable, SP Pump-to-IBM 25-pin D connector SP Pump-to-Pump Daisy-Chain linking cable, 7 ft Footswitch for SP200 Series Pumps
Syringes with Luer Fitting (no needle)

WPI Part # ILS005LT ILS010LT ILS025TLL ILS050TLL ILS100TLL ILS250TLL ILS500TLL 300035 Volume 5 L 10 L 25 L 50 L 100 L 250 L 500 L Description ILS 5 L gas-tight Luer tip ILS 10 L gas-tight Luer-tip ILS 25 L gas-tight Luer tip* ILS 50 L gas-tight Teflon Luer Lock* ILS 100 L gas-tight Teflon Luer Lock* ILS 250 L gas-tight Teflon Luer Lock* ILS 500 L gas-tight Teflon Luer Lock* 6/32 stability button for SP200 Series pumps O.D. 6.5 mm 6.5 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm
Has 6/32 button thread. The 6/32 stability button allows the SP series pumps to drive the syringe plunger in a precise direction to minimize variations in the syringe body/plunger offset. NOT COMPATIbLe wITH uLTrAMICrOPuMP. ILS is a trademark of Innovative Labor Systeme.
188
Two-Syringe Push-Pull Pump SP120p

A second syringe mount has been added to the basic SP100i, with both syringes activated by a single pusher block for simultaneous infusion and withdrawal. This pump has all the features of the SP100i, plus: l Holds two syringes, from 10 L to 10 mL.
SP120p SPECIFICATIONS
Mode Syringe Size Maximum Flow Rate Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility infusion/withdrawal 10 l to 10 ml (two) 125 ml/hr (10 ml syringe) 0.1 l/hr (10 l syringe ) 20 lb (9 kg) 0.529 m 400 steps/sec (1/2-step) 1 step/30 sec < 1% error 0.1% 9 x 6 x 5.5 in. 23 x 15 x 14 cm 8 ib (3.6 kg)
Four-Syringe Push-Pull Pump SP260p single cycle

The SP260p can hold up to four syringes. As two syringes are infusing, two other syringes are withdrawing at the same rate. The SP260p is used for single-cycle applications only. l Knob locks/unlocks drive block for effortless, drag-free adjustment l Simple menu-driven setup: Syringe diameter (selected from displayed table), Dispense volume, Dispense flow rate l Continuous dispense volume display l Preset volume control and automatic shutoff l Settings can be reviewed or changed during operation l Optical encoder stall detection l Choice of unit selection l Last settings stored in permanent memory l Built-in RS-232C interface for computer linking or daisy chaining up to 100 pumps. l TTL interface for foot switch, timer, relay control; outputs for run indicator, valve control
Dimensions Shipping Weight
Continuous Cycle Syringe Pump SP210c

The SP210c can hold up to four syringes and can cycle continuously back and forth in a push-pull action.
SP260p & SP210c SPECIFICATIONS

Mode sp260p sp210c Syringe Size sp260p sp210c Maximum Flow Rate sp260p sp210c Minimum Flow Rate Linear Force Advance Per Microstep Maximum Step Rate Minimum Step Rate Accuracy Reproducibility Dimensions Shipping Weight 86 ml/min (60 ml syringe) 86 ml/min (60 ml syringe) 0.001l/hr 40 ib (18 kg) 0.165 m 1600 steps/sec 1 step/100 sec < 1% error 0.1% 11 x 9 x 5.5 in. 28 x 23 x 14 cm 12 ib (5.4 kg) 10 l-60 ml (four) 10 l-60 ml (four) push-pull (single cycle) infusion/withdrawal (continuous)
As two syringes are infusing, two other syringes are withdrawing at the same rate. At the end of the set volume the direction is automatically reversed and the next cycle begins. With the use of 2-way valves, the pump can empty and refill syringes for a continuous dispense. l Holds four syringes, 10 mL to 60 mL each. With larger syringes the full volume may not be usable. [With a 60mL syringe, 40 mL is usable; with a 30 mL syringe, the full volume is usable.]
SP120p SP120pZ SP260p SP260pZ SP210c SP210cZ ####-A ####-P OPTIONAL 15623 15624 13685 13962
Syringe Pump, Infusion-Withdrawal (double), 95-135 V Syringe Pump, Infusion-Withdrawal (double), 220-240 V Syringe Pump, Infusion-Withdrawal (double) Single Cycle Action, 95-135 V Syringe Pump, Infusion-Withdrawal (double) Single Cycle Action, 220-240 V Syringe Pump, Infusion & Withdrawl (Continuous Action), 95-135 V Syringe Pump, Infusion & Withdrawl (Continuous Action), 220-240 V All 240-volt pumps are CE-approved. Audible Alarm (add A to pump part number when ordering) programmable ramp option (sp200 series) (add p to end of pump part number when ordering) CABLES Serial cable and adapter, SP Pump-to-IBM 9-pin D connector Serial cable and adapter, SP Pump-to-Macintosh connector SP Pump-to-Pump Daisy-Chain linking cable, 7 ft Footswitch for SP200 Series Pumps 189
SPLG Syringe Pumps

Superior reliability and flow performance
Features
l l l l l l l l
Easytoconfigure Easytouse Verticalmounting Quickreleasepusherblock Wideclampforlargersyringes Multi-sizesyringes Anti-siphonbracket RS232computerconnection,USB serialinput,RS485fornetworking pumps l Widevarietyofapplications l Worldwideregulatorycompliance SPLG SPECIFICATIONS
ACCURACY REPRODUCIBILITY SYRINgES (min./max.) FLOW RATE MINIMUM (0.5L syringe) FLOW RATE MAXIMUM (140mL syringe) DISPLAY NON-VOLATILE MEMORY CONNECTORS: RS-232 RS-485 USB I/O and TTL LINEAR FORCE (maximum) DRIVE MOTOR MOTOR DRIVE CONTROL MICROSTEPS PER REV. OF LEAD SCREW STEP RATE MINIMUM STEP RATE MAXIMUM PUSHER TRAVEL RATE MINIMUM PUSHER TRAVEL RATE MAXIMUM POWER DIMENSIONS WEIgHT ATMOSPHERIC SPECIFICATIONS Operating Temperature Storage Temperature Humidity MODE OF OPERATION CLASSIFICATION POLLUTION DEgREE INSTALLATION CATEgORY REgULATORY CERTIFICATIONS 0.35% 0.05% 0.5L/140mL 5pL/min. 220.97mL/min. 4.3" WQVgA TFT color display with touch pad Stores all settings 9-pin D-sub connector IEEE-1394, 6 pos type B 15-pin D-sub connector 34kg (75 lb.) @ 100% force selection 1.8 stepper motor Microprocessor with 1/16 microstepping 6,400 27.5 sec./step 26sec./step 0.36m/min. 190.80mm/min. 100-240VAC; 50/60Hz; 50W; 0.5A fuse 8.89 x 25.4 x 27.94cm (3.5 x 10 x 11") 4.9kg (10.75 lb.) 440C (40104F) -1070C (14158F) 2080%RH, non-condensing Continuous Class I 1 II CE, UL, CSA, CB Scheme, EU RoHS
This new SPLg series of pumps show all the pertinent, real-time information on a single touch screen display. Information displayed includes flow rate, grading syringe volume, total remaining time and total volume delivered. Recognizable, international icons make it easy to use. To conserve table space, mount the SPLg pump vertically. The display automatically reorients itself for easy vertical operation. The welded, unibody, steel chassis of the SPLg pumps makes them quieter to operate. It also offers less vibration, no deformation and excellent EMI/ RFI shielding. The one-touch operation makes the SPLg pump easy to configure, and its 15-character labeling system makes saved programs quick to identify. You can easily transfer recipes between pumps for consistent configuration without reprogramming. Pumps can be connected for gradients, increased flow capacity and simultaneous multi-tests. This family of pumps includes five versions: Infuse Only (SPLG200); Infuse/Withdraw (SPLG210); Infuse/Withdraw Programmable (SPLG212); Push-Pull (SPLG270); Push-Pull Programmable (SPLG272).
When mounted vertically, the display screen of the SPLG series pumps automatically reorients for ease of use.
SPLG200 SPLG210 SPLG212 SPLG270 SPLG272
SPL Syringe Pump, Infuse Only SPL Syringe Pump, Infuse/Withdraw SPL Syringe Pump, Infuse/Withdraw Programmable SPL Syringe Pump, Push-Pull SPL Syringe Pump, Push-Pull Programmable
190
Crystal Pipetters
These new pipetters are highly accurate. Within ten complete revolutions of the dial, you can set the minimum and maximum volumes. And, for ease of use, the dial is fixed to the plunger. Since the light plunger action reduces fatigue, results are more precise.
l Easy to set volumes l Ergonomic grip l Removable tip ejector for tight spots
Single Channel Pipetters

Part Number
CRYSTAL-2 CRYSTAL-10* CRYSTAL-20 CRYSTAL-200 CRYSTAL-1000 CRYSTAL-ML10
Volume
0.2-2L 2-20L Long tip ejector 2-20L Short tip ejector 20-200L 200-1000L 1-10mL
Accuracy
0.2L 12.0% 2L 5.0% 2L 2.5% 20L 1.0% 2L 5.0% 20L 1.0% 20L 1.8% 200L 0.8% 200L 1.5% 1000L 0.8% 1mL 3.0% 10mL 0.5%
Precision
6.0% 1.0%
Introductory Price
US$
132 132 132 132 132 202
US$
1.5% 0.3% 0.4% 0.15% 0.3% 0.15% 0.6% 0.16%
US$
US$
US$
US$
*For use with Crystal tips (0.1-10L).
ClickPet Repeating Pipetters

Part Number CP-5 CP-25 CP-100 CP-250 Volume (L) 1-5 5-25 25-100 50-250 # of Dispenses 1L - 50 5L - 10 5L - 45 25L - 9 25L - 40 100L - 10 50L - 20 250L - 4 Fill Volume Introductory (L) Price ~50 ~200 ~1000 ~1150
US$
493 493 493 493
US$
US$
US$
ver 193 Uni e page e

S
ps l Ti sa
8 or 12-Channel Multi-pettes
Part Number
CRYSTAL-10M8 CRYSTAL-10M12 CRYSTAL-200M8 CRYSTAL-200M12
Volume
0.5-10L 10-200L
Accuracy
0.5L 2.5% 10L 1.0% 10L 1.0% 200L 1.0%
Introductory Price
US$ US$ US$ US$
529 646 463 595

191
Eagle Adjustable Pipetters

n. Comfortable ergonomic desig Lasts 20 times Longer.
l SuperiorWPIsealsgivereliableandaccurate experimentalresults l Calibrationintervalcanbesignificantly increased l Pricedsoaffordablythateveryoneinthelab canhaveaset l Customizeyoursetbyselectingonlythe pipettersyouneed
Buy any set of 5 or 6 and get one free!

sets es5, es6, and es7 include your selection of pipetters, along with a stand (#14239) for convenient storage. simply specify the pipetters you want by including the letter designation from the chart on the right. for example, es5aabcd would include two e2s and one each e10, e20 and e100.
Model A B C D E F G E2 E10 E20 E100 E200 E1000 E5000
Volume Range 0.2 - 2.0 L 0.5 - 10 L 2 - 20 L 20 - 100 L 50 - 200 L 100 - 1000 L 1000 - 5000 L
Price
US$
114 114 114 114 114 114 114
ES5 ES6 ES7 500801
pipetters (set of any 5) and stand pipetters (set of any 6) and stand pipetters (set of any 7) and stand filters for e5000 (5-pack) 6 pipetter rack stand pette-clamp, 3/pkg original pipetter stand
569 661 US$ 748 US$ 17

US$ US$
US$
US$
STORAGE 500876 500877 14239
40 40 US$ 91
US$ US$
US$
US$
US$
Replacement parts
Replacement parts for the Eagle Pipetters are available from our website at www.wpiinc.com or call us for details.
US$
192
ds ran ! Ultra-clear and certified RNase/DNase-free gb price din e lea lf th Universal Tips a as me out h Tip Volume For Pipetter Bulk Part No. Price Rack Sa b ta CRYSTAL-2 a
0.1 - 10 L E2 E10 E20 CRYSTAL-10 CRYSTAL-20 CRYSTAL-10M8 CRYSTAL-10M12 Bag of 1000 500191
US$
Universal Pipette Tips

Part No. Price
17
960 500192 (10 racks of 96)
US$
35
5 - 200 L 100-1000 L 500 - 5000 L
E20 E100 E200 E1000 E5000
CRYSTAL-200 CRYSTAL-200M8 Bag of 1000 CRYSTAL-200M12 CRYSTAL-1000 Bag of 1000 Bag of 250
500193 500195 500197 *
US$
17 20
960 500194 (10 racks of 96) 1000 500196 (10 racks of 100) 500 500198 * (10 racks of 50)
US$
35 40 63
US$
US$
500197 500198 500191, 500192
US$
17
US$
500193, 500194
500195, 500196
Universal Filter Tips (sterile)

Tip Volume
0.1 - 10 L E2 E10 E20 E20 E100 E200 E1000
For Pipetter
CRYSTAL-2 CRYSTAL-10 CRYSTAL-20 CRYSTAL-200
Bulk
Part No. Price
Rack
Part No.
Price
US$
960 (10 racks of 96) 500199
69
10 - 200 L 100-1000 L
960 (10 racks of 96) 500200 1000 (10 racks of 100) 500201
US$
75 75
US$
500199
500200
Universal Gel Loader Tips (flexible)

Tip Volume 0.1 - 10 L (Flat) 0.17 mm OD 0.1 - 10 L (Flat) 0.37 mm OD 0.1 - 10 L (Round) 0.57 mm OD 0.5 - 200 L (Round) 0.57 mm OD 0.5 - 200 L (Flat) 0.37 mm OD E2 E10 E20 E2 E10 E20 E2 E10 E20 E20 E100 E200 E20 E100 E200 For Pipetter CRYSTAL-2 CRYSTAL-10 CRYSTAL-20 CRYSTAL-2 CRYSTAL-10 CRYSTAL-20 CRYSTAL-2 CRYSTAL-10 CRYSTAL-20 CRYSTAL-200 CRYSTAL-200M8 Bag of 1000 500205 CRYSTAL-200M12
US$
Bulk
Part No.
Price
Rack 200
Part No. 500202
Price
US$
500201
46
200
500203
US$
46
200
500204
US$
23
35
200
500206
US$
23
200
500207
US$
46
500202 500203
500205 500206 500207
500204
wPIs universal Pipette Tips are for use with eagle and most other pipetters, including Gilson, Oxford benchmate, Socorex, and SealPette. * Tips 500197 and 500198 fit eagle, eppendorf, and bioHit pipetters. Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc.com Internet: www.wpiinc.com
193
UltraMicroPump III
Three prong syringe holder for more stability
Micro syringes are easily installed just snap the barrel into the clamps. UMP3 accepts a range of syringes from 0.5L to 1 mL.
Manipulator not included.
Now with microstepping

Controller now has higher resolution and is virtually pulse-free
This versatile injector uses microsyringes to deliver picoliter volumes

Perfect for a wide range of applications including intracellular injection, micro delivery of biochemical agents or dyes, cell separation, and in vitro fertilization.
ULTRAMICROPUMP SPECIFICATIONS
(based on 10 L syringe) NORMAL MODE TOTAL # OF STEPS MINIMUM DISPENSINg VOLUME LINEAR MOTION PER STEP WEIgHT MOUNTINg ROD DIAMETERS MAINS POWER SUPPLY 20,000 (63 mm travel) 0.58 nL / step 3.175 microns 325 g (11.5 oz) 7.9 mm (0.31 in.) 90-264VAC @ 47-63Hz 32 mm x 190 mm ( 1.3 in. x 7.5 in.)
See Reproducible and Efficient Murine CNS Gene Delivery Using a Microprocessor Controlled Injector, A.I. Brooks et al., Journal of Neuroscience Methods, 80 (1998) 137-147.
DIMENSIONS MICROSTEPPING MODE Precision is increased eight fold
194
The worlds leading ultramicropump!

With its digital controller, UltraMicroPump III can dispense as little as 600 picoliters per incremental advance of the syringe piston (using a 5-L syringe). Syringes may be filled externally and then inserted into the pump or filled while mounted in the pump. Fluids injected or withdrawn are held entirely within the micro syringe to maintain a low fluid dead volume. For positioning, the UltraMicroPump III may be attached to any of several WPI micropositioners such as the M3301 (manual), DC3001 (motorized), or any manual stereotaxic manipulator.
Smart Controller
An Integral component in the UMPIII system is a microprocessorbased controller, SYS-Micro4, which provides an intelligent and easyto-use interface to up to four syringe pumps. Operating parameters are set with the membrane keypad and LCD display. From the keypad the user can select the following functions: set pump to infusion or withdrawal mode, enter the volume to be infused or withdrawn, rate of delivery, and syringe type as well as synchronize the starting and stopping of any combination of syringe pumps. User parameters can be stored in the devices non-volatile memory for instant recall when the unit is powered on. An optional footswitch can be plugged into a connector on the rear of the controller for hands free start-/-stop operation. Computer ControlAn RS-232 port on the rear of the controller can be used to connect it to a computer for use with computer control programs. UMPIII ACCEPTS: glass syringes with barrel diameters from 5.5 to 9 mm. UMP3-1 UMP3-2 UMP3-3 UMP3-4 UMP3 SYS-MICRO4 UltraMicroPump III (one) and Micro4 Controller UltraMicroPump III (two) and Micro4 Controller UltraMicroPump III (three) and Micro4 Controller UltraMicroPump III (four) and Micro4 Controller UltraMicroPump III (without controller) Micro4 Controller, Four-Channel
UMPIII shown mounted to stereotaxic frame (not included).
OPTIONS AND ACCESSORIES 15867 Footswitch for Micro4 40500 RS-232 Cable, 9-pin D connector 502201 V-clamp for Stereotaxic Frame 503301 Extension Cable, miniDIN (male-female) 8 ft
Microvolume Syringes
Syringes with Luer Fitting (no needle)
WPI P/N ILS005LT ILS010LT ILS025LT SGE050TLL SGE100TLL SGE250TLL Volume 5 L 10 L 25 L 50 L 100 L 250 L Description ILS 5 L gas-tight Luer tip ILS 10 L gas-tight Luer tip ILS 25 L gas-tight Luer tip SgE 50 L gas-tight Teflon Luer Lock SgE 100 L gas-tight Teflon Luer Lock SgE 250 L gas-tight Teflon Luer Lock O.D. 6.5 mm 6.5 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm UMP2 Y Y Y Y Y N UMP1 N N N Y Y N
Syringes with Replaceable Beveled Needles

WPI P/N Volume SGE0005RN* 0.5 L SGE001RN* 1.0 L SGE005RN 5 L SGE010RNS 10 L SGE025RN 25 L SGE050RN 50 L SGE100RN 100 L Description SgE 0.5 L 23 ga (0.63 mm) 70 mm long SgE 1.0 L 26 ga (0.47 mm) 70 mm long SgE 5 L 23 ga (0.63 mm) 50 mm long SgE 10 L 26 ga (0.47 mm) 50 mm long SgE 25 L 25 ga (0.50 mm) 50 mm long SgE 50 L 25 ga (0.50 mm) 50 mm long SgE 100 L 25 ga (0.50 mm) 50 mm long O.D. 8.0 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm 8.0 mm UMP2 Y Y Y Y Y Y Y UMP1 Y Y Y Y Y Y Y
* The plunger extends to the tip of the needle, displacing the full sample during injection - which gives the syringe zero dead volume. The barrel length of this syringe is 17 cm long vs. the usual 8-9 cm. SgE and ILS are respective trademarks of Scientific glass Engineering and Innovative Labor Systeme.
Replacement Needles
RN0005 RN001 RN005 RN010 RN025 For syringe SgE0005RN, 23 ga (0.63 mm) 70 mm long For syringe SgE001RN, 26 ga (0.47 mm) 70 mm long For syringe SgE005RN, 23 ga (0.63 mm) 50 mm long For syringe SgE010RN(S), 26 ga (0.47 mm) 50 mm long, 5-pack For syringes SgE025RN, SgE050RN, SgE0100RN, 26 ga (0.47 mm) 50 mm long, 5-pack
195
Pneumatic PicoPumps
Designed to simplify intracellular injection and a variety of other microinjection tasks, WPI's PicoPumps use carefully regulated air pressures for securing cells and injecting them with fluid. Injected volumes range from picoliters to nanoliters. Separate ports supply positive and negative pressurepositive pressure for high-pressure ejection, and suction for supporting the cell or for filling the pipette from the tip. A second pressure port maintains a low positive holding pressure to the injecting pipette between injection pulses, to prevent fluid uptake through capillary action or diffusion. Timing, ejection pressure, holding pressure, and suction
Repeatable microinjection in volumes ranging from picoliters to nanoliters

are adjusted independently by control knobs and indicator gauges on the front panel. Injection pressure is controlled by a 20-turn regulator on the front panel. A built-in timing circuit allows precise control of the amount of time that the injection pressure is applied to the output port. Time intervals can range from 10 seconds down to 10 ms or less, depending on the eject pressure setting. The injection pressure interval can be triggered manually on the front panel, by footswitch, or by computer controlled TTL pulse. A 5-volt monitor output provides a logic-level pulse for your computer or other monitoring device.
The most recognized picopump in the world!
For a complete list of pre-pulled micropipettes, see Tips, or call us with your special requirements.
PV830 Eject pressure, Hold pressure, and Vacuum are all available, controlled by separate regulators on the front panel. Eject pressure supplies a high-pressure pulse for injecting fluid. Hold pressure, which is not sufficient to cause fluid ejection, is used to prevent back filling of the pipette by capillary action or diffusion when the solenoid is inactive. Pressure in the injection pipette is automatically switched between Eject and Hold pressure by a precision timing circuit that controls a solenoid valve. Vacuum is used to fill pipettes from the tip or to secure a floating cell during microinjection. Vacuum is regulated the same way, by a 20-turn knob on the front panel. Vacuum may be switched from regulated vacuum to atmosphere by using the pneumatic toggle on the front panel. Vacuum can also be routed to the eject port.
Each PicoPump is supplied with two PicoNozzle Kits (5430-ALL) plus tubing to connect the holders to the pressure and vacuum ports. SYS-PV820 PicoPump w/ hold pressure SYS-PV830 PicoPump w/ hold pressure and vacuum Specify line voltage All PicoPumps require external vacuum source see below. OPTIONAL 3260 2932 2933 5430-10 5430-12 5430-15 5430-20 5430-ALL MPH6S MPH6R 3316 ACCESSORIES Foot Switch Rack Mount Kit, 31 2-in. high (PV820) Rack Mount Kit, 514-in. high (PV830) PicoNozzle Kit (MPH6S for 1.0 mm pipette & 5-ft tubing assembly) PicoNozzle Kit (MPH6S for 1.2 mm pipette & 5-ft tubing assembly) PicoNozzle Kit (MPH6S for 1.5 mm pipette & 5-ft tubing assembly) PicoNozzle Kit (MPH6S for 2.0 mm pipette & 5-ft tubing assembly) picoNozzle kit (for 1.0, 1.2, 1.5, and 1.65 mm pipettes & 5-ft tubing assembly) Micropipette Holder (specify 1.0, 1.2, 1.5 or 2.0 mm) Micropipette Holder (specify 1.0, 1.2, 1.5 or 2.0 mm) Replacement Input Kit
New PicoNozzle Kit 5430-ALL (included) allows micropipettes to be securely mounted in micropositioners for stable axial air delivery. Because air enters the pipette axially, lateral whipping during injection is eliminated.
See NanoFil page 200

196
PV820 offers separate regulated Hold and Ejection pressure, used to maintain a low pressure in the pipette between injections to prevent unwanted fluid uptake by capillary action or diffusion. A precision timing circuit switches from Eject pressure to Hold pressure automatically, once timing has been set.
PV820 PRESSURE
PRESSURE INPUT PRESSURE OUTPUT LOWEST REgULATED PRESSURE REgULATOR ACCURACY REgULATOR REPEATABILITY gAUgE ACCURACY INPUT CONNECTOR OUTPUT CONNECTOR CONTROL 0 to 150 psi 0.3 to 90 psi * 12 in. water * 0.1% (20-turn dial) * 0.05 psi * 3% at full scale * Quick Connect (14 in. OD Tubing) Barbed (116 in. ID Tubing) Solenoid * both Hold and eject Pressures 0 to 30.0 in. Hg Unregulated Unregulated Unregulated Unregulated None Quick Connect (14 in. OD Tubing) Barbed (116 in. ID Tubing) Manual Atmosphere
Although regulated vacuum is not provided in this model, suction can be provided by connecting a vacuum source to the vacuum port on the rear panel. Suction is then available through the pressure ports.
PICOPUMP SPECIFICATIONS
PV830
0 to 150 psi 0.3 to 90 psi 12 in. water 0.1% (20-turn dial) * 0.05 psi * 3% at full scale * Quick Connect (14 in. OD Tubing) Barbed (1/16 in. ID Tubing) Solenoid * both Hold and eject Pressures 0 to 30.0 in. Hg 0.2 to 29.9 in. Hg 3 in. water 0.1% (20-turn dial) 0.03 in. Hg 3% at full scale Quick Connect (14 in. OD Tubing) Barbed (116 in. ID Tubing) Manual Atmosphere
VACUUM
VACUUM INPUT VACUUM OUTPUT LOWEST REgULATED VACUUM REgULATOR ACCURACY REgULATOR REPEATABILITY gAUgE ACCURACY INPUT CONNECTOR OUTPUT CONNECTOR CONTROL VENT
CONNECTIONS INCLUDED
INPUT KIT OUTPUT KIT 10 ft nylon tubing (0.25 OD, 1000 psi), one 12 female NPT adapter Two PicoNozzle assemblies, each consisting of one MPH6S pipette holder, 60-in. of PVC tubing (200 psi), and a luer-fitted aluminum handle. 95-135 V or 220-240 V, 50/60 Hz 17 x 3.5 x 9.5 in. (43 x 9 x 24 cm) 11 lb (5 kg) 95-135 V or 220-240 V, 50/60 Hz 17 x 5.25 x 9.5 in. (43 x 13 x 24 cm) 14 lb (6.3 kg)
PHYSICAL SPECIFICATIONS
POWER DIMENSIONS SHIPPINg WEIgHT
Application Example:
Using PV830 for holding and injection of cells
Pressure Manometers see page 199

.
Luer-to-Tubing Coupler Assortment Kits see page 138
197
Nanoliter Injector
NANOLITER 2000
For oocyte injection and applications in the 2 to 70 nanoliter range

WPIs microprocessor-controlled Nanoliter2000 uses direct piston displacement. By either pushing the injection button on the control box or pressing on the optional footswitch, a calibrated volume will be smoothly injected. The process is quiet and vibration free. Capillary filling and injection speeds are 23 nL/sec and 46 nL/sec (emptying speeds are 92 nL/sec and 230 nL/ sec). Maximum fluid ejection is 5 L. Each unit comes with sufficient glass to pull at least 300 tips. glass is 1.14 mm O.D. (nominal) and 0.5-mm I.D. By setting the DIP switch, the injection volume can be changed from 2.3 to 69.0 nL in 16 steps. Up to 100 injections may be triggered per filling. Since the volume of a normal Xenopus oocyte is about 500 nL, the instrument has the capability to inject from less than 1% to over 10% of the total volume of the oocyte in one preset step increment. Included: 1 vial 3.5 in. capillaries (100); 1 vial 7 in. capillaries (100); replacement O rings; Allen wrench; MicroFilTM MF34g backfilling needle; and two sample Tip pre-pulled micropipettes.
Micromanipulator not included. Shaft diam. 8.2 mm
Adapter #500778 (included free) extends the reach of a manipulator-mounted injector.
Smart Controller: Micro4, an optional microprocessor-based controller, can provide an intelligent and easy-to-use interface to up to four Nanoliter Injectors. Operating parameters are set with the membrane keypad and LCD display. From the keypad the user can set pump to infusion or withdrawal mode, enter the volume to be infused or withdrawn, and rate of delivery, as well as synchronize the starting and stopping of a combination of Injectors. User parameters can be stored in the devices non-volatile memory for instant recall when the unit is powered on. An optional footswitch can be plugged into a connector on the rear of the controller for hands free start/stop operation. An RS-232 port on the rear of the controller can be used to connect it to a computer for use with computer control programs. Optional smart controller
for Nanoliter 2000 (order as B203MC4)

WPI recommends the following equipment for a complete sys tem,: PZMIII stereo microscope MMJ joystick micromanipulator M10 magnetic base Tip micropipettes.
NANOLITER 2000 SPECIFICATIONS

INJECTION VOLUME REMOTE CONTROL gLASS OD gLASS ID STEP INJECTION SPEED Slow Fast FILL SPEED Slow Fast EMPTY SPEED VARIABLE VOLUME RANgE SMALLEST VOLUME TO CHANgE VOLUME INJECTIONS PER FILLINg, MAX. SHIPPINg WEIgHT Variable Yes 1.14 mm 0.5 mm 12.7 /step 23 nL/sec 46 nL/sec 23 nL/sec 46 nL/sec 92 nL/sec 2.3 - 69.0 nL 2.3 nL Set switch 100 injections 3 lb. (1.1 kg)
B203XVY Nanoliter 2000 (120 V, U.S. plug) B203XVZ Nanoliter 2000 (240 V, Continental plug) B203XVB Nanoliter 2000 (240 V, British plug) B203MC4 Nanoliter Injector & Micro4 Controller (small controller not included) OPTIONAL ACCESSORIES 13142 Footswitch for Nanoliter 2000 15867 Footswitch for Micro4 Controller 4878 Replacement 3.5-in. glass capillaries (300) 4879 Replacement 7-in. glass capillaries (300) TIP10XV119 Micropipettes for Nanoliter Injector (10) SYS-MICRO4 Micro4 Controller, Four-Channel 300033 Adapter for Micro4 5340 Spare Parts Kit (includes MicroFilTM MF34G, displacement piston, five O-ring sets) 500778 Replacement Nanoliter Injector Universal Adapter 502859 Flared O-Ring Kit 500299 Pistons, 5-pack 503066 Flared glass, 100 pieces
198
Manual Microsyringe Pump

The MMP and DMP are convenient tools for precise manual injection of fluid using glass pipettes or similar injection devices. The design allows visual feedback of flow at the pipette tip. They can also be used as a manual micro syringe pump for perfusion or withdrawal of liquids. The resolution of the injection volume can be continuously varied from 10 nanoliters to the microliter range, depending on the syringe used. Either oil or air can be used as the transfer media to assist the injection of fluid. The DMP comes with an exclusive digital micrometer that will allow the reading of piston advancement easily with a 0.001-millimeter resolution. The optional software and cable kit can transmit advancement data directly into computer. Model MMP has the traditional mechanical micrometer head with a resolution of 10 microns per division and advances 500 micrometers per revolution. The entire frame body of the injector is constructed with polished stainless steel for
solid stainless steel frame

excellent stability and durability. The piston of the micrometer can be slid across the rail to the syringe's plunger position. Small diameter PTFE tubing is used to improve the accuracy and solution compatibility. The unique design of the pipette holder can securely hold any pipette with an outer diameter of between 1.0 mm and 1.5 mm. All necessary accessories for removing air and filling the syringe and tubing with liquid are included. The system comes complete with a 100 L gas tight syringe and other syringe sizes can be purchased.
DMP & MMP SPECIfICaTIONS

Travel Distance Advances Resolution Syringe Size Tubing Pipette Holder Pipette Holder Fits 25 mm 0.001 mm for DMP and 0.01 mm for MMP 10 L to 1 mL gas tight luer tip syringe 1.5 m of PTFE tubing with 0.5 mm ID 0.24" x 5.2" 1.0 to 1.5 mm OD pipette
MMP Manual Microsyringe Pump DMP Manual Microsyringe Pump with Digital Display aCCESSORIES MMP-KIT Injection Assembly Parts Kit Not including valvesee #14057-10, page 161)
Pressure Manometer
For measuring hydrostatic pressures
SYS-PM01D Pressure Manometer (1 psi) Hand-held and battery SYS-PM01R Pressure Manometer (1 psi), Rechargeable* operated, PM Series pressure SYS-PM015D Pressure Manometer (15 psi) manometers monitor vacuum SYS-PM015R Pressure Manometer (15 psi), Rechargeable* and pressure in nonaqueous SYS-PM100D Pressure Manometer (100 psi) fluids. An integral transducer SYS-PM100R Pressure Manometer (100 psi), Rechargeable* and digital display allow CBL102 Mini-Phone-to-BNC Cable easy and accurate pressure Specify line voltage readings. Three versions *Rechargeable versions come with nickel/cadmium battery and charger measure pressures in the range of 1 psi, 15 PRESSURE MaNOMETER SPECIfICaTIONS psi or 100 PM01 PM015 PM100 psi. A range PRESSURE RANGES 1 psi (52 mm Hg) 15 psi (775 mm Hg) 100 psi (690 kPa) switch allows MAX. PRESSURE 20 psi (1035 mm Hg) 30 psi (1550 mm Hg) 150 psi (1035 kPa) measurement RESOLUTION 0.001 psi (0.1 mm Hg) 0.01 psi (1 mm Hg) 0.1 psi (1 kPa) in units of psi or OUTPUT 1 V/psi 100 mV/psi 10 mV/psi kPa for the 100 OUTPUT RANGE 1.0 V 1.5 V 1.0 V psi version, and psi or mm LINEARITY 0.5% full-scale Hg for the 15 psi version. Pressure can TEMPERATURE EFFECT 1.0% full-scale (0-70C) be read on the built-in LCD display or relayed to a ZERO Screwdriver-adjust chart recorder, oscilloscope, or computer. RESPONSE TIME 30 ms POWER Nine-volt battery PM Series pressure manometers come with 4 feet BATTERY LIFE Alkaline, 200 hours; rechargeable, 25 hours of 18-inch ID soft vinyl tubing. A mini-phone-to-BNC RECORDER OUTPUT Mini-phone jack, 0.141 inch (3.5 mm) cable for the recorder output is also available (Part OUTPUT IMPEDANCE 1 k #CBL102). Standard versions are equipped with a PNEUMATIC CONNECTORS Barbed, for 1/8-inch or 3/16-inch ID soft tubing nine-volt alkaline battery.
DIMENSIONS SHIPPING WEIGHT 3 x 6 x 1 inches (8 x 15 x 4 cm) 3 lb (1.4 kg)
199
NanoFil
Sub-microliter injection system for small animal research
l The world's smallest dead volume injection syringe l Comes with various needle sizes from 26 ga. to 36 ga. l Versatile research applications RPE and IO Kits l Custom needle shapes available blunt, sharp, beveled l Compatible with WPI's UMP3 and PV800 series microinjection systems
NanoFil is a specially designed 10 microliter syringe developed in response to customer requests for improved microinjection in mice and other small animals. It makes quantitative nanoliter injection much easier and more accurate than any other method currently in use. NanoFil's low dead volume eliminates the need for oil backfilling, a messy process which risks contamination of the injected sample.Injection is now simpler, and less messy, and there is no possibility of oil contamination in critical applications such as ophthalmology research (see the Retinal Pigment Epithelial (RPE) and Intra Ocular (IO) injection kits listed below). When the inner tip diameter of a conventional syringe is reduced to less than 100 micron, it is very difficult to backfill the solution at a reasonable speed. NanoFil solves this problem by using a tip coupling mechanism that makes it possible to change the syringe tip during the experiment. Simply load the sample using a larger tip, such as the 26 gauge needle provided
with the syringe, and then replace it with a micro tip for sample injection. On a conventional 10 microliter syringe, a solid ring or bushing is permanently bonded to the tubing. Replacing the tip in middle of the experiment is not practical. With the NanoFil, tips can be exchanged by a simple twist of the brass lock, gently pulling out the tip, and replacing with the desired new tip. To secure the tip, NanoFil uses an olive shaped silicon gasket that is similar to, but much sturdier than, some of the microelectrode holders used for electro physiology recording. The silicone gasket makes it possible to hold not only metal tips but also glass and quartz tubing. Many types of tubing can be easily connected to the
syringe as long as the outer diameter (OD) is close to, but not more than, the inner diameter (ID) of the inside barrel. Flexible quartz capillaries used in gas Chromotography (gC) and Capillary Electrophoresis (CE) can also be easily coupled to the syringe. Specially designed tips as small as 36 gauge (110 micron OD) are offered in both blunt and beveled styles. Our studies have shown that these tips will cause less trauma to the tissue than any other form of micro syringe currently in use. NanoFil has a unique coupling mechanism that allows many different forms of small tubing and tips to be coupled with the syringe barrel.
NANOFIL NanoFil Syringe, 10 microliter NANOFIL-100 NanoFil Syringe, 100 microliter NanoFil syringe does not contain any injection tips, those must be purchased separately. It does include a 26 gauge beveled needle for backfilling. REPLACEMENT BACKFILL NEEDLES NF26BV-2 26g Beveled Needle (package of 2)
Using NanoFil in different configurations

Direct injection by hand: This is the simplest and most economical way to inject. Any of our tips can be inserted directly into the NanoFil syringe. Even the SilFlex tubing can be inserted to switch from hand injection to the other methods listed below. The limitation of this method is the difficulty achieving sub microliter resolution. Installed on WPIs UMP-III microsyringe pump: This will allow the user to achieve nanoliter resolution and reproducibility. For neural system injection, mount the UMPII on a stereotaxic frame. SilFlex tubing and holder: The needle is mounted on a small plastic holder that is connected to the NanoFil by a 35 cm length of flexible tubing. The NanoFil is mounted on the UMP II pump. This configuration allows the user to hold the animal in one hand and insert the needle with the other. When the needle reaches the desired location, activate the pump using the footswitch and the pre-programmed injection volume will be delivered. This configuration gives a nanoliter level of accuracy and reproducibility. It is best suited for applications such as the RPE and IO injection.
Selecting the correct tip for your application

The replaceable needles used with the NanoFil are available with either blunt or beveled tips. The blunt tip is used for injection into soft tissue and when a uniform solution distribution is needed. The beveled style is used for applications that involve the penetration of a tough tissue. One of the main factors that limit the resolution and accuracy of conventional micro syringes to the upper tens of nanoliters range is diffusion in the large tip ID. When the tip ID is equal or larger than 100 micron, the error caused by tip diffusion is in the nanoliter range level ((100 micron)^3 = 1 nanoliter). With a 36 gauge needle installed on the NanoFil, the error caused by diffusion will be reduced to the sub nanoliter level, making accurate injection of a nanoliter possible. All of WPIs beveled tips have a unique 25 degree tri-surface bevel that is optimized for microinjection. A 10 degree single-surface beveled tip penetrates better than one with a 25 degree angle, however the distance between the upper opening to the tip (see section F in Fig. 2) is longer. As a result, it requires a deeper penetration of the tip to achieve the same level of liquid delivery. Deeper penetration means more tissue damage. WPIs unique 25 degree beveled tip solves this problem with two extra beveled surfaces. The tip of a single surface beveled tip is actually a blade instead of a point. It dulls very quickly. In contrast, the tri-surfaced tip has a real point. It not only penetrates much better but is also much more durable. Our tests show that our 33 gauge, 25 degree beveled tip
200
D
C
A
DETAIL A
penetrates easier and lasts longer than other manufacturers 33 gauge, 10 degree single beveled tips. With a 35 gauge tri-surface beveled tip, the resistance to the penetration becomes even less. Each of our tips undergo a penetration test before leaving the factory to guarantee the best results for our customers.
Tip Tip Order Tip O.D. Tip I.D. Length Number A B C

NF33BV-2 NF34BV-2 NF35BV-2 NF36BV-2 NF33FBV-2 NFQ34-5 NF33BL-2 NF34BL-2 NF35BL-2 NF36BL-2 NF33FBl-2 210 m 185 m 135 m 110 m 200 m 160 m 210 m 185 m 135 m 110 m 200 m 115 m 85 m 55 m 35 m 100 m 100 m 115 m 85 m 55 m 35 m 100 m 10.0 mm 5.0 mm 5.0 mm 3.0 mm 5.0 mm 55.0 mm 10.0 mm 5.0 mm 5.0 mm 3.0 mm 5.0 mm
Total Length D
40.0 mm 35.0 mm 35.0 mm 33.0 mm 35.0 mm 75.0 mm 34.0 mm 29.0 mm 29.0 mm 27.0 mm 29.0 mm
Shank O.D. E
460 m 460 m 460 m 460 m 460 m 460 m 460 m 460 m 460 m 460 m 460 m
Bevel Total Length Dead F Volume

348 m 290 m 204 m 156 m 322 m 280 m 348 m 290 m 204 m 156 m 322 m 1.47 nL 1.39 nL 1.38 nL 1.37 nL 1.40 nL 0.59 nL 1.47 nL 1.39 nL 1.38 nL 1.37 nL 1.40 nL
Tip Material
Stainless Steel Stainless Steel Stainless Steel Stainless Steel Titanium Alloy
Available Tips
33 gauge: This tip is similar to Hamiltons 7762 and 7803 series removable needles in both tip length and outer diameter. However, our beveled tip version is shorter, more durable, and penetrates better due to the special trisurface grinding technique. In the past, 33 gauge tips were the smallest size sold by other manufacturers and were frequently cited in literature. However, our new 35 gauge tip is much better for injections involving small animals, especially mice. Compared with Hamilton 33 gauge, 10 degree beveled tip, our 35 gauge 25 degree beveled tip can reduce the depth of penetration by almost 80%. The distance between the tip and the upper rim of the opening (section F on Figure 2) is 1024 microns for the 33 gauge tip. The distance for our 35 gauge tip is only 230 microns. In addition, the smaller tip size significantly reduces the required penetration force. In nearly all applications, a 33 gauge tip can be replaced with our 35 gauge tip and produce better results. 34 gauge: This is a transitional size between the 33 gauge and 35 gauge. If the 35 gauge is too weak and the 33 gauge is too large, this makes a good alternative. 35 gauge: This was the most popular and preferred tip of most scientists during our field trial. The combination of its strength, length, durability, and clogging resistance creates a balance with very little compromising of the individual properties. It is much smaller than the 33 gauge tip offered by other manufacturers. It is only slightly larger than the 36 gauge tip but is much stronger and less likely to be clogged. Samples can be directly loaded with this tip. Its 5 mm length is sufficient enough for almost all injection applications in mice. 36 gauge: This is the smallest tip that is commercially available. The tip is so small that it can be inserted into the opening of the 33 gauge needle tip. Because this is pushing the limits of what current technology can produce, there are some limitations to consider before
Quartz Stainless Steel Stainless Steel Stainless Steel Stainless Steel Titanium Alloy
Above dimensions apply to blunt tips also.
using. Its thin diameter makes it necessary to limit its length to 2.5 to 3.0 mm and still maintain a usable strength. Since the tip ID is in the 25 to 50 micron range, it is very easily clogged. Therefore, only well filtered solutions can be used. Depending on the viscosity of the sample, the user might also need to pre-load the syringe with a regular tip before switching to this tip for injection. We recommend using the 35 gauge tip instead of the 36 gauge unless it is absolutely necessary. Flexifil: The Flexifil tip is made of a titanium alloy. The advantage of this tubing is its durability. This semi-flexible tip can be bent up to 90 degrees without damage. It is also much more corrosion resistant than the stainless steel
tip. Saline solutions left in the tip will be less likely to clog it. Although this tip is specified as a 33 gauge tip, its outer diameter is slightly smaller than our 33 gauge stainless steel tip. Flexible Quartz Tubing : The flexible quartz tubing tip is made of 160 micron OD polyimide coated quartz tubing with a special adapter sleeve mounted at the end. It is designed for filling glass capillary electrodes or pipettes, just like WPIs traditional MF34g Microfil. However, unlike the traditional MicroFil, which has about 50 microliters of dead volume in its luer hub, the dead volume of this tip is less than 0.6 microliters. It is useful for loading electrodes with solutions that have a limited volume or are too expensive to waste.
NANOFIL NEEDLES NF33BL-2 33 g blunt NanoFil needle (pkg of 2) NF34BL-2 34 g blunt NanoFil needle (pkg of 2) NF35BL-2 35 g blunt NanoFil needle (pkg of 2) NF36BL-2 36 g blunt NanoFil needle (pkg of 2) NF33BV-2 33 g beveled NanoFil needle (pkg of 2) NF34BV-2 34 g beveled NanoFil needle (pkg of 2) NF35BV-2 35 g beveled NanoFil needle (pkg of 2) NF36BV-2 36 g beveled NanoFil needle (pkg of 2) NF33FBL-2 33 g Flexifil blunt NanoFil needle (pkg of 2) NF33FBV-2 33 g Flexifil beveled NanoFil needle (pkg of 2) NF33-36BL Assortment of 4 blunt NanoFil needles NF33-36BV Assortment of 4 beveled NanoFil needles REPLACEMENT PARTS & ACCESSORIES NFINHLD NanoFil Injection Holder SILFLEX-2 SilFlex tubing 35 cm long (pkg of 2) (dead volume = 2.74 L) NFGSK-5 Spare Silicone gasket for NanoFil & Holder (pkg of 5) NFQ34-5 34 gauge Flexible Quartz Tubing for filling (pkg 5) 201
NanoFil Application Kits

These kits are specially designed for eye research for injecting retinal pigment epithelium (RPE) and intraocular (IO) in addition to brain injection in mice. They need to be used with a NanoFil syringe and UMP2 to achieve accurate, repetitive, and oil free injection in the submicroliter range. Each kit includes two pieces of Silflex tubing (one for a spare), a holder assembly, spare gaskets, and an assortment of four tips - blunt for the RPE kit and beveled tips for the IO kit. Each kit comes with one each of 33, 34, 35 and 36 gauge tips so that first time users can find the best size for their application. The Silflex tubing is the most critical component of the kit. This 35 cm long, flexible tubing has a very precise outer diameter for airtight fitting with the syringe. It also has a small inner diameter for minimum dead volume, and is very durable when handled correctly. The SilFlex is coupled to the injection tip with a mechanism similar to that of the NanoFil. The dead volume of the entire kit (including the tubing) is less than 3microliters. All of the components in the kit are constructed of inert, solvent resistant, and autoclaveable materials for easy cleaning after viral injection.
The uMP3 stand in the photo (right) includes the small base (503084), open-side clamp (14073-4) and 25cm rod (503070).
RPE-KIT
RECOMMENDED ACCESSORIES RPE-KIT Retinal Pigment Epithelium (RPE) injection kit (SilFlex tubing, gasket, holder, and blunt tipmix) IO-KIT Intraocular (IO) injection kit (SilFlex tubing, holder, gasket, and beveled tipmix) 503207 Stand & Clamps
VSP1 Syringe Pump

Stability and safety
The VSP1 Syringe Pump offers exceptional accuracy and stability coupled with safety features that are crucial in the animal health care environment. This pump alerts the user when the syringe is near empty, occlusion occurs, syringe falls off, battery is undercharged, etc. The built-in rechargeable battery ensures the pump continues uninterrupted even in the event of an AC line voltage failure of up to four hours. The pump can run under the flow rate (i.e., mL/h) and dose rate (i.e., mg/kg/min), and this function can be used in routine infusion, anesthesia, and special drug protocols. This pump can be easily mounted on a vertical or horizontal IV pole or bedrail.
VSP1 SPECIFICATIONS
flow rate purge rate accuracY sYriNge siZe occlusioN pressure alarm limits batterY life operatioN temperatures electrical safetY ac power supplY dimeNsioNs weight 0.1 1500 ml/h 400 1500 ml/h Nominal 1% excluding syringe variations 10 ml, 20 ml, 30 ml and 50 ml 800 mmhg, 500 mmhg, 300 mmhg 4 hours 5 to 40 c class 1, type cf 100~240v at 50/60hz 31cm X 14cm X13cm 2.5 kg
503613
VSP1 Syringe Pump
202
MPS-2 Multichannel Perfusion System

for single ion channel and whole-cell solution exchange
l Manual or Programmable PC control with user-friendly GUI interface l Fast LAFF solenoid valve l Color-coded polyurethane tubing for easy identification l Super low dead volume (<80 nL) micromanifold l Economically priced
inputs from 1/16 ID tubing
internal passage ID: 250 m
mounting rod connector
output: 100 or 200 m ID quartz/polymide tubing
14 mm OD internal junction OD: 600 m
Micromanifold closeup: Fluid-filled passages are shown in magenta.

MPS-2 is a programmable 8-channel perfusion system designed for single channel and whole-cell patch preparations. Offering the best combination of performance and value, the MPS-2 incorporates the same high quality solenoid valves found on similar but much more expensive systems. Unlike other perfusion systems on the market, which often compromise performance to fit every possible application, the MPS-2 is the only perfusion system designed and optimized specifically for single-channel and whole-cell patch perfusion applications. The system can be controlled manually via membrane switches on the front panel or through a PC. Two different manual control modes are offered. One controls each channel independently and the other mode allows the user to assign a master channel that will keep the system flow when all other channels are switched off. User-friendly graphic timing software is included, and the programmed perfusion sequence can be started by computer, a patch clamp amplifier or other external trigger, or manually by the user The perfusion fluid flows through specially designed color-coded polyurethane ribbon style tubing. The color-coding allows the user to easily trace each channel for diagnostic checks or set up and the ribbon style of tubing keeps the system very neat and organized. Unlike PVC based tubing, polyurethane tubing contains no plasticizer, which can cause contamination. The tubing ribbon is designed as an economical disposable item, which is often critical when cleanness is needed.
The most unique feature of the MPS-2 is its perfusion micromanifold. Using the latest microfluidic techniques, the injection molded micromanifold provides the least flow resistance and dead volume of any product on the market. The flow channel inner diameter is approximately 1.0 mm, except for the last 5 mm before the junction point. This design allows a fast flow MPS-2 Multichannel Perfusion System & Control Software rate without using a pressured system. REPLACEMENT PARTS The maximum flow rates are 1 and 16 502109-15 Color-coded Polyurethane Tubing, 1/16 ID x 8 Channels, 15 ft microliter per second for the 15 mm long 502110 Micromanifold, 100 m ID tip, 2 pcs/pk 100 m and 200 m ID tips, respectively. 502125 Micromanifold, 200 m ID tip, 2 pcs/pk Small channels and a unique design at the Specify line voltage and Micromanifold tip OD when ordering. merging point further reduce the chance of cross contamination. Dead volume is less than 80 nL. MPS-2 SPECIFICATIONS
Channels Valve Response Time Valve Control Syringe Reservoir Volume Manifold Tip ID Maximum Flow Rates (gravity fed) Dead Volume 8 2 ms Serial Port, TTL, and Manual 10 mL 8 to 1 200 micron and 100 micron. 100 m ID tip, 60 L/min. (equivalent linear speed: 12.7 cm/sec) 200 m ID tip, 960 L/min. (equivalent linear speed: 51 cm/sec) < 80 nL excluding the single outlet tubing
203
Features
lHighlyaccurate lShortresponsetime(40ms) lStabilityoverlongperiodsoftime lHighpressureresistance lTotalmediaisolation lNegligibledeadvolume lSuperiorresolution(1.8nL/min.) lRapidresponsetime lLargedynamicrange The Microfluidics Control system is shown on the left, and the Flowell is pictured on the right. ThissystemincludesboththeMicrofluidics Controlbox(WPI#FL-MF4CorFL-MF8C)and theFlowellsystem(WPI#FL-FLOWELL).The Flowellsystemincludesthreeflowmeters, fourreservoirsthatcanbepressurized,anda computerconnection. Threemassflowmeterswithpressurized reservoirsoftheFlowellsystemmonitor theflowofliquidthroughthechannels.A precisesensorwithamplificationcapabilities iscombinedwiththeA/Dconverterand signalprocessoronasingleCMOSchip. Reservoirscanbeintegrateddirectlyonthe chiporexternallylocated.Usinganadapted pneumaticsetup,aWheatstonebridge createsapressuredividerbridgetoallow dynamiccontrolofthepressure. Withavarietyofsensors,thissystemcovers thecompleterangeupto7L/min.with thelowestdetectableflowat1.8nL/min. Youcanoptimizethesystemforprecise measurementsorforhandlingrapidly changingflows.
Applications
lLiquidchromatography lLab-on-chipandTASsystems lDrugdelivery lLifesciences lQualitytesting lRheologystudy
lMinimalpowerconsumption lExcellentchemicalresistance lBio-compatible lInsensitivetobubbleformationin reservoirs l4or8independentchannels lUser-friendlyUSBcomputerinterface
Sensor
TheFlowellmeasurestrueliquidmassflow. SimplyconnecttheMicrofluidicsControlto thereservoirstopressurizethem.Flowell directlymonitorsthespecifiedflowrangeby measuringheattransferthroughthetubing materialofastandardfusedsilicacapillary. Amicrochipismountedtotheoutsideof thecapillaryandheatedslightlyabovethe ambienttemperature.Asliquidflowsthrough thecapillary,thetemperatureofthecapillary variesbothupanddownstreamoftheliquid flow.Twotemperaturesensorsmonitorthe asymmetryofthetemperaturefluctuations. Usingthesemeasurements,thesystem accuratelydeterminestheflowvolume throughthesystemwhileensuringtotal mediaisolationandpressureresistancewith highrepeatability.
Forcontroloffluidsinthenanoliterand microliterranges,theFL-MFCSisthesystem ofchoice.Iteliminatesthehysteresis,long equilibriumtimesandpulsingproblemsthat plaguestandardperistalticandsyringepumps inthelowvolumeranges.
SPECIFICATIONS
ACCURACY/BIAS..............................................................................................................5.2% RESOLUTION AT MINIMUM FLOW ................................................................. 1.8nL/min. MINIMUM PRESSURE STEP .....................................................................................25bar PRECISION/CV% at 4000nL/min. ..............................................................................0.1% FLOW RATE RANgE (BIDIRECTIONAL)............................from 1.8nL/min. to 7L/min RESPONSE TIME.......................................................................................................... 150ms WETTED MATERIAL ...............................................................glass, PEEK, Polypropylene CHEMICAL RESISTANCE ............................................................1M acid and base, EtOH WEIgHT.................................................................................................................................2kg
MAESFLO software interface controls both the Microfluidics Control and Flowell systems. Pressure control is shown along the top, and flow rate is monitored in the bottom half of the window.
FL-MF2C-25 FL-MF4C-345 FL-MF8C-1000
microfluidics control system, 25 mbar, vaccuum microfluidics control system, 345 mbar microfluidics control system, 1000 mbar
OPTIONAL ACCESSORIES FL-FLUIWELL Fluiwell, 4 wells FL-FLUIWELL-1C Fluiwell, 1 well FL-FLOWELL Flowell
204
Optical Detection Systems

NEW! LEDspec bio photometric detection system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 206 . UltraPath exceptionally high dynamic range UV/VIS spectrometer system . . . . . . . . .208
Optical Detectors
TIDAS I spectrometer for low-noise UV/VIS absorbance applications . . . . . . . . . . . . . . . 210
Light Sources
D2H Deuterium Halogen Light Source (UV/VIS/NIR) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 212 FO-6000 High Power, Low Drift (VIS) Tungsten Light Source . . . . . . . . . . . . . . . . . . . . . . . 213 LED-Lite plus ELS modules for single wavelength applications . . . . . . . . . . . . . . . . . . . 213
Flow Cells
LWCC Liquid Waveguide Capillary Cell . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 214 V-Vette Microliter Sample Holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 215 MicroLWCC Low Volume Flow Cell . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 215
Dipping Probes
DipTip UV/VIS/NIR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217
Optical Glass and Quartz Cuvettes for Spectrophotometry

Cuvettes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 218
SPECTROSCOPY
Accessories
Cuvette Holders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220 In-Line Filter Holder Assembly SMA or ST connections . . . . . . . . . . . . . . . . . . . . . . . . . 220 . QFT1 Filter Holder for Glass Fiber Filters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221 UV Fiber Optic Adapter for UV1000 and UV2000 Thermo Electron HPLC Detectors . . . 222 Fiber Optic Collimator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 222 Misc . Cable Fittings and Connectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 222
Optical Fibers
Bifurcated Fiber Optic Assemblies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 223 Fiber Optic Cables, UV-enhanced . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 223
Fiber Optic Sensors

OxyMicro and OxyMini Oxygen Sensors with Luminescence Lifetime Detection . . . . . . 74 NEW! FLOX Fluorescence-based Oxygen Sensor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75 pHOptica pH Sensor System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77
ORDER TOLL-FREE: 866-606-1974 (U.S. only) World Precision Instruments Tel: 941-371-1003 Fax: 941-377-5428 E-mail: sales@wpiinc .com Internet: www.wpiinc.com
205
Cuvette and cuvette holder available separately.
Bio Photometric Detection System

LEDspec (visible) or LEDspecUV (ultraviolet) Two unique photometers
l High Precision performance exceeds that of CCD and photodiode array based spectrometers l Affordable spectroscopy l Simplified display with just the data you want to see l Includes your choice of 3 wavelengths l Install up to 7 wavelengths, LEDspec is easy to modify l Order 2- or 4-channel l Light source: LEDs no costly lamps to replace
2
spectrophotometer
Absorbance @ 260nm [AU]
1.5
R 2 = 0.9981
2 L sample volume
1 0.5 0 0 100 200 300 400 500 600
LEDspec
R 2 = 0.9927
SPECTROSCOPY
700
800
DNA [g/mL]
DNA Calibration Curve using WPI's V-Vette combined with a LEDspecUV and pharmaceutical compliant spectrophotometer.
LEDspec
l Measures visible wavelengths l Sample cells: LWCC, Fiber Optic Cuvette Holders, V-Vette l Wavelength range (nm): 400, 450, 540, 560, 600, 650, 700, custom l Applications include: Environmental/Oceanography Nitrite/Nitrate at 540nm Phosphate at 700nm Iron at 560nm Pharmaceutical Process Control Semiconductors Water purity, trace metal analysis (Fe, Pd, Cu, U)
LEDspecUV
l Measures ultraviolet and visible wavelengths l Sample cells: LWCC, V-Vette, Fiber Optic Cuvette Holder l Wavelength range (nm): 260, 280, 340, 400, 450, 540, 560, 600, 650, 700, custom l BSA, Lowry and Bradford assay capable l Applications include all LEDspec applications, plus: Biochemistry DNA 0 .5-1000ng/mL at 260nm (with WPI's v-Vette) Protein: 0 .1-30mg/mL at 280nm (with WPI's v-Vette) Pharmaceutical Drug discovery Dissolution Testing
206
Data You Want to See

Many biochemistry applications require information at specific, important wavelengths, instead of a full spectrum analysis . For example, the Bradford, BCA and Lowry assays for protein analysis rely on specific wavelengths . LEDspec is ideally suited for oceanographic applications such as detecting nM concentrations of nitrite/nitrate, phosphate and iron using WPIs LWCC sample cells . Two or four independent channel FIA detection systems can be assembled using a LEDspec-2 or LEDspec-4, respectively . LEDspec and LEDspecUV are stand-alone LED-based biophotometric detection systems designed to give you the information you want to see . Now you can conduct flow analysis and single-scan applications with high precision and a large dynamic range . LEDspec can be equipped with up to 7 LEDs of different wavelengths . Its noise (< 0 .1 mAU peak to peak) and drift performance (<0 .5 mAU/h) exceeds that of a CCD or photodiode array detection system at a fraction of the cost . LEDspec uses dualbeams to reduce light source drift . Conventional single beam spectrometers notice baseline drift caused by warm up, temperature stability and bulb aging . A reference channel in the LEDspec corrects for baseline while you make sample measurements .
LEDSPEC SPECIFICATIOnS
OPTICAL BASICS CHANNELS DETECTOR SPECTRAL BANDWIDTH (FWHM) DYNAMIC RANGE DETECTOR RESOLUTION NOISE (PEAK TO PEAK) WARMUP TIME FIBER OPTIC INPUT DRIFT DIGITAL INPUTS AND OUTPUTS ANALOG OUTPUT DIMENSIONS (W*H*D) WEIGHT INTERFACE MAINS LED-based multiple wavelength detector with build-in reference channel 2 or 4 Photodiode 10 nm (LEDs >400nm) 4 nm (260, 280, 340nm LEDs) 0-3 AU 24 Bit < 0 .1 mAU Instant 600 m < 0 .5 mAU/h 8/8 +/- 10 V, scaleable output 290 x 80 x 250 mm (11 .4 x 3 .2 x 9 .9) 2 kg (2 .2 lbs) USB 100 240 V / 50 - 60 Hz
Data Collection and Analysis

Now, you can analyze output data with LEDspec's easy-to-use software and export chromatographs directly to your PC (via USB) in Microsoft Excel format . Software provides: l Full computer control of LEDspec
SPECTROSCOPY
l Continuous flow or single-shot analysis of up to four independent channels simultaneously or sequentially . l Immediate calibration and analysis (mean and standard deviation) of up to four channels
LEDSPEC-2 LEDSPEC-4 LEDSPEC-2UV LEDSPEC-4UV 89273 89272 89274 89245 89246 89247 89248 89275 89276 89249 LWCC-2200-LED LWCC-2050-LED LWCC-2100-LED PERIPRO-4L MInISTAR
InTRODUCTORY PRICE $ LEDspec biophotometric detection system (VIS), 2 channel, 3 LED modules (choose when ordering) 3,495 $ LEDspec biophotometric detection system (VIS), 4 channel, 3 LED modules (choose when ordering) 4,995 LEDspec biophotometric detection system (UV+VIS), 2 channel, 3 LED modules (choose when ordering) call LEDspec biophotometric detection system (UV+VIS), 4 channel, 3 LED modules (choose when ordering) call LED module, 260 NM call LED module, 280 NM call LED module, 340 NM call $ LED module, 400 nm 195 $ LED module, 450 nm 195 $ LED module, 540 nm 195 $ LED module, 560 nm 195 $ LED module, 600 nm 195 $ LED module, 650 nm 195 $ LED module, 700 nm 195 $ LEDSPEC UPGRADE: LWCC-2200,2 fibers, sample injector kit (58006), waveguide cleaning kit (501609) 1,995 $ LEDSPEC UPGRADE: LWCC-2050,2 fibers, sample injector kit (58006), waveguide cleaning kit (501609) 1,995 $ LEDSPEC UPGRADE: LWCC-2200,2 fibers, sample injector kit (58006), waveguide cleaning kit (501609) 1,750 $ Peri-Star Pro, 4-channel, low rate, small tubing (see page 2) 1,450 $ Miniature Peristaltic Pump, 1-channel (see page 4) 445
207
UltraPath
A unique multiple long pathlength sample cell for absorbance spectroscopy
l Process Control & Oceanography l Rugged system for laboratory and onboard measuring l Portable & easy to use l User-selected optical path lengths: 2, 10, 50 & 200 cm l Highly sensitive and stable
SPECTROSCOPY
UltraPath is a unique high-performance spectrophotometer system offering user-selectable optical path lengths of 2, 10, 50 and 200 cm . The instrument operates in the wavelength range of 250 to 730 (UPUV) or 380 to 730 nm (UPVIS) and has an exceptional dynamic range . Designed for the detection of low absorbing species in aqueous solutions, UltraPath is an ideal tool for any study requiring precise and highly sensitive spectroscopic determination of analytes, either in the lab or in the field .
Background
UltraPath was developed by WPI under a collaborative agreement with NASA (Stennis Space Center) for the spectroscopic determination of colored dissolved organic matter (CDOM) in seawater and fresh water environments . It can be used in the laboratory and in the field (i.e., at sea) . CDOM concentrations vary significantly between open ocean samples with low CDOM (e.g., 0 .007 m-1 at 380 nm), and high CDOM freshwater environments (e.g., 10-20 m-1 at 380 nm) . To address these problems the design requirements of UltraPath mandated the development of a rugged portable system capable of high sensitivity measurements across a wide dynamic range . The UltraPath system meets these stringent design criteria and enables reliable measurement of CDOM in the range of 0 .002 m-1 to 200 m-1 (250 to 730 nm) .
substances to the cell wall . In particular, the design greatly minimizes the problems commonly found with flow cells of long optical pathlengths: the risk of trapping dust particles, fibers or particulate matter inside the cell . The UltraPath system includes a low noise photodiode array-based spectrometer module (TIDAS I: FWHM = 5 nm, noise <0 .2 mAU) and a light source (D2H with UPUV; FO6000 with UPVIS) to measure sample absorption . Light is coupled from the light source to the sample cell and from the sample cell to the detector via two fused silica fibers . A peristaltic pump (PeriStar Pro) is utilized to draw the sample into the UltraPath sample cell .
35 30
Sarasota Bay & Pond CDOM

Sarasota Bay Pond
Absorption [1/m]
25 20 15 10 5 0 -5 250 350 450 550
Design
UltraPath has four optical pathlengths contained within a single sample cell (i.e., 2 cm, 10 cm, 50 cm and 200 cm) . The pathlengths are userselectable, offering a very high sensitivity and an extended dynamic range for UV and VIS absorbance measurements . The fluid path of the sample cell is optimized to produce a laminar flow that is virtually free of interference from trapped air bubbles and adherence of dissolved
650
750
Wavelength [nm]
Fig. 1 Two typical absorption spectra measured using UltraPath. The sample labeled Sarasota Bay is a CDOM sample with 34 PSU salinity collected from Sarasota Bay (Nov. 2007), and the sample labeled Pond is a highly concentrated CDOM sample collected from a local pond in Sarasota, Florida (Nov. 2007).
208
Mayagez Bay CDOM

0.09 Absorption [1/m] 0.07 0.05 0.03 0.01 -0.01 380 480 580 Wavelength [nm] 680 Mayagez Bay
Determining CDOM Absorption Spectra in Diverse Coastal Environments Using a Multiple Pathlength, Liquid Core Waveguide System, Continental Shelf Research, July 2002, 22:9, p 1301-1310 . System Analyzes Water Samples at Sea, NASA Aerospace Technology Innovation, 2001, 9 (5) . http://nctn .hq .nasa .gov/innovation/innovation95/3techtrans2 .html R . L . Miller and E . DSa . Evaluating the influence of CDOM on the remote sensing signal in the Mississippi River Bight . In Eos Transactions AGU Ocean Sciences, 2002 . Honolulu, HI, p . 171 . E . DSa, R .L . Miller and R . Trzaska . Aparent Optical Properties in Waters Influenced by the Mississippi River, Proceedings of the Seventh Thematic Conference, Remote Sensing for Marine and Coastal Environments, 2002, 6 pg, Miami, FL . R . L . Miller, C . Hall, C . Del Castillo, B . McKee and M . Dagg . Bio-optical Properties of the Mississippi River Plume and Adjacent Shelf . ASLO Aquatic Sciences, Albuquerque, NM, 2001 . R . L . Miller, M . Belz and S . Y . Liu, Measuring the absorption of CDOM in the field using a multiple pathlength liquid waveguide system, Ocean Optics XV, paper 1308, Monaco, October 2000 .
Fig. 2 CDOM Sample Mayagez Bay was collected from the high salinity oligotrophic waters of Mayagez Bay on the west coast of Puerto Rico (2001). Data courtesy of NASA Stennis Space Center.
A standard PC or laptop (not included) is connected to the TIDAS I via a RS232 interface (an RS232-to-USB2 .0 adapter is included) . For spectrometer requirements and software options, see TIDAS-1 .
Absorbance
0.025 0.02 0.015 0.01 0.005 0 -0.005
Ponceau S measured with 200 cm pathlength

baseline 0.7 nM 1.8 nM 3 nM
125 100 75 50 25 0 -25 AU/cm
Mobility
The system is designed for mobility . The components of the UltraPath system are designed to function over a broad range of laboratory and field environments .
Samples
Two typical absorption spectra recorded with an UltraPath (UPUV) of a seawater and a fresh water sample collected in November 2007 are shown in Fig . 1 . Due to their high absorbance, both samples were analyzed in the 10 cm pathlength . The CDOM sample labeled Mayagez Bay in Fig . 2 is from oligotrophic, low productive waters with high salinity collected off the west coast of Puerto Rico in the Mayagez Bay . Special attention should be drawn to the exceptional sensitivity of UltraPath enabling detection of CDOM absorption below 0 .03 m-1 . To exemplify the performance of the UltraPath in Laboratory Chemistry and Process Control, Ponceau S absorbance was measured with the 200 cm pathlength of an UltraPath . Normalizing the Ponceau absorbance graph to AU/cm, the range of this measurement is 150 AU with a noise level below 2 AU peak to peak . Sub-nanomolar concentration of this dye can clearly and reliably be detected, which is a novelty in absorbance based spectroscopy .
400
450
500
550
600
650
700
Wavelength [nm]
Fig. 3 Ponceau S absorption measured with UltraPath (200 cm cell). Ponceau S was dissolved in Millipore water.
SPECTROSCOPY
ULTRAPATH SPECIFICATIOnS
DYNAMIC RANGE WAVELENGTH RANGE 5 AU/cm to 1 AU/cm 0 .002 m-1 to 200 m-1 250 nm 730 nm (UPUV) 380 nm 730 nm (UPVIS) < 0 .2 mAU < 1 mAU/h 2, 10, 50 & 200 cm (user selectable) 2 mm 10 mL (at 200 cm pathlength) 1/8 600 m Most organic and inorganic solvents UPUV: 44 lb (20 kg) UPVIS: 33 lb (20 kg)
WAVELENGTH RESOLUTION (FWHM) 5 nm NOISE (PEAK TO PEAK) DRIFT OPTICAL PATHLENGTH SAMPLE CELL INNER DIAMETER CELL VOLUME SAMPLE INLET / OUTLET FIBER INPUT/OUTPUT SOLVENT RESISTANCE SHIPPING WEIGHT
Particulate Absorption
Particulate absorption can be measured by the well established Quantitative Filter Technique (QFT) . WPI now offers a fiber optic filter holder for Glass Fiber Filters (QFT1, page 31) which can be used with the spectrometer (TIDAS 1) and light source (D2H or FO6000) supplied with the UltraPath . With this accessory, particulate absorption can be measured on site, avoiding loss of spectral information due to freezing and shipping particulate samples to a laboratory .
Reference
N . B . Nelson, D . A . Siegel, C . A . Carlson, C . Swan, W . M . Smethie Jr . and S . Khatiwala . 2007 . Hydrography of chromophoric dissolved organic matter in the North Atlantic . Deep-Sea Res . I . 54: 710 731 . V . Kitidis, A . P . Stubbins, G . Uher, R . C . Upstill Goddard, C . S . Law, E . M . S . Woodward, Variability of chromophoric organic matter in surface waters of the Atlantic Ocean, Deep Sea Research Part II: Topical Studies, Vol . 53, Issue 14-16, 2006, p . 1666-1684 . R . L . Miller, M . Belz, C . Del Castillo, R . Trzaska,
$ UPVIS Ultrapath System, Visible Light 18,635 $ UPUV Ultrapath System, Ultraviolet & Visible Light 24,595 The UltraPath system includes: Multiple pathlength cell, Tidas I with TidasDAQ/SpectraView software, FO-6000 light source (UPVIS) or D2H light source (UPUV), two FO-600-SMA1M optical fibers, PeriStar Pro peristaltic pump, silicone tubing, sample injector and Waveguide Cleaning Kit. Specify line voltage
501609 KIT-UPVIS-STARTUP KIT-UPUV-STARTUP 89575
Waveguide Cleaning Kit FO-600-SMA1M, 501609, 72100, 800120, 15807 FO-600-SMA1M, 501609, 72100, D2H-DB, D2H-HB, 15807 QFT1, Fiber Optic Holder for Glass Fiber Filters
$ 59 349 $ 1275 $ 650 $
209
Optical Detectors
l Photodiode array spectrometer module l Low noise detection (<0.1 mAU peak to peak) l Wavelength range 195 nm to 725 nm l Fiber optic design
Tidas I
High performance fiber optic spectrometer system
SPECTROSCOPY
WPIs Tidas I is a high end fiber-optic spectrometer module designed for low noise applications . The Tidas I outperforms conventional benchbased spectrophotometers and CCD-based spectrometer modules, when it comes to high precision fiber optic sampling . It relies on a monolithic optical bench made by Zeiss, which is optimized for fiber
optic applications . Most cuvette-based standard spectrometers lose more than 90% of light through expensive prism decoupling . The TIDAS I is designed for fiber optic sampling cells . Using suitable light sources and sample cells, spectral detection in the wavelength range of 195 to 730 nm can be performed at noise levels < 0 .1 mAU peak to peak .
TIDAS I SPECIFICATIOnS
OPTICAL BASICS Monolithic Spectrometer Module; Concave Aberration Corrected Holographic Grating; Fiber optic cross section converter for increased light throughput; 2nd order multilayer filter Hamamatsu photodiode array, 256 pixel 195 - 725 nm 5 nm 16 Bit < 0.1 mAU @ 550 nm with FO-6000 0.2 nm 0.07 nm 600 m 8/8 Windows XP, Vista TIDASDAQ (data collection) & SpectraView (data analysis) 235 mm x 148 mm x 315 mm (9.25 x 5.8 x 12.4) 3.5 kg (7.7 lb) RS232 (USB adapter included) 100 - 240 V / 50 - 60 Hz
Applications
The Tidas I is ideally suited for WPIs fiber optic sampling equipment . High sensitivity detection systems for flow analysis can be assembled using WPIs Liquid Waveguide Capillary Cells (LWCC) with effective pathlengths ranging from 2 to 500 cm . These setups are frequently used in fluid injection analysis systems for nutrient analysis (nitrite, nitrate, phosphate, iron) in oceanographic applications . Microliter sampling systems for UV/ VIS applications can be assembled, using WPIs SpectroPipetter (SPT-2), or DipTip dipping probe . Such systems are ideally suited for direct DNA or protein detection of microliter samples at 260 nm and 280 nm wavelength in biochemistry applications .
DETECTOR ARRAY WAVELENGTH RANGE: SPECTRAL BANDWIDTH (FWHM) DETECTOR RESOLUTION NOISE (PEAK TO PEAK)* WAVELENGTH ACCURACY WAVELENGTH REPRODUCIBILITY FIBER OPTIC INPUT DIGITAL INPUTS AND OUTPUTS SYSTEM REQUIREMENTS SOFTWARE (INCLUDED) DIMENSIONS (WxHxD) WEIGHT INTERFACE POWER
Software
There are separate software packages for data collection and data analysis for the TIDAS I . An instrument driver, TIDASDAQ, is used to run the spectrometer module, collect spectra in either single or continuous mode, control the digital I/Os and save the experimental data to disk . Data analysis is performed with the SpectraView software package . Further, TIDASDAQ exports data directly into GRAMS/AI, a feature very useful for advanced data analysis for pharmaceutical applications and requirements .
TIDAS-I Tidas I Spectrometer Module with TidasDAQ/SpectraView $14,789
210
TidasDAQ: Data Collection and Instrument Control

With TidasDAQ, high precision intensity, absorbance, transmittance or normalized spectra can be obtained in less than a second . Only a few parameters need to be adjusted to obtain spectral data . Sampling of single scans, continuous full spectra scans or triggered scans is possible . Chromatograms can be displayed and logged to disk at up to four wavelengths . Data Export of 2D and 3D Spectrograms, as well as Chromatograms is supported in ASCII, Spectralys/SpectraView, Excel and Grams/ AI formats . Light sources and other sampling instrumentation can be controlled via the TTL level digital outputs, as well as data collection can be triggered by TTL leveled external inputs of the TIDAS I .
Figure 1: TIDASDAQ acquisition window, showing an absorbance baseline.
Figure 2: SpectraView 3D view. Spectra can be displayed and analyzed in 2D and 3D format. This allows the user to conveniently interpret time acquisition data typically done with a TIDAS-1LWCC flow system
SPECTROSCOPY
SpectraView: Data Analysis

SpectraView is a spectroscopy data analysis package targeted at flow analysis applications . It processes data recorded by TIDASDAQ . SpectraView allows to display recorded spectra in 2D (default) and 3D view . Mathematical computation, Derivation, Smoothing, Quantification and other functions are available to work with your data . The Quantification module allows single point and multiple point analysis, multiple linear regression, partial least square and principle component analysis . Data can be exported out of a 3D analysis file into separate scans . Further, chromatograms as well as spectrograms can be copied directly into Excel for further data analysis .
TIDAS-I-LWCC: See liquid waveguide capillary cell system on page 24.
211
Light Sources Deuterium halogen light source with integrated TTL shutter
Replacement Deuterium Lamp D2H-DB
SPECTROSCOPY
The D2H is a combined deuterium and halogen light source for UV/VIS and NIR applications . This light source is ideally suited to work with WPIs spectrometer modules and sample cells . It supplies a continuous spectrum in the UV, VIS and NIR range from 215 nm to 1700 nm . The D2H is equipped with an integrated electrical shutter, which can be controlled by a switch or a TTL signal . For deep UV applications (190-nm), the D2H-2 should be used .
LIGHT SOURCE SPECIFICATIOnS

D2H / D2H-2
APPLICATION SPECTRAL RANGE DEUTERIUM LAMP LIFE TUNGSTEN/HALOGEN LAMP LIFE STABILITY POWER CONSUMPTION POWER REQUIREMENTS SHUTTER/TTL TRIGGER MAX . FIBER OUTPUT CONNECTIONS SHIPPING WEIGHT DIMENSIONS (W/H/L) UV/VIS/NIR 215/1901700 nm 1000 hr 1000 hr 1-2 mAU/h 100 W 110/240V, 50-60Hz, 1A Yes 1000 m SMA 13 .2 lb (6 kg) 5 .3 x 5 .9 x 12 .6 (13 .5 x 15 x 32)
FO-6000
VIS/NIR 3801700 nm NA 3000* hr <0 .5 mAU/h 6 W 12VDC/1A Yes 1000 m SMA 1 .3 lb (0 .6 kg) 4 .8 x 2 .8 x 7 .5 (12 x 7 x 19)
D2H Spectrum
1.0 tungsten & deuterium tungsten 0.8 0.6 0.4 0.2 0.0 200 300 400 500 600 700 800 deuterium
Normalized Intensity
*Lamp life is dependent upon internal power settings.
Wavelength [nm]
UV Safety Goggles
Goggles fit over regular glasses
13410 UV Safety Goggles
$
D2H D2H-HB D2H-DB D2H-HBER
$ Deuterium Halogen Light Source (215 nm1700 nm) 4,371 $ Halogen replacement lamp 190 $ Deuterium replacement lamp ( > 215 nm) 757 $ Deuterium replacement lamp ( > 190 nm) 918
16
212
FO-6000
High color temperature tungsten light source
LED-Lite
Modular LED Light source with exchangeable LEDs

The LED-lite is a power supply for WPIs ELS LED modules for monochromatic light excitation . Each ELS module has an SMA bulk head fitting and allows direct attachment of SMA terminated fibers .
ELS module
This new miniature tungsten FO-6000 Spectrum light source has been developed for high precision 1. 0 portable and low-power 0. 8 spectroscopy applications . 0. 6 Its advantage lies in its high light power output, its 0. 4 effective color temperature 0. 2 FO-6000 of 6000K and its 2760 K Tungsten Lamp 0. 0 exceptionally low drift below 300 400 500 600 700 800 900 1000 0 .5 mAU/h . The FO-6000 Wavelength [nm] is a light source for the extended visible part of the light spectrum (380 nm 1700 nm) . It has a SMA type output connector . Shutter and lamp can be operated via TTL external triggering . This light source offers a wide assortment of field applications in analytical chemistry as well as environmental and life science . A significant problem with tungsten light bulbs is their inherent low light output at wavelengths below 430 nm . The FO-6000 was developed to overcome this limitation . The light intensity of a tungsten light bulb (2760K) drops below 10% at 420 nm wavelength . However, using FO-6000, the light intensity drops below 10% at 370 nm, where the intensity of the conventional tungsten light bulb is at approximately 2% relative light output . The inherent low noise and low drift of the FO-6000 makes it particularly suitable for low-noise detection systems .
Normalized Intensity [cts]
ELS SPECTRAL DISTRIBUTIOnS

Color UV Blue Blue Blue Blue-Green Green Yellow Orange Red max 370 nm 430 nm 450 nm 470 nm 495 nm 525 nm 590 nm 623 nm 660 nm Spectral Line Half Width 12 nm 65 nm 70 nm 20 nm 35 nm 40 nm 13 nm 15 nm 35 nm Estimated Output 85 W 15 W 119 W 140 W 227 W 80 W 60 W 114 W 275 W
SPECTROSCOPY
Estimated output is after light has passed through a 1 mm fiber. LED-LITE ELS Power Supply (requires ELS module) Includes transformer and AC adapter. Specify line voltage ELS-xxx ELS-370 300051 300052 External Light Source Module (specify wavelength) ELS Module (370 nm) Fiber Optic Collimator (SMA) Fiber Optic Collimator (ST)
$
239
FO-6000FILT
The FO-6000FILT inline filter holder directly attaches to the FO-6000 light source . This allows a virtual light loss free insertion of optical filters with outer diameters from 8 to 25 .4 mm and thickness ranging from 2 to 10 mm into the light path of the FO-6000 . With this filter holder and an optical filter, a highly stable monochromatic light source can be assembled .
139 189 $ 175 $ 175

$ $
To order ELS, use wavelength as suffix to part number (e.g. ELS-430).
FO-6000 Fiber Optic Light Source FO-6000FILT Inline Filter Holder Adapter for FO-6000 800120 Replacement Lamp for FO-6000
$ $
955 395 $ 65 213
Flow Cells
Shown here is a complete system: TIDAS-I-LWCC
Liquid Waveguide Capillary Cell

SPECTROSCOPY
Liquid Waveguide Capillary Cells (LWCC) are fiber optic cells that combine an increased optical pathlength (2500 cm) with small sample volumes (51250 mL) . They can be connected via optical fibers to a spectrophotometer with fiber optic capabilities . Ultra-sensitive absorbance measurements can be performed in the ultraviolet (UV), visible (VIS) and near-infrared (NIR) to detect low sample concentrations in a laboratory or process control environment . According to Beers Law the absorbance signal is proportional to chemical concentration and light path length . Compared with a standard 1 cm cell, a 1 mAU signal is enhanced fifty-fold with a 50 cm cell to 50 mAU, using WPIs patented aqueous waveguide
Pathlength, internal volume, and wavelength range (measured with ultrapure water and a Tidas II spectrophotometer
Pathlength [cm] LWCC-2002 LWCC-2005 LWCC-2010 LWCC-2050 LWCC-2100 LWCC-2200 LWCC-2500 2 5 10 50 100 200 500 Internal Volume [L] 5 12 .5 25 125 250 500 1250 Wavelength Range [nm] measured with Tidas II 200-1000 200-1000 200-900 230-800 230-730 250-730 280-730
LWCC Key Features
Typical Efficiency Curves for LWCC

50 Percent Transmission (%T) 40 30 20 10 0 200 -10 Pathlength 2-cm 5-cm 10-cm 50-cm 100-cm 200-cm 500-cm 400 600 Wavelength (nm) 800 1000
LWCC SPECIFICATIOnS
WAVEGUIDE MATERIAL OPTICAL PATHLENGTH INNER DIAMETER INTERNAL VOLUME SAMPLE INLET/OUTLET COMPRESSION FITTING FIBER INPUT MINIMUM PRESSURE* SOLVENT RESISTANCE SHIPPING WEIGHT Fused silica tubing coated with a low refractive index polymer 2-500 cm 550 m 5 - 1250 L 1/16, 1/32 SMA, ID = 400 m 1 .5 - 3 PSI Most organic & inorganic solvents 1 .4 kg (3 lb)
These spectra show the optimal detection limits for LWCCs of varying pathlength.
*A one-meter Type II waveguide of 550 m ID requires about 1.5 PSI for water flow of 1 mL/min.
214
Ultra-sensitive Microliter UV/Vis Spectroscopy with 2 to 500 cm optical pathlength!

Mote Marine Laboratories in Sarasota, Florida has partnered with WPI, using the Companys waveguide technology. WPI customized the LWCC installed in the instrument package inside these AUVs (Autonomous Underwater Vehicles). The LWCCs are used to monitor the color of seawater in the Gulf of Mexico. One of the primary interest areas of this research is red tide algae blooms.
technology* . The LWCC can be connected directly to a pump or can even be filled using a syringe . Based on fiber optics, the LWCC is designed for use with WPIs LEDspec photometric detector (see pages 16-17) . Further, modular spectrophotometric sample systems can be assembled using a TIDAS I spectrometer and a UV/VIS light source such as D2H and FO-6000 (see pages 22-23).
Applications
LWCCs have been used in a variety of applications, such as liquid chromatography, stopped-flow and colormetric detection, drinking water analysis, as well as environmental and oceanographic monitoring systems (see References on WPI website) . WPIs Liquid Waveguide Capillary Cells are made of fused silica tubing with an outer coating of a low refractive index polymer . This results in high signal stability and easy removal of air bubbles trapped in the sensor cell due to the hydrophilic character of the cell wall .
SPECTROSCOPY
Waveguide Cleaning Kit (#501609), above, includes the most commonly needed cleaning solutions for the LWCC waveguides. The LWCC Start-up Kit (#KITLWCC), at right, includes two fiber optic cables (#FO-400-SMA1M), Sample Injector Assembly (#58006), Peri-Star Pro Peristaltic Pump, and WaveGuide Cleaning Kit (#501609). LWCC-2002 LWCC-2005 LWCC-2010 LWCC-2050 LWCC-2100 LWCC-2200 LWCC-2500 Liquid Waveguide Capillary Cell, pathlength = 2 cm Liquid Waveguide Capillary Cell, pathlength = 5 cm Liquid Waveguide Capillary Cell, pathlength = 10 cm Liquid Waveguide Capillary Cell, pathlength = 50 cm Liquid Waveguide Capillary Cell, pathlength = 100 cm Liquid Waveguide Capillary Cell, pathlength = 200 cm Liquid Waveguide Capillary Cell, pathlength = 500 cm 1,695 1,695 $ 1,695 $ 1,695 $ 1,695 $ 1,895 $ 3,350
$ $
LWCC Injection System

For flow analysis, including simple fluid injection analysis (FIA) setups, add WPIs LWCC injection system (WPI #89372) . A selection valve provides baseline or cleaning solutions to the sample stream . The injection valve injects a sample into the stream, avoiding the introduction of air bubbles or changes of flow rate .
ACCESSORIES
A sample injector assembly can be used to conveniently fill an LWCC with sample solution using a peristaltic pump . Please note that the LWCC requires two optical fibers to connect to spectrophotometer system . Choose between anti-solarized 400 micron core or UV-enhanced cables (may be ordered in 1 or 3 meter lengths) .
* Related Patents
Micro Chemical Analysis Employing Flow Through Detectors, 1995, U .S . Patent No . 5,444,807 . Aqueous Fluid Core Waveguide, 1996, U .S . Patent No . 5,507,447 . Long Capillary Waveguide Raman Cell, 1997, U .S . Patent No . 5,604,587 . Chemical Sensing Techniques Employing Liquid-Core Optical Fibers, U .S . Patent No . 6,016,372
89372 LWCC Injection System 58006 Sample Injector Attachment PERIPRO-4L Peri-Star Pro Peristaltic Pump (see page 2) MInISTAR Miniature Peristaltic Pump, 1-channel (see page 4) FO-400-SMA1M Fiber Optic cable, 1m, SMA, 400 mm core, UV-enhanced 501609 Waveguide Cleaning Kit KITLWCC LWCC Start-up Kit* 58450 Kit, Adapter Syringe, LWCC
*includes FO-400-SMA1M (two), 58006, PERIPRO-4L, 501609
1195 $ 69 $ 1,450 $ 445 $ 145 $ 59 $ 1,750 $ 35

$
215
V-Vette
Sample holder for spectroscopic analysis of microliter volume samples

l 2 microliter sample l 1 mm pathlength l No moving parts l Baseline repeatability < 2 mAU l Patent pending
V-Vette is a fiber optic sample cell with a pathlength of 1 mm for spectroscopic analysis of microliter volume samples . Light is coupled into and out of the sample cell via optical fibers . A 2 L sample droplet can be conveniently placed into the v-shaped sample compartment from a pipetter . Absorbance of the sample is measured between the input and output fiber after a cover is placed on the sample compartment to minimize stray light . The sample can be picked up and reused or removed by blowing it off with dry air or wiping it off .
V-VETTE V-Vette Microliter Sample Holder
$
V-VETTE SPECIFICATIOnS
FUNCTIONALITY . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Absorbance COVER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Included PATHLENGTH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 mm WAVELENGTH RANGE . . . . . . . . . . . . . . . . . . . . . . . .200 1000 nm FIBER CONNECTION . . . . . . . . . . . . . . . . . . . . . . . . . .600 m (SMA) SAMPLE VOLUME . . . . . . . . . . . . . . . . . . . . . . . . . . . .2-5 L BASELINE REPEATABILITY . . . . . . . . . . . . . . . . . . . .< 2 mAU peak to peak .
995
MicroLWCC
Low volume flow cell for FIA, HPLC and Process Analysis
SPECTROSCOPY
MicroLWCC (WPI #LWCC-M-10 and #LWCC-M-50) is a new fiber optic low volume flow cell for UV/VIS/NIR absorbance analysis . Based on WPIs established liquid core waveguide technology, the analyte solution functions as the core of a fluid filled light waveguide . Wetted parts in the sample cell light path are PEEK, fused silica and PTFE . Optical fibers are used to transport light to and from the sample cell . The cell can be used in biochemistry for LWCC-M SPECIFICATIOnS
LWCC-M-10 LWCC-M-50 OPTICAL PATHLENGTH . . . . . . . . . . . . . . . . . 10 mm . . . . . . . . . . . . . 50mm . INTERNAL VOLUME . . . . . . . . . . . . . . . . . . . . 2 .4 L . . . . . . . . . . . . . 12 L . WAVELENGTH RANGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .200 1000 nm FIBER CONNECTION [m] . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .600 (SMA) TRANSMISSION @ 254 nm * . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .> 40% MAXIMUM PRESSURE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . > 1000 psi REFRACTIVE INDEX @ 280 nm** . . . . . . . . . . . . . . . . . . . . . . . . . . . . . < 7 mAU . WETTED MATERIALS . . . . . . . . . . . . . . . . . . . . . . . . . . . PEEK, Fused Silica, PTFE * Reference: 2 * 600 um Fiber, butt-coupled ** Measured using ASTM E 685 - 93 WPI U .S . Patents: 5,444,807; 5,570,447; 5,604,587; 6,603,556; 6,385,380 .
DNA, RNA & protein quantification, colorimetric nutrient and trace metal analysis, drug discovery and dissolution testing, process control, and HPLC analysis .
LWCC-M-10 LWCC-M-50 Low Volume Flow Cell, 10 mm pathlength Low Volume Flow Cell, 50 mm pathlength
$ $
1595 1795
References
M . Belz, Simple and sensitive protein detection system using UV LEDs and liquid core waveguides, Advanced Environmental, Chemical, and Biological Sensing Technologies V, Optics East, Oct 2007, Proc . SPIE, Vol . 6755, 675505 M . Belz, F . A . Klein, H . S . Eckhardt, K . Klein, D . Dinges, K . T . V . Grattan, Optical Detection Techniques and Light Delivery with UV LEDs and Optical Fibres, Third International Conference on Optical and Laser Diagnostics, Proc . IOP, City University, London, UK, May 2007 . M . Belz, P . Dress, A . Sukhitskiy, S . Liu, Linearity and effective optical pathlength of liquid waveguide capillary cells, Part of the SPIE Conference on Internal Standardization and Calibration; Architectures for Chemical Sensors, Boston Massachusetts, September 1999, SPIE Vol . 3856, 271281 .
216
Dipping Probes
for UV/Vis Spectroscopy
Worlds Smallest Fiber Optic Dipping Probe

10 mm light pathlength 5 mm light pathlength
2 mm light pathlength
DipTip is a miniature transmission probe for microliter spectroscopic sampling . DipTips tip diameter is only 1 .5 mmthe size of a 17-gauge needle . It will fit into all micro centrifuge tubes on the market and is a very useful tool for measuring protein and DNA samples . The diminutive dipping probe can also be used for a dissolution system . Thanks to WPI's proprietary optical design, DipTip is not only four to five times smaller in diameter than any other product on the market, but also costs 50% less . Together with our fiber optic-based spectrometer module (Tidas I) and light sources (D2H and FO-6000), microliter samples can be analyzed very cost effectively .
SPECTROSCOPY
Ideal for multi-channel applications.
DIPTIP SPECIFICATIOnS
DIP-NIR 1 .5 mm 2, 5, 10mm 350-1000 20-50 L 7 mm 1 .5 m SMA 905 400 m 400 m DIP-UV-SR 1 .5 mm 2, 5, 10mm 200-1000 20-50 L 7 mm 1 .5 m SMA 905 400 m 400 m
$
TIP DIAMETER LIGHT PATHLENGTH WAVELENGTH RANGE (nm) SAMPLE VOLUME REQUIRED DISTANCE FROM TIP TO UPPER EDGE OF SAMPLE WINDOW FIBER LENGTH FIBER OPTIC CONNECTION LAUNCH FIBERS (2) NA = 0 .22 RETURN FIBER (1) NA = 0 .22
DIP-nIRx DIP-UV-SRx UCK
DipTip for VIS/NIR Spectroscopy (2, 5, and 10mm path) DipTip for UV/VIS with solar resistant fibers (2, 5, and 10mm path) Ultrasonic Cleaning Kit Specify pathlength when ordering: X = 2, 5 or 10
845 845 Call
217
Optical Glass and Quartz Cuvettes for

l High Quality Glass Cuvettes for less than $4/cuvette $39/pack of 10 l Standard Quartz Cuvettes for $39 each l Now offering an expanded line of standard, self-masking, and flow cuvettes!
WPIs glass and synthetic quartz cuvettes packaged, glass cuvettes are shipped in and synthetic quartz cuvettes are shown in are ideal for UV/VIS/NIR absorbance or packages of 10 cuvettes . These economic Fig .1 (cuvettes were empty, thickness 1 .25 mm fluorescence experiments . quartz and glass cuvettes are ideal for precision x 2, including surface reflections, measured with measurements because of their high quality a TIDAS II against air as reference) . Synthetic quartz can be used in deep UV materials used and their low manufacturing applications and is recommended for A complete transmission spectrum from tolerances . Typical transmission curves of glass fluorescent applications, as it does not exhibit 190nm to 4 mm is shown in Fig . 2 (cuvettes background fluorescence . Quartz were empty, thickness 1 .25 mm x cuvettes (absorbance, fluorescence 2, including surface reflections) . TECHnICAL CHARACTERISTICS and flow) are shipped individually Cuvette Material Spectral Range Transmission Difference ( >80% ) Between Different Cuvettes Optical Glass 350 2500 nm Less than 1% Synthetic Quartz 200 2500 nm Less than 1%
100
Transmission [%]
80 60 40 20 0 200 400 600
Synthetic Quartz Glass
SPECTROSCOPY
800
1000
Wavelength [nm]
Fig. 1Transmission curves of Glass and Synthetic Quartz Cuvettes
Style A
Style B
Style C
Fig. 2Complete transmission curves of Glass and Synthetic Quartz Cuvettes
Style D
218
Style E
Style F
Spectrophotometry and Fluorometry

WPI PN
CUV2101-1* CUV2102-1* CUV2011-1* CUV1022-10 CUV2012-1 CUV2105-1 CUV2106-1 CUV2107-1 CUV2108-1
Style
Polished path material windows [mm] Dimensions [mm]

Quartz Quartz Quartz Optical Glass Quartz Quartz Quartz Quartz Quartz 2 2 2 2 2 2 2 2 2 1 2 5 10 10 20 30 40 50 3 .5x12 .5x45 4 .5x12 .5x45 7 .5x12 .5x45 12 .5x12 .5x45 12 .5x12 .5x45 22 .5x12 .5x45 32 .5x12 .5x45 42 .5x12 .5x45 52 .5x12 .5x45
volume [mL]
0 .35 0 .7 1 .7 3 .5 3 .5 7 10 .5 14 17 .5
Beam width [mm]

10 10 10 10 10 10 10 10 10
Price per cell
standard rectangular cuvettes B B B C C C C C C

$ $ $ $
85 85 42
39 pack of 10 $ 39 $ 89 $ 95 $ 105 $ 119
*89341 *89342 *89337
Cuvette spacer for 1-mm cuvettes (part CUV2101-1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$49 Cuvette spacer for 2-mm cuvettes (part CUV2102-1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$49 Cuvette spacer for 5-mm cuvettes (part CUV2011-1, CUV2023-1, CUV2063-1) . . . . . . . .$49 .
Self masking Semi micro Cell Cuvette CUV2023-1* CUV2031-1 CUV2025-1 CUV2028-1 CUV2032-1 CUV2033-1 CUV2034-1 CUV2063-1* CUV2061-1 CUV2065-1 CUV2066-1 CUV2062-1 D D D D D D D Quartz Quartz Quartz Quartz Quartz Quartz Quartz 2 2 2 2 2 2 2 5 10 20 50 10 10 10 7 .5x12 .5x45 12 .5x12 .5x45 22 .5x12 .5x45 52 .5x12 .5x45 12 .5x12 .5x45 12 .5x12 .5x45 12 .5x12 .5x45 0 .7 1 .4 2 .8 7 1 0 .7 0 .35 4 4 4 4 3 2 1
$ $ $
89
89 105 $ 159 $ 89 $ 89 $ 89
Self masking continuous flowthrough cell, Z=15 mm E E E E F Quartz Quartz Quartz Quartz Quartz 2 2 2 2 2 5 10 20 30 10 7 .4x12 .5x45 12 .5x12 .5x45 22 .6x12 .5x45 32 .6x12 .4x45 12 .5x12 .5x45 0 .035 0 .07 0 .14 0 .21 0 .48 3 3 3 3 4x12 2
$ $ $
169
169 189 $ 189 $ 159
SPECTROSCOPY
Self masking continuous flow through cell, small input, large output, Z=8.5 mm CUV2614-1 H Quartz 2 10 12 .4x12 .4x35 .6 0 .03 Micro Cell with black walls CUV2674-1 J Quartz Fluorescence CUV2051-1 CUV2052-1
269
10
12 .5x12 .5x45
0 .05
189
A A
Quartz Quartz
4 4
10 10
12 .5x12 .5x45 12 .5x12 .5x45
3 .5 1 .4
10 4
$ $
110 149
Long Path Cuvette CUV2071-1 G
Quartz
100
102 .5 x 22
28
19
149
TTE UVE C n EW LDERS HOage 220

p
Style G
Style H
Style J
219
Accessories High Precision Cuvette Holders
0.1 to 10 cm pathlength
WPI #89328
Description Functionality Adjustable Cuvette Holder Absorbance Included 1, 2, 3, 4, 5, 10 cm 1, 2, 5 mm with spacer 200 1000 nm 50 1000 m (SMA) 5 mm < 2 mAU peak to peak A, B, C, D, E, F, G, J 15 mm
$
WPI #89340
ABS/FL Cuvette Holder Absorbance & Fluorescence included 1 cm, 1, 2, 5 mm with spacer 200 1000 nm 50 1000 m (SMA) 5 mm < 2 mAU peak to peak A, B, C, D, E, F, J 15 mm
$
WPIs cuvette holders address the need for precision sampling with specialty cuvettes in Absorbance and Fluorescence applications . High precision cuvette positioning for low volume cuvettes . Quartz lenses for high light throughput . WPI #89328 fits 1, 2,3,4,5 & 10 cm standard and cylindrical cuvettes . WPI #89340 can be configured for absorbance or fluorescence experiments . 89339 Mirrored screw plugs, ea .
$
SPECTROSCOPY
Cover Pathlength Wavelength Range Fiber Connection Beam Diameter Baseline Repeatability WPI Cuvette Types Z height Price
99
875
650
In-Line Fiber Optic Filter Holder
This In-Line Fiber Optic Filter Holder allows the insertion of optical filters within a fiber optic pathway . The connectors of the filter holder assembly are com at le with WPIs range of fiber optic jumper cables and can be p ib coupled using SMA or ST connectors . Filters with outer diameters from 8 to 25 .4 mm and thick ess s from n e 2 to 10 mm can be accomodated . The design lim ts lateral and axial i movement of the filter when secured in the holder . Two fiber optic collimators are internally mounted in the holder to pass collimated light through the filter and then refocus the filtered light into the aperture of the out ut fiber . Spectral range will be largely limited p by the bandpass of the optical fibers (from UV to near IR using WPI UV-enhanced ca les) . b 56200 56300 In-Line Fiber Optic Filter Holder (SMA) In-Line Fiber Optic Filter Holder (ST) 540 540
$ $
220
Filter Holder for Glass Fiber Filters
QFT2
Simple measurements for particulate absorption

WPIs filter holder for particulate absorption measurements is specially designed for field use . It is rugged and portable . It performs as well as a laboratory based spectrophotometer . It can be directly connected to WPIs line of fiber optic spectrometers and light sources . Instead of collecting your samples, transporting them to a laboratory, and accepting the loss of spectral information associated with it (Sosik, 1999), particulate absorption can now be measured on site . QFT1, an optical holder for glass fiber filters, allows you to measure absorbance of particulate matter concentrated on a glass fiber filter pad . The QFT2 is a QFT1 with an integrated 1cm cuvette holder, which allows for on-site liquid sample measurements, as well .
QFT1
Advantages of QFT1
WPIs filter holder for glass fiber filters is designed for fiber optic use . It is rugged and portable and can be used in the field .
380730 nm and 280730 nm wavelength range, respectively . Further, the QFT1 can be interfaced with WPIs SpectraUSB4 CCD spectrometer line . The QFT1 can also be interfaced to any other CCD, PDA or scanning type spectrometer with fiber optic capabilities .
How does it work ?

Particulate absorption of fresh and seawater can be determined by filtering a known amount of sample through a Glass Fiber Filter (GF/F) and measuring the particulate absorption coefficient ap() concentrated on the filter . This technique is called quantitative filter technique (QFT) and corrects for the pathlength amplification, an effect of scattering . The correction of the pathlength amplification and the correction of the non-linear relationship between the optical density of samples on a Whatman GF/F filter and in suspension are discussed in Mitchell (1990) .
Performance
To test the performance of the QFT1, seawater samples were collected locally and filtered through a GF/F filter pad . The particulate absorption was measured with the QFT1 and for comparison with a Lambda 35 UV/VIS spectrometer equipped with a RSA-PE-20 integrating sphere attachment . The measured particulate absorbance spectra overlay well for a number of samples . A significant advantage of the filter holder is its large beam diameter of 5 mm, resulting in averaging out of larger non-organic particles frequently found on the filter pad when using natural samples . The removable filter fixture allows simple filter alternation and cleaning .
SPECTROSCOPY
Specifications
GF/F Filter Diameter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 mm Wavelength Range . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 280-730 nm * Fiber Optic Connection . . . . . . . . . . . . . . . . . . . . . . . . . 600 m / SMA Material in contact with filter pad . . . . . . . . Delrin Weight . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0 .5 kg (1 lb)
* Using a TIDAS I spectrometer and D2H UV/VIS light

source.
Detector and light source requirements

The optical throughput of QFT1 equipped with a classical GF/F filter is very low and requires a matched light source / spectrometer system . WPIs TIDAS I in combination with WPIs FO-6000 tungsten light source or D2H deuterium/ halogen light source can be used in the
Sarasota Bay Particulate Matter

Absorption [1/m]
References
0.7 0.5 0.3 0.1 -0.1 380
PE-1 PE-2 QFT1-1 QFT1-2
Mitchell, B . G ., Algorithms for Determining the Absorption Coefficient of Aquatic Particles Using the Quantitative Filter Technique (QFT), SPIE Vol . 1302 Ocean Optics X (1990), 137-148 . Sosik, H . M ., Storage of marine particulate samples for light-absorption measurements, Limnol. Oceanogr., 44(4), 1999, 1139-1141 M . Belz, K . Larsen, K .-F . Klein, Fiber optic sample cells for polychromatic detection of dissolved and particulate matter in natural waters, Proc. SPIE, Vol . 6377, Oct 2006, 63770X
480
580 Wavelength [nm]
680
Particulate absorption of seawater samples collected in Sarasota Bay.
89575 89385
QFT1, Fiber Optic Holder for Glass Fiber Filters QFT2, Fiber Optic Holder with Cuvette Holder
$ $
750 950 221
Accessories Fiber Optic Adapter Fiber Optic Collimator

For UV1000 and UV2000 Thermo Electron HPLC Detectors
WPIs Fiber Optic Collimator can be used for both collimating a light beam emitted by an optical fiber or coupling light from a collimated light beam into an optical fiber . The numerical aperture of the collimator is optimized for maximum coupling efficiency into typical fused silica fibers . The collimator can, for example, be used to guide a parallel light beam through a sample cuvette or an optical filter with virtually no optical losses . In this application, one collimator collimates the light into a parallel beam 5 mm in diameter, enabling it to pass a long distance without losing the energy . After the light passes the sample media, a second collimator can be used to collect the beam into the receiving fiber . A unique design feature of this collimator is that the distance between the lens and the optical fiber can be easily adjusted . This permits it to be used as a focusing device or for fine-tuning the color balance when coupling light from a light source into a fiber .
COLLIMATOR SPECIFICATIOnS
This fiber optic adapter is designed for Thermo Electrons UV1000/UV2000 series of HPLC detectors . It allows for an efficient connection of WPIs fiber optic sampling equipment via two SMA-905 connectors . Instead of using the standard 1 cm flow cell, WPIs line of liquid waveguide capillary cells with pathlengths from 2 cm to 500 cm can be attached . This is a cost-effective way to equip existing UV1000 or UV2000 detectors in the lab with fiber optic sampling cells . For example, using a LWCC-2200 with a 200 cm optical pathlength, the sensitivity of the detection system is increased 200fold, enabling very sensitive flow injection analysis setups . A baseline noise performance of approximately 1-2 mAU is achievable with such a setup .
LENS DIAMETER LENS FOCAL DISTANCE LENS MATERIAL WAVELENGTH RANGE MOUNTING THREADS DIVERGENCE FIBER CONNECTOR INTERFACE 5 mm 10 mm Ultraviolet grade synthetic fused silica (KU-1) 170 nm-2 m 3/8-24 UNF < 0 .1 rad for 1 mm core fiber SMA or ST
$ $
SPECTROSCOPY
59609
Fiber Optic Adapter for UV1000 & UV2000
650
300051 300052
Fiber Optic Collimator (SMA) Fiber Optic Collimator (ST)
175 175
Plastic Fiber Optic Cables

More flexible than glass fibers, these inexpensive PMMA plastic fibers can be used for illumination and scientific applications . They are excellent for light transfer between 350 nm and 1000 nm . Their maximum temperature should be kept below 80 C .
PLASTIC FIBER OPTIC CABLES (nOn UV), 400 TO 1000 nM FOP1-SMA Plastic Fiber Optic Cable, SMA connectors, 1 mm x 2 m FOP1-SMA/ST Plastic Fiber Optic Cable, ST/SMA connectors, 1 mm x 2 m FOP1-ST Plastic Fiber Optic Cable, ST connectors, 1 mm x 2 m
105 145 $ 105

$ $
OPTIOnAL ACCESSORIES 13395 SMA Bulkhead Feedthru connector/coupler, D-hole 13370 SMA half-length Bulkhead coupler/connector CC-3-UV Cosine Corrector 13370
20 20 $ 129
$ $
CC-3-UV
13395
222
Optical Fibers Bifurcated Fiber Optic Assemblies

Use to combine similar intensity light from differing sources or to split a light source into two fibers . For use with a dual spectrometer as a reference .
UV/VIS
BIFURCATED ASSEMBLY SPECIFICATIOnS

Length Connectors Wavelength ranges Cable Type 1 meter SMA 200-1100 nm UV-enhanced
BIF22 BIF44 BIF41 BIF62 BIF66
Split or combine similar intensities (200/200) Split or combine similar intensities (400/400) Combine UV (400) + VIS (100) Combine UV (600) + VIS (200) Split or Combine Similar Intensities (600/600)
400 455 $ 425 $ 525 $ 495

$ $
WPI can build custom fiber optic assemblies for many UV/VIS/nIR applications. Call for more information.
UV-enhanced fiber optic cables

of such a fiber, defined by the 1/e reduction in transmission at 240 nm, is normally less than 200 minutes . This effect renders them unsuitable for UV spectroscopy below 240 nm . Anti-solarization fibers suitable for deep UV spectroscopy solve this problem . These fibers stabilize to less than 5% degradation over a period of 20,000 hours after an initial transmission burn-in loss of less than 25% . Additionally, this anti-solarization characteristic will not degrade over time .
Attenuation dB/km 1000
Over 20,000 hours with less than 5% degradation!
SPECTROSCOPY
100 Transmission/m 99%
10
99.9%
1 200 300 400 Wavelength, nm 500 600 700 800 900 1000 1100
Features
l Broad UV/Vis spectral range l Laser damage resistant l High core to clad ratios l Broad temperature range l Bio-compatible materials l Radiation resistant l Sterilizable by ETO and gamma radiation l Higher transmission than PCS between 180-nm and 300 nm
Properties
l Multimode Pure silica core Numerical aperture: 0 .22 0 .02 (standard) l Standard prooftest: 70 kpsi Minimum bend radius: 100x clad radius (momentary), 600x clad radius (long term)
UV-EnHAnCED FIBER OPTIC CABLES, 230 1000 nM FO-50-SMA1M Fiber Optic Cable, 1 m, SMA, 50 m Core, UV-Enhanced FO-50-SMA Fiber Optic Cable, 3 m, SMA, 50 m Core, UV-Enhanced FO-100-SMA1M Fiber Optic Cable, 1 m, SMA, 100 m Core, UV-Enhanced FO-100-SMA Fiber Optic Cable, 3 m, SMA, 100 m Core, UV-Enhanced FO-200-SMA1M Fiber Optic Cable, 1 m, SMA, 200 m Core, UV-Enhanced FO-200-SMA Fiber Optic Cable, 3 m, SMA, 200 m Core, UV-Enhanced FO-400-SMA1M Fiber Optic Cable, 1 m, SMA, 400 m Core, UV-Enhanced FO-400-SMA Fiber Optic Cable, 3 m, SMA, 400 m Core, UV-Enhanced FO-400SMA/ST Fiber Optic cable, 1 m, SMA/ST connector, 400 m core, UV-Enhanced FO-600-SMA1M Fiber Optic Cable, 1 m, SMA, 600 m Core, UV-Enhanced FO-600-SMA Fiber Optic Cable, 3 m, SMA, 600 m Core, UV-Enhanced FO-1000-SMA1M Fiber Optic Cable, 1 m, SMA, 1000 m Core, UV-Enhanced FO-1000-SMA Fiber Optic Cable, 3 m, SMA, 1000 m Core, UV-Enhanced AnTI SOLARIZATIOn FIBER OPTIC CABLES, 190 1000 nM FO-200AS-SMA Fiber Optic Cable, 1 m, SMA, 200 m Core, Anti-Solarization FO-400AS-SMA Fiber Optic Cable, 1 m, SMA, 400 m Core, Anti-Solarization FO-600AS-SMA Fiber Optic Cable, 1 m, SMA, 600 m Core, Anti-Solarization PLASTIC FIBER OPTIC CABLES (nOn UV), 400 TO 1000 nM FOP1-SMA Plastic Fiber Optic Cable, SMA connectors, 1 mm x 2 m FOP1-SMA/ST Plastic Fiber Optic Cable, ST/SMA connectors, 1 mm x 2 m FOP1-ST Plastic Fiber Optic Cable, ST connectors, 1 mm x 2 m
135 170 $ 130 $ 165 $ 130 $ 155 $ 145 $ 195 $ 555 $ 160 $ 225 $ 190 $ 350
$ $
Anti-Solarization
The transmission of conventional UV-enhanced silica/silica fiber decreases rapidly at wavelengths below 240 nm when exposed to high intensities of a deuterium lamp . This effect is called UV-solarization and results from the generation of color centers in the fiber material . The lifetime
165 245 $ 270

$ $
105 145 $ 105

$ $
223
Product Index
Item Page Item Page Item Page Item Page
121 . . . . . . . . . . . . . . . . . . . . . . . . . 102 260 . . . . . . . . . . . . . . . . . . . . . . . . . . 93 705 . . . . . . . . . . . . . . . . . . . . . . . . . . 85 773 . . . . . . . . . . . . . . . . . . . . . . . . . . 86 1358 . . . . . . . . . . . . . . . . . . . . . . . . 141 1571 . . . . . . . . . . . . . . . . . . . . 125,.133 1965 . . . . . . . . . . . . . . . . . . . . . . . . 121 1966 . . . . . . . . . . . . . . . . . . . . . . . . 121 1967 . . . . . . . . . . . . . . . . . . . . . . . . 121 2478 . . . . . . . . . . . . . . . . . . . . . . . . 178 2479 . . . . . . . . . . . . . . . . . . . . . . . . 178 2505 . . . . . . . . . . . . . . . . . . . . . . . . 125 2541 . . . . . . . . . . . . . . . . . . . . . . . . . 85 2547 . . . . . . . . . . . . . . . . . . . . . . . . . 87 2851 . . . . . . . . . . . . . . . . . . . . . . . . 141 2932 . . . . . . . . . . . . . . . . . . . . . . . . 136 2933 . . . . . . . . . . . . . . . . . . . . . . . . 136 2935 . . . . . . . . . . . . . . . . . . . . . . . . 136 3006 . . . . . . . . . . . . . . . . . . . . . . . . 141 3161 . . . . . . . . . . . . . . . . . . . . . . . . 141 3259 . . . . . . . . . . . . . . . . . . . . . . . . 107 3260 . . . . . . . . . . . . . . . . . . . . . . . . 196 3294 . . . . . . . . . . . . . . . . . . . . . . . . 141 3301 . . . . . . . . . . . . . . . . . . . . . . . . 141 3302 . . . . . . . . . . . . . . . . . . . . . . . . 141 3316 . . . . . . . . . . . . . . . . . . . . . . . . 196 3414 . . . . . . . . . . . . . . . . . . . . . . . . . 91 3468 . . . . . . . . . . . . . . . . . . . . . . . . 136 3469 . . . . . . . . . . . . . . . . . . . . . . . . 136 3484 . . . . . . . . . . . . . . . . . . . . . . . . 136 3485 . . . . . . . . . . . . . . . . . . . . . . . . . 91 3491 . . . . . . . . . . . . . . . . . . . . . . . . 141 3492 . . . . . . . . . . . . . . . . . . . . . . . . 141 3508 . . . . . . . . . . . . . . . . . . . . . . . . 141 3517 . . . . . . . . . . . . . . . . . . . . . . . . 141 3531 . . . . . . . . . . . . . . . . . . . . . . . . 178 3551 . . . . . . . . . . . . . . . . . . . . . . . . 178 3578 . . . . . . . . . . . . . . . .103,.129,.141 3669 . . . . . . . . . . . . . . . . . . . . . . . . . 27 3670 . . . . . . . . . . . . . . . . . . . . . . . . 141 3955 . . . . . . . . . . . . . . . . . . . . . . . . . 27 3960 . . . . . . . . . . . . . . . . . . . . . . . . . 27 3993 . . . . . . . . . . . . . . . . . . . . . . . . . 19 4878 . . . . . . . . . . . . . . . . . . . . . . . . 198 4879 . . . . . . . . . . . . . . . . . . . . . . . . 198 4886 . . . . . . . . . . . . . . . . . . . . . . . . 132 4898 . . . . . . . . . . . . . . . . . . . . . . . . 133 5052 . . . . . . . . . . . . . . . . . . . . . . . . 158 5153 . . . . . . . . . . . . . . . . . . . . . . . . . 27 5210 . . . . . . . . . . . . . . . . . . . . . . . . . 27 5233 . . . . . . . . . . . . . . . . . . . . . . . . . 27 5340 . . . . . . . . . . . . . . . . . . . . . . . . 198 5361 . . . . . . . . . . . . . . . . . . . . . . . . . 27 5362 . . . . . . . . . . . . . . . . . . . . . . . . . 27 5371 . . . . . . . . . . . . . . . . . . . . . . . . 141 5372 . . . . . . . . . . . . . . . . . . . . . . . . 141 5373 . . . . . . . . . . . . . . . . . . . . . . . . 141 5374 . . . . . . . . . . . . . . . . . . . . . . . . 141 5375 . . . . . . . . . . . . . . . . . . . . . . . . 141 5377 . . . . . . . . . . . . . . . . . . . . . . 63,.66 5378 . . . . . . . . . . . . . . . . . . . 63,.66,.76 5399 . . . . . . . . . . . . . . . . . . . . . . 64,.76 224
5430 . . . . . . . . . . . . . . . . . . . . . . . . 196 5435 . . . . . . . . . . . . . . . . . . . . . . 63,.64 5436 . . . . . . . . . . . . . . . . . . . . . . 63,.64 5440 . . . . . . . . . . . . . . . . . . . . . . . . 123 5444 . . . . . . . . . . . . . . . . . . . . . . . . 125 5447 . . . . . . . . . . . . . . . . . . . . . . . . . 90 5450 . . . . . . . . . . . . . . . . . . . . . . . . . 28 5451 . . . . . . . . . . . . . . . . . . . . . . . . . 28 5464 . . . . . . . . . . . . . . . .149,.152,.155 5468 . . . . . . . . . . . . . . ..100,.103,.178 5469 . . . . . . . . . . . . . . . . . . . . . . . . 100 5470 . . . . . . . . . . . . . . . . . . . . . . . . 100 5475 . . . . . . . . . . . . . . . . . . . . . . . . 168 5479 . . . . . . . . . . . . . . . . . . . . . . . . 158 5482 . . . . . . . . . . . . . . . . . . . . . . . . 100 5483 . . . . . . . . . . . . . . . . . . . . . . . . 100 5489 . . . . . . . . . . . . . . . . . . . . . . . . . 90 6820 . . . . . . . . . . . . . . . . . . . . . . . . 133 7128 . . . . . . . . . . . . . . . . . . . . . . . . 133 7325 . . . . . . . . . . . . . . . . . . . . . . 63,.64 7326 . . . . . . . . . . . . . . . . . . . 63,.66,.76 7335 . . . . . . . . . . . . . . . . . . . . . . . . 133 7341 . . . . . . . . . . . . . . . . . . . . . . . . 134 7342 . . . . . . . . . . . . . . . . . . . . . . . . 134 7357 . . . . . . . . . . . . . . . . . . . . . . . . . 64 7521 . . . . . . . . . . . . . . . . . . . . . . . . . 64 7600 . . . . . . . . . . . . . . . . . . . . . . 28,.29 13024. . . . . . . . . . . . . . . . . . . . . . . 136 13025. . . . . . . . . . . . . . . . . . . . . . . 136 13142. . . . . . . . . . . . . ..175,.177,.198 13316. . . . . . . . . . . . . . . . . . . 123,.133 13324. . . . . . . . . . . . . . . . . . . . . . . 141 13338. . . . . . . . . . . . . . . . . . . 165,.168 13347. . . . . . . . . . . . . . . . . . . . . . . 141 13370. . . . . . . . . . . . . . . . . . . . . . . 222 13388. . . . . . . . . . . . . . . . . . . . . . . 141 13395. . . . . . . . . . . . . . . . . . . . . . . 222 13410. . . . . . . . . . . . . . . . . . . . . . . 212 13451. . . . . . . . . . . . . . . . . . . . . . . 141 13555. . . . . . . . . . . . . . . . . . . . . . . 141 13620. . . . . . . . . . . . . . . . . . . . . . . 141 13685. . . . . . . . . . . . . . .141,.187,.189 13776. . . . . . . . . . . . . . . . . . . . . . . 141 13854. . . . . . . . . . . . . . . . . . . . . . . 141 13962. . . . . . . . . . . . . . . . . . . 187,.189 14003. . . . . . . . . . . . . . . . . . . . . . . . 34 14011. . . . . . . . . . . . . . . . . . . . . . . 138 14012. . . . . . . . . . . . . . . . . . . . . . . 138 14088. . . . . . . . . . . . . . . . . . . . . . . 141 14095. . . . . . . . . . . . . . . . . . . . . . . . 31 14096. . . . . . . . . . . . . . . . . . . . . . . . 32 14097. . . . . . . . . . . . . . . . . . . . . . . . 32 14098. . . . . . . . . . . . . . . . . . . . . . . . 31 14099. . . . . . . . . . . . . . . . . . . . . . . . 32 14101. . . . . . . . . . . . . . . . . . . . . . . . 31 14104. . . . . . . . . . . . . . . . . . . . . . . 147 14106. . . . . . . . . . . . . . . . . . . . . . . 147 14109. . . . . . . . . . . . . . . . . . . . . . . . 36 14119. . . . . . . . . . . . . . . . . . . . . . . . 37 14122. . . . . . . . . . . . . . . . . . . . . . . . 34 14125. . . . . . . . . . . . . . . . . . . . . . . . 34 14126. . . . . . . . . . . . . . . . . . . . . . . . 34
14130. . . . . . . . . . . . . . . . . . . . . . . . 37 14192. . . . . . . . . . . . . . . . . . . . . . . . 36 14218. . . . . . . . . . . . . . . . . . . . . . . . 35 14219. . . . . . . . . . . . . . . . . . . . . . . . 35 14226. . . . . . . . . . . . . . . . . . . . . . . . 33 14239. . . . . . . . . . . . . . . . . . . . . . . 192 14254. . . . . . . . . . . . . . . . . . . . . . . 141 14393. . . . . . . . . . . . . . . . . . . . . . . . 35 14394. . . . . . . . . . . . . . . . . . . . . . . . 35 14404. . . . . . . . . . . . . . . . . . . . . . . . 41 14405. . . . . . . . . . . . . . . . . . . . . . . . 41 14444. . . . . . . . . . . . . . . . . . . . . . . 155 15590. . . . . . . . . . . . . . . . . . . . . . . 169 15623. . . . . . . . . . . . . . .141,.187,.189 15624. . . . . . . . . . . . . . .141,.187,.189 15810. . . . . . . . . . . . . . . . . . 64,.65,.66 15867. . . . . . . . . . . . . . . . . . . 195,.198 15873. . 145,.148,.149,.152,.154,.155 15914. . . . . . . . . . . . . . . . . . . . . . . . 33 15915. . . . . . . . . . . . . . . . . . . . . . . . 33 15920. . . . . . . . . . . . . . . . . . . . . . . . 33 15921. . . . . . . . . . . . . . . . . . . . . . . . 33 15922. . . . . . . . . . . . . . . . . . . . . . . . 35 15923. . . . . . . . . . . . . . . . . . . . . . . . 35 15934. . . . . . . . . . . . . . . . . . . . . . . 179 15975. . . . . . . . . . . . . . . . . . . . . . . 141 15976. . . . . . . . . . . . . . . . . . . . . . . 141 40500. . . . . . . . . . . . . . . . . . . . . . . 195 47510. . . . . . . . . . . . . . . . . . . . . 65,.81 47520. . . . . . . . . . . . . . . . . . . . . 65,.81 47530. . . . . . . . . . . . . . . . . . . . . 65,.81 47540. . . . . . . . . . . . . . . . . . . . . 65,.81 48000. . . . . . . . . . . . . . . . . . . . . . . 179 48014. . . . . . . . . . . . . . . . . . . . . . . 179 48015. . . . . . . . . . . . . . . . . . . . . . . 179 48025. . . . . . . . . . . . . . . . . . . . . . . 179 48200. . . . . . . . . . . . . . . . . . . . . . . 179 48300. . . . . . . . . . . . . . . . . . . . . . . 179 56200. . . . . . . . . . . . . . . . . . . . . . . 220 56300. . . . . . . . . . . . . . . . . . . . . . . 220 58006. . . . . . . . . . . . . . . . . . . . . . . 215 58450. . . . . . . . . . . . . . . . . . . . . . . 215 59609. . . . . . . . . . . . . . . . . . . . . . . 222 75040. . . . . . . . . . . . . . . . . . . . . . . 177 75050. . . . . . . . . . . . . . . . . . . . . . . 177 75070. . . . . . . . . . . . . . . . . . . . . . . 175 77020. . . . . . . . . . . . . . . . . . . . . . . 119 83016. . . . . . . . . . . . . . . . . . . . . . . 116 89245. . . . . . . . . . . . . . . . . . . . . . . 207 89246. . . . . . . . . . . . . . . . . . . . . . . 207 89247. . . . . . . . . . . . . . . . . . . . . . . 207 89248. . . . . . . . . . . . . . . . . . . . . . . 207 89249. . . . . . . . . . . . . . . . . . . . . . . 207 89272. . . . . . . . . . . . . . . . . . . . . . . 207 89273. . . . . . . . . . . . . . . . . . . . . . . 207 89274. . . . . . . . . . . . . . . . . . . . . . . 207 89275. . . . . . . . . . . . . . . . . . . . . . . 207 89276. . . . . . . . . . . . . . . . . . . . . . . 207 89328. . . . . . . . . . . . . . . . . . . . . . . 220 89339. . . . . . . . . . . . . . . . . . . . . . . 220 89340. . . . . . . . . . . . . . . . . . . . . . . 220 89575. . . . . . . . . . . . . . . . . . . . . . . 221
91580. . . . . . . . . . . . . . . . . . . . . . . . 63 91736. . . . . . . . . . . . . . . . . . . . . . . . 19 100042. . . . . . . . . . . . . . . . . . . . 63,.66 100084. . . . . . . . . . . . . . . . . . . . . . . 63 300033. . . . . . . . . . . . . . . . . . . . . . 198 300035. . . . . . . . . . . . . . . . . . . . . . 188 300040. . . . . . . . . . . . . . . . . . . . . . 141 300051. . . . . . . . . . . . . . . . . . . . . . 222 300052. . . . . . . . . . . . . . . . . . . . . . 222 300102. . . . . . . . . . . . . . . . . . 100,.141 300276. . . . . . . . . . . . . . . . . . . . . . 169 300305. . . . . . . . . . . . . . . . . . . . . . . 72 500028. . . . . . . . . . . . . . . . . . . . . . 163 500075. . . . . . . . . . . . . . . . . . . . . . . 38 500076. . . . . . . . . . . . . . . . . . . . . . . 38 500077. . . . . . . . . . . . . . . . . . . . . . . 38 500081. . . . . . . . . . . . . . . . . . . . . . 141 500082. . . . . . . . . . . . . . . . . . . . . . 141 500085. . . . . . . . . . . . . . . . . . . . . . . 31 500086. . . . . . . . . . . . . . . . . . . . . . . 34 500121. . . . . . . . . . . . . . . . . . . . . . . 41 500128. . . . . . . . . . . . . . . . . . . . . . 141 500131. . . . . . . . . . . . . . . . . . 128,.141 500162. . . . . . . . . . . . . . . . . . . . . . 161 500184. . . . . . . . . . . . . . . . . . . . . . 141 500186. . . . . . . . . . . . . . . . . . . . . . 168 500191. . . . . . . . . . . . . . . . . . . . . . 193 500192. . . . . . . . . . . . . . . . . . . . . . 193 500193. . . . . . . . . . . . . . . . . . . . . . 193 500194. . . . . . . . . . . . . . . . . . . . . . 193 500195. . . . . . . . . . . . . . . . . . . . . . 193 500196. . . . . . . . . . . . . . . . . . . . . . 193 500197. . . . . . . . . . . . . . . . . . . . . . 193 500198. . . . . . . . . . . . . . . . . . . . . . 193 500199. . . . . . . . . . . . . . . . . . . . . . 193 500200. . . . . . . . . . . . . . . . . . . . . . 193 500201. . . . . . . . . . . . . . . . . . . . . . 193 500202. . . . . . . . . . . . . . . . . . . . . . 193 500203. . . . . . . . . . . . . . . . . . . . . . 193 500204. . . . . . . . . . . . . . . . . . . . . . 193 500205. . . . . . . . . . . . . . . . . . . . . . 193 500206. . . . . . . . . . . . . . . . . . . . . . 193 500207. . . . . . . . . . . . . . . . . . . . . . 193 500216. . . . . . . . . . . . . . . . . . . . . . . 35 500217. . . . . . . . . . . . . . . . . . . . . . . 35 500233. . . . . . . . . . . . . . . . . . . . . . . 31 500234. . . . . . . . . . . . . . . . . . . . . . . 32 500236. . . . . . . . . . . . . . . . . . . . . . . 37 500240. . . . . . . . . . . . . . . . . . . . . . . 37 500252. . . . . . . . . . . . . . . . . . . . . . . 41 500253. . . . . . . . . . . . . . . . . . . . . . . 41 500254. . . . . . . . . . . . . . . . . . . . . . . 41 500255. . . . . . . . . . . . . . . . . . . . . . . 41 500256. . . . . . . . . . . . . . . . . . . . . . 141 500257. . . . . . . . . . . . . . . . . . . . . . 141 500258. . . . . . . . . . . . . . . . . . . . . . 141 500259. . . . . . . . . . . . . . . . . . . . . . 141 500260. . . . . . . . . . . . . . . . . . . . . . . 34 500261. . . . . . . . . . . . . . . . . . . . . . 163 500262. . . . . . . . . . . . . . . . . . . . . . 163 500264. . . . . . . . . . . . . . . . . . . . . . 165 500266. . . . . . . . . . . . . . . . . . . . . . 165
PRODUCT INDEX
Prices shown are in U.S. dollars. Actual charges will vary because of import duty, freight, and currency fluctuations. To obtain an exact quotation, contact your WPI office. UK: Tel: 01438-880025..wpiuk@wpi-europe .com....Germany: Tel: 030-6188845..wpide@wpi-europe .com....China: Tel: 21.68885517..chinasales@china .wpiinc .com
Item
Page
Item
Page
Item
Page
Item
Page
500280. . . . . . . . . . . . . . . . . . . . . . 134 500282. . . . . . . . . . . . . . . . . . . . . . 184 500283. . . . . . . . . . . . . . . . . . . . . . 184 500292. . . . . . . . . . . . . . . . . ..175,.177 500299. . . . . . . . . . . . . . . . . . . . . . 198 500329. . . . . . . . . . . . . . . . . . . . . . 175 500330. . . . . . . . . . . . . . . . . . . . . . 128 500341. . . . . . . . . . . . . . . . . . . . . . . 31 500342. . . . . . . . . . . . . . . . . . . . . . . 31 500343. . . . . . . . . . . . . . . . . . . . . . . 37 500344. . . . . . . . . . . . . . . . . . . . . . . 37 500345. . . . . . . . . . . . . . . . . . . . . . . 37 500346. . . . . . . . . . . . . . . . . . . . . . . 37 500353. . . . . . . . . . . . . . . . . . . . . . . 37 500370. . . . . . . . . . . . . . . . . . . . . . . 40 500475. . . . . . . . . . . . . . . . . . 152,.153 500476. . . . . . . . . . . . . . . . . . 152,.153 500778. . . . . . . . . . . . . . . . . . . . . . 198 500871. . . . . . . . . . . . . . . . . . . . . . 157 500876. . . . . . . . . . . . . . . . . . . . . . 192 500877. . . . . . . . . . . . . . . . . . . . . . 192 500890. . . . . . . . . . . . . . . . . . . . . . 138 500895. . . . . . . . . . . . . . . . . . . . . . 138 501218. . . . . . . . . . . . . . . . . . . . . . . 36 501219. . . . . . . . . . . . . . . . . . . . . . . 36 501220. . . . . . . . . . . . . . . . . . . . . . . 36 501221. . . . . . . . . . . . . . . . . . . . . . . 36 501222. . . . . . . . . . . . . . . . . . . . . . . 36 501232. . . . . . . . . . . . . . . . . . . . . . . 34 501234. . . . . . . . . . . . . . . . . . . . . . . 34 501241. . . . . . . . . . . . . . . . . . . . . . . 33 501288. . . . . . . . . . . . . . . . . . . . . . . 33 501291. . . . . . . . . . . . . . . . . . . . . . . 33 501319. . . . . . . . . . . . . . . . . . . . . . . 40 501321. . . . . . . . . . . . . . . . . . . . . . 135 501331. . . . . . . . . . . . . . . . . . . . . . . 40 501336. . . . . . . . . . . . . . . . . . . . . . . 38 501352. . . . . . . . . . . . . . . . . . . . . . 165 501353. . . . . . . . . . . . . . . . . . . . . . 165 501367. . . . . . . . . . . . . . . . . . . . . . 165 501369. . . . . . . . . . . . . . . . . . . . . . 165 501370. . . . . . . . . . . . . . . . . . . . . . 165 501371. . . . . . . . . . . . . . . . . . . . . . 165 501372. . . . . . . . . . . . . . . . . . . . . . 165 501373. . . . . . . . . . . . . . . . . . . . . . 165 501375. . . . . . . . . . . . . . . . . . . . . . 165 501376. . . . . . . . . . . . . . . . . . . . . . 165 501377. . . . . . . . . . . . . . . . . . . . . . 165 501378. . . . . . . . . . . . . . . . . . . . . . 165 501379. . . . . . . . . . . . . . . . . . . . . . 165 501381. . . . . . . . . . . . . . . . . . . . . . 165 501601. . . . . . . . . . . . . . . . . . . . . . 135 501608. . . . . . . . . . . . . . . . . . . . . . . 56 501609. . . . . . . . . . . . . . . . . . 209,.215 501610. . . . . . . . . . . . . . . . . . . . . . 135 501622. . . . . . . . . . . . . .145,.146,.148 501623. . . . . . . . . . . . . . . . . . 146,.148 501624. . . . . . . . . . . . . . . . . . . . . . 146 501635. . . . . . . . . . . . . . . . . . . . . . 135 501636. . . . . . . . . . . . . . . . . . . . . . 161 501637. . . . . . . . . . . . . . . . . . . . . . 161 501638. . . . . . . . . . . . . . . . . . . . . . 161 501639. . . . . . . . . . . . . . . . . . . . . . 161 501640. . . . . . . . . . . . . . . . . . . . . . 161 501641. . . . . . . . . . . . . . . . . . . . . . . 74
501642. . . . . . . . . . . . . . . . . . . . . . . 74 501643. . . . . . . . . . . . . . . . . . . . . . . 74 501644. . . . . . . . . . . . . . . . . . . . 74,.77 501651. . . . . . . . . . . . . . . . . . . . . . 158 501652. . . . . . . . . . . . . . . . . . . . . . 158 501653. . . . . . . . . . . . . . . . . . . . . . 158 501656. . . . . . . . . . . . . . . . . . . . . . . 74 501657. . . . . . . . . . . . . . . . . . . . . . . 74 501658. . . . . . . . . . . . . . . . . . . . . . . 74 501669. . . . . . . . . . . . . . . . . . . . . . 161 501670. . . . . . . . . . . . . . . . . . . . . . 141 501705. . . . . . . . . . . . . . . . . . . . . . . 33 501714. . . . . . . . . . . . . . . . . . . . . . . 33 501715. . . . . . . . . . . . . . . . . . . . . . . 33 501728. . . . . . . . . . . . . . . . . . . . . . . 41 501729. . . . . . . . . . . . . . . . . . . . . . . 41 501743. . . . . . . . . . . . . . . . . . . . . . . 36 501753. . . . . . . . . . . . . . . . . . . . . . . 36 501754. . . . . . . . . . . . . . . . . . . . . . . 36 501755. . . . . . . . . . . . . . . . . . . . . . . 36 501756. . . . . . . . . . . . . . . . . . . . . . . 36 501757. . . . . . . . . . . . . . . . . . . . . . . 36 501758. . . . . . . . . . . . . . . . . . . . . . . 35 501759. . . . . . . . . . . . . . . . . . . . . . . 35 501778. . . . . . . . . . . . . . . . . . . . . . . 34 501839. . . . . . . . . . . . . . . . . . . . . . . 34 501842. . . . . . . . . . . . . . . . . . . . . . . 39 501851. . . . . . . . . . . . . . . . . . . . . . . 39 501852. . . . . . . . . . . . . . . . . . . . . . . 39 501853. . . . . . . . . . . . . . . . . . . . . . . 39 501854. . . . . . . . . . . . . . . . . . . . . . . 39 501855. . . . . . . . . . . . . . . . . . . . . . . 39 501856. . . . . . . . . . . . . . . . . . . . . . . 39 501857. . . . . . . . . . . . . . . . . . . . . . . 39 501858. . . . . . . . . . . . . . . . . . . . . . . 39 501862. . . . . . . . . . . . . . . . . . . . . . . 39 501863. . . . . . . . . . . . . . . . . . . . . . . 39 501864. . . . . . . . . . . . . . . . . . . . . . . 39 501889. . . . . . . . . . . . . . . . . . . . . . . 61 501890. . . . . . . . . . . . . . . . . . . . . . . 61 501891. . . . . . . . . . . . . . . . . . . . . . . 61 501985. . . . . . . . . . . . . . . . . . . . . . . 31 501986. . . . . . . . . . . . . . . . . . . . . . 134 502000. . . . . . . . . . . . . . . . . . . . . . 163 502001. . . . . . . . . . . . . . . . . . . . . . 163 502004. . . . . . . . . . . . . . . . . . 163,.165 502005. . . . . . . . . . . . . . . . . . 163,.165 502006. . . . . . . . . . . . . . . . . . . . . . 163 502007. . . . . . . . . . . . . . . . . . 163,.165 502009. . . . . . . . . . . . . . . . . . 163,.165 502010. . . . . . . . . . . . . . . . . . . . . . 163 502011. . . . . . . . . . . . . . . . . . . . . . 163 502012. . . . . . . . . . . . . . . . . . . . . . 163 502013. . . . . . . . . . . . . . . . . . . . . . 163 502015. . . . . . . . . . . . . . . . . . 163,.168 502016. . . . . . . . . . . . . . . . . . . . . . 163 502017. . . . . . . . . . . . . . . . . . . . . . 163 502018. . . . . . . . . . . . . . . . . . . . . . 163 502019. . . . . . . . . . . . . . . . . . . . . . 163 502040. . . . . . . . . . . . . . . . . . . . . . 173 502041. . . . . . . . . . . . . . . . . . . . . . 173 502053. . . . . . . . . . . . . . . . . . . . . . . 53 502054. . . . . . . . . . . . . . . . . . . . . . . 53 502055. . . . . . . . . . . . . . . . . . . . . . . 53 502056. . . . . . . . . . . . . . . . . . . . . . . 53
502060. . . . . . . . . . . . . . . . . . . . . . . 52 502062. . . . . . . . . . . . . . . . . . . . . . . 52 502063. . . . . . . . . . . . . . . . . . . . . . . 52 502067. . . . . . . . . . . . . . . . . . . . . . . 53 502068. . . . . . . . . . . . . . . . . . . . . . . 53 502070. . . . . . . . . . . . . . . . . . . . . . . 53 502102. . . . . . . . . . . . . . . . . . . . . . 146 502105. . . . . . . . . . . . . . . . . . . . . . 152 502109. . . . . . . . . . . . . . . . . . . . . . 203 502110. . . . . . . . . . . . . . . . . . . . . . 203 502119. . . . . . . . . . . . . . . . . . . . . . . 77 502120. . . . . . . . . . . . . . . . . . . . . . . 77 502122. . . . . . . . . . . . . . . . . . . . . . . 77 502124. . . . . . . . . . . . . . . . . . . . . . . 77 502125. . . . . . . . . . . . . . . . . . . . . . 203 502157. . . . . . . . . . . . . . . . . . . . . . 135 502160. . . . . . . . . . . . . . . . . . . . . . 162 502163. . . . . . . . . . . . . . . . . . 163,.165 502167. . . . . . . . . . . . . . . . . . . . . . 163 502168. . . . . . . . . . . . . . . . . . . . . . 163 502190. . . . . . . . . . . . . . . . . . . . . . 142 502191. . . . . . . . . . . . . . . . . . . . . . 142 502195. . . . . . . . . . . . . . . . . . . . . . . 48 502196. . . . . . . . . . . . . . . . . . . . . . . 48 502197. . . . . . . . . . . . . . . . . . . . . . . 48 502201. . . . . . . . . . . . . . . . . . . . . . 195 502204. . . . . . . . . . . . . . . . . . . . . . . 52 502210. . . . . . . . . . . . . . . . . . . . . . . 53 502213. . . . . . . . . . . . . . . . . . . . 52,.53 502224. . . . . . . . . . . . . . . . . . . . . . . 53 502225. . . . . . . . . . . . . . . . . . . . . . . 53 502226. . . . . . . . . . . . . . . . . . . . . . . 52 502227. . . . . . . . . . . . . . . . . . . . . . . 54 502228. . . . . . . . . . . . . . . . . . . . . . . 54 502229. . . . . . . . . . . . . . . . . . . . . . . 54 502230. . . . . . . . . . . . . . . . . . . . . . . 54 502231. . . . . . . . . . . . . . . . . . . . . . . 54 502232. . . . . . . . . . . . . . . . . . . . . . . 54 502233. . . . . . . . . . . . . . . . . . . . . . . 54 502234. . . . . . . . . . . . . . . . . . . . . . . 54 502235. . . . . . . . . . . . . . . . . . . . . . . 53 502236. . . . . . . . . . . . . . . . . . . . . . . 53 502237. . . . . . . . . . . . . . . . . . . . 39,.53 502238. . . . . . . . . . . . . . . . . . . . . . . 52 502241. . . . . . . . . . . . . . . . . . . . . . . 52 502242. . . . . . . . . . . . . . . . . . . . . . . 53 502243. . . . . . . . . . . . . . . . . . . . . . . 53 502244. . . . . . . . . . . . . . . . . . . . . . . 53 502245. . . . . . . . . . . . . . . . . . . . . . . 53 502600. . . . . . . . . . . . . . . . . . . . . . . 50 502603. . . . . . . . . . . . . . . . . . . . . . . 50 502650. . . . . . . . . . . . . . . . . . . . . . . 50 502653. . . . . . . . . . . . . . . . . . . . . . . 50 502859. . . . . . . . . . . . . . . . . . . . . . 198 502900. . . . . . . . . . . . . . . . . . . . . . . 51 502903. . . . . . . . . . . . . . . . . . . . . . . 51 502950. . . . . . . . . . . . . . . . . . . . . . . 51 502953. . . . . . . . . . . . . . . . . . . . . . . 51 503022. . . . . . . . . . . . . . . . . . . . . . 183 503023. . . . . . . . . . . . . . . . . . . . . . 183 503036. . . . . . . . . . . . . . . . . . . . . . 135 503041. . . . . . . . . . . . . . . . . . . . . . 143 503042. . . . . . . . . . . . . . . . . . . . . . 143 503049. . . . . . . . . . . . . . . . . . . . . . 183 503050. . . . . . . . . . . . . . . . . . . . . . 183
503051. . . . . . . . . . . . . . . . . . . . . . 165 503066. . . . . . . . . . . . . . . . . . . . . . 198 503067. . . . . . . . . . . . . . . . . . . . . . . 59 503070. . . . . . . . . . . . . . . . . . . . . . 142 503071. . . . . . . . . . . . . . . . . . . . . . 142 503072. . . . . . . . . . . . . . . . . . . . . . 142 503073. . . . . . . . . . . . . . . . . . . . . . 142 503075. . . . . . . . . . . . . . . . . . . . . . 142 503076. . . . . . . . . . . . . . . . . . . . . . 142 503077. . . . . . . . . . . . . . . . . . . . . . 142 503083. . . . . . . . . . . . . . . . . . . . . . 142 503084. . . . . . . . . . . . . . . . . . . . . . 142 503085. . . . . . . . . . . . . . . . . . . . . . 142 503086. . . . . . . . . . . . . . . . . . . . . . 143 503097. . . . . . . . . . . . . . . . . . . . . . 171 503098. . . . . . . . . . . . . . . . . . . . . . 171 503099. . . . . . . . . . . . . . . . . . . . . . 171 503120. . . . . . . . . . . . . . . . . . 183,.184 503121. . . . . . . . . . . . . . . . . . . . . . 184 503122. . . . . . . . . . . . . . . . . . . . . . 184 503235. . . . . . . . . . . . . . . . . . . . . . . 31 503259. . . . . . . . . . . . . . . . . . . . . . . 35 503260. . . . . . . . . . . . . . . . . . . . . . . 35 503294. . . . . . . . . . . . . . . . . . . . . . . 40 503505. . . . . . . . . . . . . . . . . . . . . . 173 503506. . . . . . . . . . . . . . . . . . . . . . 173 503507. . . . . . . . . . . . . . . . . . . . . . 173 503509. . . . . . . . . . . . . . . . . . . . . . 173 503510. . . . . . . . . . . . . . . . . . 166,.167 503511. . . . . . . . . . . . . . . . . . 166,.167 503512. . . . . . . . . . . . . . . . . . 166,.167 503513. . . . . . . . . . . . . . . . . . 167,.177 503514. . . . . . . . . . . . . . . . . . 167,.178 503524. . . . . . . . . . . . . . . . . . . . . . . 48 503529. . . . . . . . . . . . . . . . . . . . . . 131 503530. . . . . . . . . . . . . . . . . . . . . . 131 503531. . . . . . . . . . . . . . . . . . . . . . 131 503532. . . . . . . . . . . . . . . . . . . . . . 131 503537. . . . . . . . . . . . . . . . . . . . . . 131 503540. . . . . . . . . . . . . . . . . . . . . . . 19 503566. . . . . . . . . . . . . . . . . . . . . . . 28 503567. . . . . . . . . . . . . . . . . . . . . . . 53 503568. . . . . . . . . . . . . . . . . . . . . . 158 503569. . . . . . . . . . . . . . . . . . . . . . 158 503570. . . . . . . . . . . . . . . . . . . . . . 158 503571. . . . . . . . . . . . . . . . . . . . . . 158 503598. . . . . . . . . . . . . . . . . . . . 39,.53 503599. . . . . . . . . . . . . . . . . . . . 39,.53 503601. . . . . . . . . . . . . . . . . . . . . . . 55 503602. . . . . . . . . . . . . . . . . . . . . . . 55 503603. . . . . . . . . . . . . . . . . . . . . . . 55 503604. . . . . . . . . . . . . . . . . . . . . . . 55 503605. . . . . . . . . . . . . . . . . . . . . . . 55 503608. . . . . . . . . . . . . . . . . . . . . . . 55 503610. . . . . . . . . . . . . . . . . . . . . . . 55 503613. . . . . . . . . . . . . . . . . . . . . . 202 503666. . . . . . . . . . . . . . . . . . . . . . . 35 503667. . . . . . . . . . . . . . . . . . . . . . . 35 503668. . . . . . . . . . . . . . . . . . . . . . . 35 503669. . . . . . . . . . . . . . . . . . . . . . . 35 503670. . . . . . . . . . . . . . . . . . . . . . . 35 503671. . . . . . . . . . . . . . . . . . . . . . . 35 600009. . . . . . . . . . . . . . . . . . . . . . 133 600011. . . . . . . . . . . . . . . . . . . . 63,.66 600012. . . . . . . . . . . . . . . . . . . . 63,.66 225
PRODUCT INDEX
Item
Page
Item
Page
Item
Page
Item
Page
600015. . . . . . . . . . . . . . . . . . . . . . . 63 600016. . . . . . . . . . . . . . . . . . . . . . . 63 800100. . . . . . . . . . . . . . . . . . . . . . . 70 800120. . . . . . . . . . . . . . . . . . . . . . 213 800283. . . . . . . . . . . . . . . . . . . . . . 136 Tip. . . . . . . . . . . . . . . . . . . . . . . . . 122 1300M. . . . . . . . . . . . . . . . . . . . . . . 178 13156-100 . . . . . . . . . . . . . . . . . . . 139 13157-100 . . . . . . . . . . . . . . . . . . . 139 13158-100 . . . . . . . . . . . . . . . . . . . 139 13159-100 . . . . . . . . . . . . . . . . . . . 139 13160-100 . . . . . . . . . . . . . . . . . . . 139 13161-100 . . . . . . . . . . . . . . . . . . . 139 13162-100 . . . . . . . . . . . . . . . . . . . 139 13163-100 . . . . . . . . . . . . . . . . . . . 139 1350M. . . . . . . . . . . . . . . . . . . . . . . 178 13822-10 . . . . . . . . . . . . . . . . . . . . 139 14003-G . . . . . . . . . . . . . . . . . . . . . . 34 14034-40 . . . . . . . . . . . . . . . . . . . . 139 14035-10 . . . . . . . . . . . . . . . . . . . . 139 14036-15 . . . . . . . . . . . . . . . . . . . . 139 14038-10 . . . . . . . . . . . . . . . . . . . . 139 14039-10 . . . . . . . . . . . . . . . . . . . . 139 14040-50 . . . . . . . . . . . . . . . . . . . . 139 14041-60 . . . . . . . . . . . . . . . . . . . . 139 14042-100 . . . . . . . . . . . . . . . . . . . 139 14043-20 . . . . . . . . . . . . . . . . . . . . 139 14044-5 . . . . . . . . . . . . . . . . . . . . . 139 14045-20 . . . . . . . . . . . . . . . . . . . . 139 14047-10 . . . . . . . . . . . . . . . . . . . . 139 14048-20 . . . . . . . . . . . . . . . . . . . . 139 14051-100 . . . . . . . . . . . . . . . . . . . 139 14054-10 . . . . . . . . . . . . . . . . . . . . 139 14055-2 . . . . . . . . . . . . . . . . . . . . . 139 14057-10 . . . . . . . . . . . . . . . . . . . . 139 14058-10 . . . . . . . . . . . . . . . . . . . . 139 14059-2 . . . . . . . . . . . . . . . . . . . . . 139 14061-60 . . . . . . . . . . . . . . . . . . . . 139 14073-4 . . . . . . . . . . . . . . . . . . . . . 143 14109-G . . . . . . . . . . . . . . . . . . . . . . 36 14119-G . . . . . . . . . . . . . . . . . . . . . . 37 14122-G . . . . . . . . . . . . . . . . . . . . . . 34 14124-G . . . . . . . . . . . . . . . . . . . . . . 34 14125-G . . . . . . . . . . . . . . . . . . . . . . 34 14130-G . . . . . . . . . . . . . . . . . . . . . . 37 14192-G . . . . . . . . . . . . . . . . . . . . . . 36 14218-G . . . . . . . . . . . . . . . . . . . . . . 35 14219-G . . . . . . . . . . . . . . . . . . . . . . 35 14226-G . . . . . . . . . . . . . . . . . . . . . . 33 14393-G . . . . . . . . . . . . . . . . . . . . . . 35 14394-G . . . . . . . . . . . . . . . . . . . . . . 35 15914-G . . . . . . . . . . . . . . . . . . . . . . 33 15915-G . . . . . . . . . . . . . . . . . . . . . . 33 15920-G . . . . . . . . . . . . . . . . . . . . . . 33 15921-G . . . . . . . . . . . . . . . . . . . . . . 33 15922-G . . . . . . . . . . . . . . . . . . . . . . 35 15923-G . . . . . . . . . . . . . . . . . . . . . . 35 1B100-3 . . . . . . . . . . . . . . . . . . . . . 118 1B100-4 . . . . . . . . . . . . . . . . . . . . . 118 1B100-6 . . . . . . . . . . . . . . . . . . . . . 118 1B100F-3. . . . . . . . . . . . . . . . . . . . . 118 1B100F-4. . . . . . . . . . . . . . . . . . . . . 118 1B100F-6. . . . . . . . . . . . . . . . . . . . . 118 1B120. . . . . . . . . . . . . . . . . . . . . . . 118 1B120-4 . . . . . . . . . . . . . . . . . . . . . 118 226
1B120-6 . . . . . . . . . . . . . . . . . . . . . 118 1B120F-3. . . . . . . . . . . . . . . . . . . . . 118 1B120F-4. . . . . . . . . . . . . . . . . . . . . 118 1B120F-6. . . . . . . . . . . . . . . . . . . . . 118 1B150-3 . . . . . . . . . . . . . . . . . . . . . 118 1B150-4 . . . . . . . . . . . . . . . . . . . . . 118 1B150-6 . . . . . . . . . . . . . . . . . . . . . 118 1B150F-3. . . . . . . . . . . . . . . . . . . . . 118 1B150F-4. . . . . . . . . . . . . . . . . . . . . 118 1B150F-6. . . . . . . . . . . . . . . . . . . . . 118 1B200-4 . . . . . . . . . . . . . . . . . . . . . 118 1B200F-4. . . . . . . . . . . . . . . . . . . . . 118 1B200F-6. . . . . . . . . . . . . . . . . . . . . 118 2026-10 . . . . . . . . . . . . . . . . . . . . . 141 2B150F-4. . . . . . . . . . . . . . . . . . . . . 120 2B150F-6. . . . . . . . . . . . . . . . . . . . . 120 3417-10 . . . . . . . . . . . . . . . . . . . . . 141 3579-20 . . . . . . . . . . . . . . . . . . . . . . 27 3742-20 . . . . . . . . . . . . . . . . . . . . . 139 3B120F-4. . . . . . . . . . . . . . . . . . . . . 120 3B120F-6. . . . . . . . . . . . . . . . . . . . . 120 4-.or.7-Barrel.Pipette.Puller. . . . . . . 180 500216-G . . . . . . . . . . . . . . . . . . . . . 35 500217-G . . . . . . . . . . . . . . . . . . . . . 35 500236-G . . . . . . . . . . . . . . . . . . . . . 37 500239-500248. . . . . . . . . . . . . . . . 37 500260-G . . . . . . . . . . . . . . . . . . . . . 34 500348-500356. . . . . . . . . . . . . . . . 37 501218-G . . . . . . . . . . . . . . . . . . . . . 36 501219-G . . . . . . . . . . . . . . . . . . . . . 36 501220-G . . . . . . . . . . . . . . . . . . . . . 36 501221-G . . . . . . . . . . . . . . . . . . . . . 36 501222-G . . . . . . . . . . . . . . . . . . . . . 36 501234-G . . . . . . . . . . . . . . . . . . . . . 34 501241-G . . . . . . . . . . . . . . . . . . . . . 33 501288-G . . . . . . . . . . . . . . . . . . . . . 33 501291-G . . . . . . . . . . . . . . . . . . . . . 33 501705-G . . . . . . . . . . . . . . . . . . . . . 33 501714-G . . . . . . . . . . . . . . . . . . . . . 33 501715-G . . . . . . . . . . . . . . . . . . . . . 33 501743-G . . . . . . . . . . . . . . . . . . . . . 36 501753-G . . . . . . . . . . . . . . . . . . . . . 36 501754-G . . . . . . . . . . . . . . . . . . . . . 36 501755-G . . . . . . . . . . . . . . . . . . . . . 36 501756-G . . . . . . . . . . . . . . . . . . . . . 36 501757-G . . . . . . . . . . . . . . . . . . . . . 36 501758-G . . . . . . . . . . . . . . . . . . . . . 35 501759-G . . . . . . . . . . . . . . . . . . . . . 35 501850-501858. . . . . . . . . . . . . . . . 39 501860-501864. . . . . . . . . . . . . . . . 39 501888-501891. . . . . . . . . . . . . . . . 61 501976-6 . . . . . . . . . . . . . . . . . . . . . 32 501979-6 . . . . . . . . . . . . . . . . . . . . . 32 501981-6 . . . . . . . . . . . . . . . . . . . . . 32 502193-4 . . . . . . . . . . . . . . . . . . . . 143 503078-4 . . . . . . . . . . . . . . . . . . . . 143 503079-4 . . . . . . . . . . . . . . . . . . . . 143 503080-4 . . . . . . . . . . . . . . . . . . . . 143 503081-4 . . . . . . . . . . . . . . . . . . . . 142 503082-4 . . . . . . . . . . . . . . . . . . . . 143 503088-10 . . . . . . . . . . . . . . . . . . . 142 555830L . . . . . . . . . . . . . . . . . . . . . . 61 555831L . . . . . . . . . . . . . . . . . . . . . . 61 555833L . . . . . . . . . . . . . . . . . . . . . . 61 555834L . . . . . . . . . . . . . . . . . . . . . . 61
555835L . . . . . . . . . . . . . . . . . . . . . . 61 555836L . . . . . . . . . . . . . . . . . . . . . . 61 555920A. . . . . . . . . . . . . . . . . . . . . . 61 555938A. . . . . . . . . . . . . . . . . . . . . . 61 5B120F-4. . . . . . . . . . . . . . . . . . . . . 120 5B120F-6. . . . . . . . . . . . . . . . . . . . . 120 711P . . . . . . . . . . . . . . . . . . . . 103,.178 712P . . . . . . . . . . . . . . . . . . . . . . 86,.87 715P . . . . . . . . . . . . . . . . . . . . . ..86,.87 7600S . . . . . . . . . . . . . . . . . . . . . 28,.29 7B100F-4. . . . . . . . . . . . . . . . . . . . . 120 7B120F-4. . . . . . . . . . . . . . . . . . . . . 120 8-Channel.Digital.Stimulator . . . . . . 114 900A . . . . . . . . . . . . . . . . . . . . . . . . 104 900AP. . . . . . . . . . . . . . . . . . . . . . . 104 900APP. . . . . . . . . . . . . . . . . . . . . . 104
Audible.Baseline.Monitor. . . . . . . . . . 93 Automated.TEER.Measuring.System. . 22 AUWxxxx. . . . . . . . . . . . . . . . . . . . . 137
B
B203MC4. . . . . . . . . . . . . . . . . . . . . 198 B203XV. . . . . . . . . . . . . . . . . . . . . . 198 Ball.Bearing.Boom.Stand. . . . . 163,.165 Ball.Joint,.Magnetic . . . . . . . . . . . . . 157 Ball-joint.holder.attachment. . . . . . . 153 Banaji.Cannula. . . . . . . . . . . . . . . . . . 61 Barb-to-Tubing.Coupler .. .. .. .. .. .. .. .. .. ..138 Base. . . . . . . . . . . . . . . . . . . . . . . . . 142 base.plate. . . . . . . . . . . . . . . . . . . . . 158 Base,.Magnetic. . . . . . . . . . . . . . . . . 156 BAT-10R/LOP. . . . . . . . . . . . . . . . . . . 56 BAT-12R. . . . . . . . . . . . . . . . . . . . . . . 56 Bath.Chamber. . . . . . . . . . . . . . . . . . . 28 Battery.Charger . . . . . . . . . . . ..110,.112 Battery,.NiMH. . . . . . . . . . . . . . . . . . . 91 BEECAL .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 78 Beetrode. . . . . . . . . . . . . . . . . . . . . . . 78 BetterSkin.Electrodes. . . . . . . . . . . 128 Beveler,.Micropipette . . . . . . . . . . . . 178 Biaxial.Test.System. . . . . . . . . . . . . . . 16 BIF22. . . . . . . . . . . . . . . . . . . . . . . . 223 BIF41. . . . . . . . . . . . . . . . . . . . . . . . 223 BIF44. . . . . . . . . . . . . . . . . . . . . . . . 223 BIF62. . . . . . . . . . . . . . . . . . . . . . . . 223 BIF66. . . . . . . . . . . . . . . . . . . . . . . . 223 Bifurcated.Fiber. . . . . . . . . . . . . . . . 223 . Bifurcated.Light.Guide . . . . . . . . . . . 168 Bio.Photometric.Detection.System . . 206 Bio-amplifier. . . . . . . . . . . . . . . . . . . 90 . Biosensing. . . . . . . . . . . . . . . . . . . . . 62 BioTester.5000. . . . . . . . . . . . . . . . . . 16 Bipolar.Electrodes. . . . . . . . . . . . . . . 100 bipolar.stimulation. . . . . . . . . . . . . . 100 BLADES . . . . . . . . . . . . . . . . . . . . . . . 28 Blades,.single.edge . . . . . . . . . . . . . . 28 Blood.Pressure. . . . . . . . . . . . . . . . . . 58 Blood.Pressure.Monitor . . . . . . . . . . . 59 BLOOD.PRESSURE.TRANSDUCER. . . 59 BLPR2 . . . . . . . . . . . . . . . . . . . . . . . . 59 Boom.Stand. . . . . . . . . . . . . . . 163,.165 Borosilicate. . . . . . . . . . . .118,.120,.122 BP1 . . . . . . . . . . . . . . . . . . . . . . . . . . 59 BPCABLE2 . . . . . . . . . . . . . . . . . . . . . 59 Brackets. . . . . . . . . . . . . . . . . . . . . . 136 Brain.Matrices . . . . . . . . . . . . . . . . . . 29 Bridge.Amplifier. . . . . . . . . . . . . . . 6,.95 BT-1. . . . . . . . . . . . . . . . . . . . . . . . . . 57 Buffer.Solutions . . . . . . . . . . . . . . . . . 79 Buffer.Temperature.Sensor. . . 10,.11,.13 Bulldog.Clamps . . . . . . . . . . . . . . . . . 37 Buratto.Cannula. . . . . . . . . . . . . . . . . 61
A
A300.Pulsemaster . . . . . . . . . . . . . . 108 A310.Accupulser . . . . . . . . . . . . . . . 107 A320D. . . . . . . . . . . . . . . . . . . . . . . 110 A320R. . . . . . . . . . . . . . . . . . . . . . . 110 A362 . . . . . . . . . . . . . . . . . . . ..110,.113 A365D. . . . . . . . . . . . . . . . . . . . . . . 111 A365R. . . . . . . . . . . . . . . . . . . . . . . 111 A382 . . . . . . . . . . . . . . . . . . . . . . . . 112 A385 . . . . . . . . . . . . . . . . . . . . . . . . 112 A385R. . . . . . . . . . . . . . . . . . . . . . . 112 A385RC. . . . . . . . . . . . . . . . . . . . . . 112 A395 . . . . . . . . . . . . . . . . . . . . . . . . 113 A395D. . . . . . . . . . . . . . . . . . . . . . . 113 A395R. . . . . . . . . . . . . . . . . . . . . . . 113 ABM. . . . . . . . . . . . . . . . . . . . . . . . . . 93 Accupulser.Signal.Generator . . . . . 107 Action.Potential.Sensor. . . . . . 10,.11,.13 action.potentials. . . . . . . . . . . . . . . . 102 Adhesives. . . . . . . . . . . . . . . . . 132,.133 Adjustable.Pipetters. . . . . . . . . . . . . 192 ADPT2.Footswitch . . . . . . . . . . . . . . 185 Ag/AgCl.Half-Cells . . . . . . . . . . 103,.129 AGTxxxx. . . . . . . . . . . . . . . . . . . . . . 137 AGWxxxx. . . . . . . . . . . . . . . . . . . . . 137 Air-Therm. . . . . . . . . . . . . . . . . . . . . 169 AL1000 . . . . . . . . . . . . . . . . . . . . . . 185 AL2000 . . . . . . . . . . . . . . . . . . . . . . 185 Aladdin.Syringe.Pumps . . . . . . . . . . 185 allodynia . . . . . . . . . . . . . . . . . . . . . . 44 Alumina.Abrasive. . . . . . . . . . . . . . . 178 Amperametric.Amplifier . . . . . . . . . . . 97 Amplifier.Selection.Guide. . . ..83,.95,.97 amplitude.discriminator. . . . . . . . . . 102 Analgesia. . . . . . . . . . . . . . . . . . . . . . 45 Analgesia.Meter. . . . . . . . . . . . . . 46,.47 Anesthesia. . . . . . . . . . . . . . . . . . . . . 42 Anesthesiometer. . . . . . . . . . . . . . . . . 44 Angled.Electrode.Holder. . . . . . . . . . 152 Animal.Temperature.Controller. . . . . . 48 Anti-Oscillation.Module . . . . . . . . . . . 96 Anti-oscillation.unit . . . . . . . . . . . . . . . 5 APEH1. . . . . . . . . . . . . . . . . . . . . . . 124 APEH2. . . . . . . . . . . . . . . . . . . . . . . 124 Apollo.1000. . . . . . . . . . . . . . . . . . . . 67 Articulated.Arm . . . . . . . . . . . . 163,.165 ATC1000 . . . . . . . . . . . . . . . . . . . . . . 48 ATPase.Activity. . . . . . . . . . . . . . . . . . . 8
PRODUCT INDEX
C
C3005 . . . . . . . . . . . . . . . . . . . . . . . 137 Cables.and.Connectors. . . . . . . . . . . 140 CAL900A . . . . . . . . . . . . . . . . . . . . . 104 CALBUF-1. . . . . . . . . . . . . . . . . . . . . . 79 CALBUF-2. . . . . . . . . . . . . . . . . . . . . . 79 Calcium.Calibration.Solutions. . . . . . . 79
Item
Page
Item
Page
Item
Page
Item
Page
Calcium.Electrode. . . . . . . . . . . . . . . . 80 CaliCell .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 20 Caliper,.Digital. . . . . . . . . . . . . . . . . 135 Cannula,.Micro. . . . . . . . . . . . . . . . . 122 Cannulae . . . . . . . . . . . . . . . . . . . . . . 61 Carbon.Epoxy. . . . . . . . . . . . . . . . . . 133 Carbon.fiber.microelectrodes .. .. .. .. .. .. .. 73 Carbon.Wire. . . . . . . . . . . . . . . . . . . 137 cartridge.electrodes . . . . . . . . . . . . . . 24 CBL100 . . . . . . . . . . . . . . . . . . . . . . 141 CBL102 . . . . . . . . . . . . . . . . . . . . . . 141 CC-3-UV. . . . . . . . . . . . . . . . . . . . . . 222 CCD.Video.Camera. . . . . . . . . . . . . . 171 Cell.culture.cups. . . . . . . . . . . . . . . . . 20 Cellular.&.Tissue.Research. . . . . . . . . 18 CF10 .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 73 CF30 .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 73 CFN10-xxx. . . . . . . . . . . . . . . . . . . . . 73 CFN30-xxx. . . . . . . . . . . . . . . . . . . . . 73 Chamber,.Measurement . . . . . . . . . . . 70 CHM1. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM2. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM3. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM4. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM5. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM5M12. . . . . . . . . . . . . . . . . . . . . 27 CHM6. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM7. . . . . . . . . . . . . . . . . . . . . . . . . 27 CHM8. . . . . . . . . . . . . . . . . . . . . . . . . 27 Circulation.Reservoirs. . . . . . . . . . . . . 27 clamp. . . . . . . . . . . . . . . . . . . . . . . . 153 Clamps. . . . . . . . . . . . . . . . . . . . . . . 142 Clear.hose . . . . . . . . . . . . . . . . . . . . 169 ClickPet.Repeating.Pipetters. . . . . . . 191 Clip.Applier . . . . . . . . . . . . . . . . . . . . 37 Clips.and.Clamps. . . . . . . . . . . . . . . . 37 CMF20GxxL. . . . . . . . . . . . . . . . . . . 131 CMF22GxxL. . . . . . . . . . . . . . . . . . . 131 CMF23GxxL. . . . . . . . . . . . . . . . . . . 131 CMF26GxxL. . . . . . . . . . . . . . . . . . . 131 CMF28GxxL. . . . . . . . . . . . . . . . . . . 131 CMF31GxxL. . . . . . . . . . . . . . . . . . . 131 CMF34GxxL. . . . . . . . . . . . . . . . . . . 131 CMF35GxxL. . . . . . . . . . . . . . . . . . . 131 CMF90UxxL. . . . . . . . . . . . . . . . . . . 131 C-Mount. . . . . . . . . . . . . . . . . . . . . . 165 C-Mount.Eyepiece.Adapters . . . . . . . 171 CO2.Analyzer. . . . . . . . . . . . . . . . . . . 49 Coaxial.cables,.micro . . . . . . . . . . . . 137 COLCAM. . . . . . . . . . . . . . . . . . . . . . 171 COLLIMATOR . . . . . . . . . . . . . . . . . . 222 Color.Video.Camera . . . . . . . . . . . . . 171 Combination.pH.electrode. . . . . . . . . . 78 Compact.Langendorff . . . . . . . . . . . . . 12 Compact.Magnetic.Stand . . . . . . . . . 158 Compression. . . . . . . . . . . . . . . . . . . . 17 Concentric.Bipolar.Electrodes . . . . . . 100 Conductive.Electrode.Gel . . . . . . . . . 128 Constant.load.unit . . . . . . . . . . . . . . . . 5 Copper.Alloy.Wire .. .. .. .. .. .. .. .. .. .. .. .. .. ..137 Cover.Slips. . . . . . . . . . . . . . . . . . . . 173 CP-100. . . . . . . . . . . . . . . . . . . . . . . 191 CP-25. . . . . . . . . . . . . . . . . . . . . . . . 191 CP-250. . . . . . . . . . . . . . . . . . . . . . . 191 CP-5. . . . . . . . . . . . . . . . . . . . . . . . . 191
CPVCxxxxx. . . . . . . . . . . . . . . . . . . . 137 Crystal.Pipetters. . . . . . . . . . . . . . . . 191 CS-BIOTESTER5000. . . . . . . . . . . . . . 16 CS-MECHANOCULTURE . . . . . . . . . . . 17 CS-MICROSQUISHER. . . . . . . . . . . . . 17 CU7T44G. . . . . . . . . . . . . . . . . . . . . 137 Current.Clamp .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..24,.25 Current.Electrode . . . . . . . . . . . . . . . . 24 Current.Generator. . . . . . . . . . . . . . . . 93 Current.Sources . . . . . . . . . . . . . . . . 111 Cuvette.Holders,.High.Precision . . . . 220 Cuvettes. . . . . . . . . . . . . . . . . . . . . . 219 CW-MICROCAPSTAR. . . . . . . . . . . . . . 49 CW-MRI-1 . . . . . . . . . . . . . . . . . . . . . 49 CW-SAR-830/AP. . . . . . . . . . . . . . . . 49 .
Dual.Microiontophoresis.Current . . . . 93 Dual.Microprobe.System. . . . . . . . . . . 86 Dual.Tool-Holder.Micromanipulator. 155 Dummy.Load.Resistor.Kit. . . . . . . . . 111 Dummy.Membrane. . . . . . . . . . . . . . . 25 Duo.773. . . . . . . . . . . . . . . . . . . . . . 86 . DVC1000. . . . . . . . . . . . . . . . . . . . . . 25 DVC2. . . . . . . . . . . . . . . . . . . . . . . . . 25 DVC3. . . . . . . . . . . . . . . . . . . . . . . . . 25
E
E210 . . . . . . . . . . . . . . . . . . . . . . . . 121 E212 . . . . . . . . . . . . . . . . . . . . . . . . 121 E215 . . . . . . . . . . . . . . . . . . . . . . . . 121 E220 . . . . . . . . . . . . . . . . . . . . . . . . 121 E-28000. . . . . . . . . . . . . . . . . . . . . . 43 . Eagle.Pipetters. . . . . . . . . . . . . . . . . 192 Ear.Bars,.Stereotaxic. . . . . . . . . . . . . . 53 Ear.Punch. . . . . . . . . . . . . . . . . . . . . . 38 Economy.Manual.Micromanipulator. 152 Economy.Tweezers. . . . . . . . . . . . . . . 32 EHB1. . . . . . . . . . . . . . . . . . . . . . . . 124 EHBF . . . . . . . . . . . . . . . . . . . . . . . . 124 EJA. . . . . . . . . . . . . . . . . . . . . . . . . . 168 EK1 . . . . . . . . . . . . . . . . . . . . 24,.25,.27 EKC . . . . . . . . . . . . . . . . . . . . . . . 25,.27 EKV . . . . . . . . . . . . . . . . . . . . 24,.25,.27 EL203 . . . . . . . . . . . . . . . . . . . . . . . 128 EL204 . . . . . . . . . . . . . . . . . . . . . . . 128 EL204D . . . . . . . . . . . . . . . . . . . . . . 128 EL204S. . . . . . . . . . . . . . . . . . . . . . 128 . EL208 . . . . . . . . . . . . . . . . . . . . . . . 128 EL208D . . . . . . . . . . . . . . . . . . . . . . 128 EL208WD. . . . . . . . . . . . . . . . . . . . . 128 EL208WS. . . . . . . . . . . . . . . . . . . . . 128 EL212 . . . . . . . . . . . . . . . . . . . . . . . 128 Electro.705. . . . . . . . . . . . . . . . . . . . . 85 Electrochemical.measurements. . . . . . 84 Electrolyte,.ISO2. . . . . . . . . . . . . . . . . 76 Electrolyte,.ISO-NO. . . . . . . . . . . . . . . 64 Electrometer. . . . . . . . . . . . . . . . ..84,.85 Elgiloy.Microelectrodes. . . . . . . . . . . 100 ELS-370. . . . . . . . . . . . . . . . . . . . . . 213 ELS-xxx . . . . . . . . . . . . . . . . . . . . . . 213 ENDOHM-12. . . . . . . . . . . . . . . . . . . 21 ENDOHM-24SNAP. . . . . . . . . . . . . . . 21 ENDOHM-6. . . . . . . . . . . . . . . . . . . . 21 Endohm. . . . . . . . . . . . . . . . . . . . . . 21 EP05 . . . . . . . . . . . . . . . . . . . . 103,.129 EP08 . . . . . . . . . . . . . . . . . . . . 103,.129 EP1 . . . . . . . . . . . . . . . . . . . . . 103,.129 EP12 . . . . . . . . . . . . . . . . . . . . 103,.129 EP2 . . . . . . . . . . . . . . . . . . . . . 103,.129 EP4 . . . . . . . . . . . . . . . . . . . . . 103,.129 EP8 . . . . . . . . . . . . . . . . . . . . . 103,.129 Epithelial.Voltohmmeter. . . . . . . . . . . 19 Epoxy. . . . . . . . . . . . . . . . . . . . 132,.133 Ergometer. . . . . . . . . . . . . . . . . . . . . . . 5 ES5. . . . . . . . . . . . . . . . . . . . . . . . . 192 . ES6. . . . . . . . . . . . . . . . . . . . . . . . . 192 . ES7. . . . . . . . . . . . . . . . . . . . . . . . . 192 . Euthanex.Gasket.Kit. . . . . . . . . . . . . . 43 Euthanex.Lids. . . . . . . . . . . . . . . . . . . 43 EVC3 . . . . . . . . . . . . . . . . . . . . . . . . . 24 EVC4000 . . . . . . . . . . . . . . . . . . . . . . 24
D
D2H. . . . . . . . . . . . . . . . . . . . . . . . . 212 D2H-DB. . . . . . . . . . . . . . . . . . . . . . 212 D2H-HB. . . . . . . . . . . . . . . . . . . . . . 212 D2H-HBER. . . . . . . . . . . . . . . . . . . . 212 DAM.Series.Bioamplifiers. . . . . . . . . . 90 Dam50. . . . . . . . . . . . . . . . . . . . . . . . 90 Dam80. . . . . . . . . . . . . . . . . . . . . . . . 91 DAM80P. . . . . . . . . . . . . . . . . . . . . . . 91 Data.acquisition/analysis.system. . . . . 5 DC3001L. . . . . . . . . . . . . . . . . . . . . 149 DC3001R. . . . . . . . . . . . . . . . . . . . . 149 DC3314L. . . . . . . . . . . . . . . . . . . . . 149 DC3314R. . . . . . . . . . . . . . . . . . . . . 149 DCAP. . . . . . . . . . . . . . . . . . . . . . . . . 39 DCAP-L. . . . . . . . . . . . . . . . . . . . . . . . 39 DCAP-M. . . . . . . . . . . . . . . . . . . . . . . 39 Deuterium.halogen.light. . . . . . . . . . 212 Differential.Electrometer. . . . . . . . . . . 84 Digital..Linear.Stimulus.Isolator. . . . 116 Digital.Caliper . . . . . . . . . . . . . . . . . 135 Digital.Display.Stereotaxic.Instr. . . . . 51 Digital.Micrometer. . . . . . . . . . . . . . 135 Digital.Micrometer.Head. . . . . . . . . . 146 Digital.Microscope.Camera. . . . . . . . 170 Digital.Stimulator. . . . . . . . . . . . . . . 114 DIP-NIRx. . . . . . . . . . . . . . . . . . . . . 217 Dipping.probe . . . . . . . . . . . . . . . . . 217 DIP-UV-SRx. . . . . . . . . . . . . . . . . . . 217 Disposable.Ag/AgCl.Snap.Electrodes.128 Dissecting.Kit. . . . . . . . . . . . . . . . . . . 38 Dissecting.Pad.Kit . . . . . . . . . . . . . . 134 Dissecting.Scissors. . . . . . . . . . . . . . . 35 Dissolved.oxygen.meter. . . . . . . . . . . 76 DLS100 . . . . . . . . . . . . . . . . . . . . . . 116 DMF1000. . . . . . . . . . . . . . . . . . . . 176 . DMF1000-H5. . . . . . . . . . . . . . . . . . 177 DMP. . . . . . . . . . . . . . . . . . . . . . . . . 199 DRIREF-2. . . . . . . . . . . . . . . . . . . . . . 79 DRIREF-2SH. . . . . . . . . . . . . . . . . . . . 79 DRIREF-450. . . . . . . . . . . . . . . . . . . . 79 DRIREF-5. . . . . . . . . . . . . . . . . . . . . . 79 DRIREF-5SH. . . . . . . . . . . . . . . . . . . . 79 DRIREF-L. . . . . . . . . . . . . . . . . . . . . . 79 Dri-Ref. . . . . . . . . . . . . . . . . . . . . . . 79 Driven.guard.shield . . . . . . . . . . ..85,.87 DRL . . . . . . . . . . . . . . . . . . . . . . . . . 111 Dry.Sterilizer . . . . . . . . . . . . . . . . . . . 41 DS8000. . . . . . . . . . . . . . . . . ..114,.115
EVOM2. . . . . . . . . . . . . . . . . . . . . . . . 19 EXT-6. . . . . . . . . . . . . . . . . . . . . . . . . 56 Extracellular.Bio-Amplifier . . . . . . . . . 96 Extracellular.recording . . . . . . . . . . . . 90 Eyepiece.Adapter,.SLR .. .. .. .. .. .. .. .. .. .. ..171 Eyepieces. . . . . . . . . . . . . . . . . 163,.165 EZ.Anesthesia. . . . . . . . . . . . . . . . . . . 42 EZ-103A. . . . . . . . . . . . . . . . . . . . . . . 43 EZ-104A. . . . . . . . . . . . . . . . . . . . . . . 43 EZ-107A. . . . . . . . . . . . . . . . . . . . . . . 43 EZ-109. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-1130. . . . . . . . . . . . . . . . . . . . . . . 43 EZ-169. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-200xx. . . . . . . . . . . . . . . . . . . . . . 43 EZ-211. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-212. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-25000. . . . . . . . . . . . . . . . . . . . . . 43 EZ-27000. . . . . . . . . . . . . . . . . . . . . . 43 EZ-320. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-330. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-7000. . . . . . . . . . . . . . . . . . . . . . . 42 EZ-830. . . . . . . . . . . . . . . . . . . . . . . . 43 EZ-B800. . . . . . . . . . . . . . . . . . . . . . . 43 EZ-FF900. . . . . . . . . . . . . . . . . . . . . . 42
F
FD223A. . . . . . . . . . . . . . . . . . . . . . . 84 FD223AP. . . . . . . . . . . . . . . . . . . . . . 84 FD35-100 . . . . . . . . . . . . . . . . . . . . 172 FD3510-100 . . . . . . . . . . . . . . . . . . 172 FD35B-100 . . . . . . . . . . . . . . . . . . . 173 FD35COL-100 . . . . . . . . . . . . . 172,.173 FD35PDL-100 . . . . . . . . . . . . . . . . . 172 FD5040-100 . . . . . . . . . . . . . . . . . . 172 Fiber.Optic.Adapter. . . . . . . . . . . . . . 222 Fiber.Optic.Cables. . . . . . . . . . . 222,.223 Fiber.Optic.Collimator. . . . . . . . . . . . 222 Fiber.Optic.Filter.Holder. . . . . . . . . . 220 Fiber.Optic.Illuminator . . . . . . . . . . . 168 Filling.Solution. . . . . . . . . . . . . . . . . . 63 Filter.Holder. . . . . . . . . . . . . . . . . . . 221 Filter.Holder,.Inline. . . . . . . . . . . . . . 213 Fire-Polished. . . . . . . . . . . . . . . . . . . 118 Five-barrel.glass. . . . . . . . . . . . . . . . 120 Flexible.Light.Guides . . . . . . . . . . . . 168 Flexible.NO.Sensor. . . . . . . . . . . . . . . 65 FLEXREF. . . . . . . . . . . . . . . . . . . . . . . 79 FL-FLOWELL. . . . . . . . . . . . . . . . . . . 204 FL-FLUIWELL .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..204 FL-FLUIWELL-1C. . . . . . . . . . . . . . . . 204 FL-MF2C-25. . . . . . . . . . . . . . . . . . . 204 FL-MF4C-345. . . . . . . . . . . . . . . . . . 204 FL-MF8C-1000. . . . . . . . . . . . . . . . . 204 flow.analysis . . . . . . . . . . . . . . . . . . 207 Flow.Cell,.Low.Volume. . . . . . . . . . . 216 Flow.Cells. . . . . . . . . . . . . . . . . . . . . 215 FLOX-PATCH. . . . . . . . . . . . . . . . . . . . 75 FLOX-PROBE. . . . . . . . . . . . . . . . . . . . 75 Fluorescence-based.optical.sensor . . . 75 Fluorescent.lamp . . . . . . . . . . . . . . . 163 FluoroDish . . . . . . . . . . . . . . . . . . . . 172 FO-1000-SMA. . . . . . . . . . . . . . . . . 223 FO-1000-SMA1M. . . . . . . . . . . . . . . 223 FO-100-SMA . . . . . . . . . . . . . . . . . . 223 FO-100-SMA1M. . . . . . . . . . . . . . . . 223 227
PRODUCT INDEX
Item
Page
Item
Page
Item
Page
Item
Page
FO-200AS-SMA. . . . . . . . . . . . . . . . 223 FO-200-SMA. . . . . . . . . . . . . . . . . . 223 FO-200-SMA1M . . . . . . . . . . . . . . . 223 FO-400AS-SMA. . . . . . . . . . . . . . . . 223 FO-400-SMA. . . . . . . . . . . . . . . . . . 223 FO-400SMA/ST. . . . . . . . . . . . . . . . 223 FO-400-SMA1M . . . . . . . . . . . . . . . 223 FO-50-SMA. . . . . . . . . . . . . . . . . . . 223 FO-50-SMA1M .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..223 FO-6000. . . . . . . . . . . . . . . . . . . . . 213 FO-6000FILT. . . . . . . . . . . . . . . . . . 213 FO-600AS-SMA. . . . . . . . . . . . . . . . 223 FO-600-SMA. . . . . . . . . . . . . . . . . . 223 FO-600-SMA1M . . . . . . . . . . . . . . . 223 FOIMPH. . . . . . . . . . . . . . . . . . . . . . 124 FOIMPH-LF . . . . . . . . . . . . . . . . . . . 124 FOP1-SMA. . . . . . . . . . . . . . . . 222,.223 FOP1-SMA/ST. . . . . . . . . . . . . 222,.223 FOP1-ST . . . . . . . . . . . . . . . . . 222,.223 . Force.Transducers. . . . . . . . . . . . . 6,.99 Forceps .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 33 FORT.transducers. . . . . . . . . . . . . . . . 99 FORT100. . . . . . . . . . . . . . . . . . . . . . 99 FORT1000. . . . . . . . . . . . . . . . . . . . . 99 FORT10g. . . . . . . . . . . . . . . . . . . . . . 99 FORT25. . . . . . . . . . . . . . . . . . . . . . . 99 FORT250. . . . . . . . . . . . . . . . . . . . . . 99 FORT5000. . . . . . . . . . . . . . . . . . . . . 99 Frame.Clamp . . . . . . . . . . . . . . . . . . 143 FrameWorks. . . . . . . . . . . . . . . . . . . 142 Free.Radical.Analyzer. . . . . . . . . . 67,.68
heart,.isolated,.perfused. . . . . . . . . . . 12 Heater.Controller . . . . . . . . . . . . . . . 169 Heating.Filament .. .. .. .. .. .. .. .. .. . ..175,.177 Heating.Plate . . . . . . . . . . . . . . . . . . . 48 high.throughput.screening. . . . . . . . . 22 Hot.Plate.Analgesia.Meter . . . . . . . . . 47 HS6 . . . . . . . . . . . . . . . . . . . . . . . . . 154 HS6-3. . . . . . . . . . . . . . . . . . . . . . . 149 . HS6-3M. . . . . . . . . . . . . . . . . . . . . . 149 HT-1. . . . . . . . . . . . . . . . . . . . . . . . . . 57 HT-2. . . . . . . . . . . . . . . . . . . . . . . . . . 57 Hydrogen.Electrode. . . . . . . . . . . . . . . 80 Hydrogen.Peroxide.Sensors . . . . . 63,.66 Hydrogen.Sulfide.Sensor . . . . . . . . . . 63 Hydrostatic.pressure. . . . . . . . . . . . . 199
I
IE010. . . . . . . . . . . . . . . . . . . . . . . . . 80 IE190. . . . . . . . . . . . . . . . . . . . . . . . . 80 IE200. . . . . . . . . . . . . . . . . . . . . . . . . 80 II-12M229. . . . . . . . . . . . . . . . . . . . . 58 II-12M22931. . . . . . . . . . . . . . . . . . . 58 II-2200. . . . . . . . . . . . . . . . . . . . . . . 45 . II-23xx. . . . . . . . . . . . . . . . . . . . . . . . 44 II-24M22931. . . . . . . . . . . . . . . . . . . 58 II-2500. . . . . . . . . . . . . . . . . . . . . . . 45 . II-2888. . . . . . . . . . . . . . . . . . . . . . . 44 . II-29M. . . . . . . . . . . . . . . . . . . . . . . . 58 II-29M31. . . . . . . . . . . . . . . . . . . . . . 58 II-336T. . . . . . . . . . . . . . . . . . . . . . . . 47 II-39. . . . . . . . . . . . . . . . . . . . . . . . . . 47 II-390. . . . . . . . . . . . . . . . . . . . . . . . . 47 II-3M229SC. . . . . . . . . . . . . . . . . . . . 58 II-3M229SC31. . . . . . . . . . . . . . . . . . 58 II-520MP. . . . . . . . . . . . . . . . . . . . . . 45 II-600MR. . . . . . . . . . . . . . . . . . . . . . 46 II-6M229. . . . . . . . . . . . . . . . . . . . . . 58 II-6M22931. . . . . . . . . . . . . . . . . . . . 58 II-PE34. . . . . . . . . . . . . . . . . . . . . . . . 46 ILS.gas-tight.syringes. . . . . . . . 188,.195 implantable.probe . . . . . . . . . . . . . . . 74 IMPLANTABLE.PROBES . . . . . . . . . . . 57 in.vitro.fertilization. . . . . . . . . . . . . . 194 IN1003 . . . . . . . . . . . . . . . . . . . . . . 137 Incapacitance.Meter . . . . . . . . . . . . . . 46 Incremental.Hot.Cold.Analgesia.Meter. 6 4 Indium.Wire. . . . . . . . . . . . . . . . . . . 137 Induction.Chambers. . . . . . . . . . . . . . 43 Infusion.Pump . . . . . . . . . . . . . 186,.187 Infusion/Withdrawal.Pump. . . . . . . . 188 injector. . . . . . . . . . . . . . . . . . . . . . . 194 inline.filter.holder. . . . . . . . . . . . . . . 213 INST-APOLLO. . . . . . . . . . . . . . . . . . . 67 Instrument.Portfolio . . . . . . . . . . . . . . 40 Intact.Muscle . . . . . . . . . . . . . . . . . . 5,.7 Intracellular.Amplifier. . . . . . . . . ..85,.86 Intracellular.Calcium.Concentration. . . . 8 intracellular.injection . . . . . . . . . . . . 194 INV-101. . . . . . . . . . . . . . . . . . . . . . 166 Inverted.Trinocular.Microscope. . . . . 166 IO-KIT . . . . . . . . . . . . . . . . . . . . . . . 202 ion.selective.electrodes. . . . . . . . . . . . 80 iontophoresis. . . . . . . . . . . . . . . . . . . 93 Iridium.Microelectrodes . . . . . . . . . . 100 Iris.Forceps. . . . . . . . . . . . . . . . . . . . . 33
G
GEL100. . . . . . . . . . . . . . . . . . . . . . 128 Gimber.Fountain.Cannula. . . . . . . . . . 61 Glass.Cuvettes. . . . . . . . . . . . . . . . . 218 Glass.Handling.Forceps. . . . . . . . . . 119 glass.micropipettes . . . . . . . . . . . . . 122 glass.rod. . . . . . . . . . . . . . . . . . . . . 120 Glass,.Holders.&..Electrodes . . . . . . 117 Glue.Gun. . . . . . . . . . . . . . . . . 123,.133 GN-NET25. . . . . . . . . . . . . . . . . . . . 185 GN-NET7. . . . . . . . . . . . . . . . . . . . . 185 GN-PC25. . . . . . . . . . . . . . . . . . . . . 185 GN-PC7. . . . . . . . . . . . . . . . . . . . . . 185 GN-TTL . . . . . . . . . . . . . . . . . . . . . . 185 GO1-100. . . . . . . . . . . . . . . . . . . . . 125 GO2-100. . . . . . . . . . . . . . . . . . . . . 125 GO3-100. . . . . . . . . . . . . . . . . . . . . 125 GO4-100. . . . . . . . . . . . . . . . . . . . . 125 Gold.Wire. . . . . . . . . . . . . . . . . . . . 137 . Gold-plated.pins,.sockets. . . . . . . . . 100 GPL-T. . . . . . . . . . . . . . . . . . . . . . . 167 . GR100-4. . . . . . . . . . . . . . . . . . . . . 120 GR100-6. . . . . . . . . . . . . . . . . . . . . 120 Grip.Strength.Meter. . . . . . . . . . . . . . 45 GSNO . . . . . . . . . . . . . . . . . . . . . . . . 71 GSNO-100. . . . . . . . . . . . . . . . . . . . 71 . GSNO-50. . . . . . . . . . . . . . . . . . . . . . 71 g-SPIN. . . . . . . . . . . . . . . . . . . . . . . 131 Guillotine. . . . . . . . . . . . . . . . . . . . . . 39
Iris.Scissors . . . . . . . . . . . . . . . . . . . . 35 IRM23xxx . . . . . . . . . . . . . . . . . . . . 101 ISO2. . . . . . . . . . . . . . . . . . . . . . . . . . 76 ISO2.Filling.Solution .. .. .. .. .. .. .. .. .. .. .. .. .. 76 ISO-80. . . . . . . . . . . . . . . . . . . . . . . . 92 ISO-80P. . . . . . . . . . . . . . . . . . . . . . . 92 ISO-H2S-2 . . . . . . . . . . . . . . . . . . . . . 63 ISO-HPO-100. . . . . . . . . . . . . . . . 63,.66 ISO-HPO-100-H. . . . . . . . . . . . . . . . . 63 ISO-HPO-100-L . . . . . . . . . . . . . . 63,.66 ISO-HPO-2. . . . . . . . . . . . . . . . . . 63,.66 Isolated.Bioamplifier. . . . . . . . . . . . . . 92 Isolated.Differential.Amplifier. . . . . . . 92 Isolated.perfused.heart.system. . . . . . 10 Isolated.working.heart.system. . . . . . 11 ISO-NOP. . . . . . . . . . . . . . . . . . . 63,.64 . ISO-NOP.Rejuvenator. . . . . . . . . . . . . 71 ISO-NOP007 . . . . . . . . . . . . . . . . 63,.65 ISO-NOP30 . . . . . . . . . . . . . . . . . 63,.65 ISO-NOP30L. . . . . . . . . . . . . . . . . . . 66 . ISO-NOP70L. . . . . . . . . . . . . . . . 63,.66 . ISO-NOPF. . . . . . . . . . . . . . . . . . . 63,.65 ISO-NOPF200-L10. . . . . . . . . . . . . . . 66 ISO-NOPFH . . . . . . . . . . . . . . . . . . . . 63 ISO-NOPNM. . . . . . . . . . . . . . . . . 63,.64 ISO-OXY-2 . . . . . . . . . . . . . . . . . . 63,.66 Isostim. . . . . . . . . . . . . . . . . . . . . . . 110 ISO-TEMP-2. . . . . . . . . . . . . . . . . . . . 66 IT-14 . . . . . . . . . . . . . . . . . . . . . . . . . 57 IT-18 . . . . . . . . . . . . . . . . . . . . . . . . . 57 IT-18EXLONG. . . . . . . . . . . . . . . . . . . 57 IT-1E. . . . . . . . . . . . . . . . . . . . . . . . . . 57 IT-21 . . . . . . . . . . . . . . . . . . . . . . . . . 57 IT-23 . . . . . . . . . . . . . . . . . . . . . . . . . 57
L
L-32-32. . . . . . . . . . . . . . . . . . . . . . 168 Lab.Coat. . . . . . . . . . . . . . . . . . . . . . 134 Lab.Supply.Selection.Guide . . . . . . . 130 LAB-TRAX-4. . . . . . . . . . . . . . . . . . . . 67 Lacrimal.Cannula . . . . . . . . . . . . . . . . 61 Langendorff . . . . . . . . . . . . . . . . . . . . 10 Lapping.Film,.Alumina. . . . . . . . . . . 179 Lapping.Film,.Diamond. . . . . . . . . . 179 . LED.light.source. . . . . . . . . . . . . . . . 213 LED-Lite . . . . . . . . . . . . . . . . . . . . . . 213 LEDspec. . . . . . . . . . . . . . . . . . . . . . 206 LEDspecUV. . . . . . . . . . . . . . . . . . . . 206 Length.control.unit. . . . . . . . . . . . . . . . 5 Light.guides. . . . . . . . . . . . . . . . . . . 168 Light.Sources . . . . . . . . . . . . . . . . . . 213 Lighted.Fan.Base . . . . . . . . . . . . . . . 162 Linear.motor. . . . . . . . . . . . . . . . . . . . . 5 Linear.Stimulus.Isolator . . . . . . . . . . 113 Liquid.Ion.Exchangers. . . . . . . . . . . . 80 . Liquid.Waveguide.Capillary.Cell. . . . 214 Live.cell.imaging . . . . . . . . . . . . . . . 169 LOUPES . . . . . . . . . . . . . . . . . . . . . . . 40 Low-Pass.Filter. . . . . . . . . . . . . . . . . . 93 LPF30. . . . . . . . . . . . . . . . . . . . . . . . . 93 L-shaped.sensors. . . . . . . . . . . . . . . . 66 Luer.Valve.Kit. . . . . . . . . . . . . . . . . . 138 Luer-to-Tubing.Coupler. . . . . . . . . . . 138 LUME. . . . . . . . . . . . . . . . . . . . . . . . . 98 LU-PRO . . . . . . . . . . . . . . . . . . . . . . . 60 LU-READER . . . . . . . . . . . . . . . . . . . . 60 LU-S05. . . . . . . . . . . . . . . . . . . . . . . . 60 LU-S06. . . . . . . . . . . . . . . . . . . . . . . . 60 LU-S09. . . . . . . . . . . . . . . . . . . . . . . . 60 LU-T02-100. . . . . . . . . . . . . . . . . . . . 60 LWCC. . . . . . . . . . . . . . . . . . . . . . . . 214 LWCC-M-10 . . . . . . . . . . . . . . . . . . . 216 LWCC-M-50 . . . . . . . . . . . . . . . . . . . 216
PRODUCT INDEX
J
JE671P. . . . . . . . . . . . . . . . . . . . . . . . 81 Joystick.control. . . . . . . . .148,.149,.154 JUV . . . . . . . . . . . . . . . . . . . . . . . . . . 71
M
M1. . . . . . . . . . . . . . . . . . . . . . . . . . 156 M10. . . . . . . . . . . . . . . . . . . . . . . . . 157 M10L. . . . . . . . . . . . . . . . . . . . . . . . 157 M11. . . . . . . . . . . . . . . . . . . . . . . . . 157 M1L. . . . . . . . . . . . . . . . . . . . . . . . . 156 M2. . . . . . . . . . . . . . . . . .149,.153,.155 M-3 . . . . . . . . . . . . . . . . .147,.149,.155 M325. . . . . . . . . . . . . . . . . . . . . . . . 155 M3301. . . . . . . . . . . . . . . . . . . . . . . 152 M3301EH. . . 145,.148,.152,.154,.155 . M3301L. . . . . . . . . . . . . . . . . . . . . . 152 M3301-M3-L. . . . . . . . . . . . . . . . . . 152 M3301-M3-R. . . . . . . . . . . . . . . . . . 152 M3301R. . . . . . . . . . . . . . . . . . . . . . 152 M4C. . . . . . . . 149,.152,.153,.154,.155 M5. . . . . . . . . . . . . 149,.153,.155,.156 M6. . . . . . . . . . . . . . . . . .149,.153,.155 M7. . . . . . . . . . . . . . . . . . . . . . . . . . 158 M8. . . . . . . . . . . . . . . . . . . . . . . . . . 156 M9. . . . . . . . . . . . . . . . . . . . . . . . . . 157 Macro.sensors . . . . . . . . . . . . . . . . . . 63 MAESFLO.software. . . . . . . . . . . . . . 204 Magnetic.Ball.Joint. . . . . . . . . . . . . . 157 Magnetic.Heating.Stirrer. . . . . . . . . 135 .
K
Kelly.Hemostatic.Forceps . . . . . . . . . . 33 KG.Transducers . . . . . . . . . . . . . . . . . . 6 kidney,.perfused. . . . . . . . . . . . . . . . . . 9 KITE-L .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..152 KITE-R . . . . . . . . . . . . . . . . . . . . . . . 152 KITE-TB-L. . . . . . . . . . . . . . . . . . . . . 152 KITE-TB-R. . . . . . . . . . . . . . . . . . . . . 152 KITLWCC. . . . . . . . . . . . . . . . . . . . . 215 . KWIK-2 . . . . . . . . . . . . . . . . . . . . . . . 80 KWIKCAL-2 . . . . . . . . . . . . . . . . . . . . 80 Kwik-Cast . . . . . . . . . . . . . . . . . . . 133 Kwik-Gard. . . . . . . . . . . . . . . . . . . 132 KWIKGLUE. . . . . . . . . . . . . . . . . . . . 132 KWIKGUN . . . . . . . . . . . . . . . . . . . . 132 KWIKH-2. . . . . . . . . . . . . . . . . . . . . . 80 KWIKMIX. . . . . . . . . . . . . . . . . . . . . 132 KWIKPOT-2 . . . . . . . . . . . . . . . . . . . . 80 Kwik-Sil. . . . . . . . . . . . . . . . . . . . . 133 Kwik-Tip . . . . . . . . . . . . . . . . . . . . . 80 KWIKTPP-2 . . . . . . . . . . . . . . . . . . . . 80 KZ1101. . . . . . . . . . . . . . . . 59,.61,.122 KZ1106. . . . . . . . . . . . . . . . . . . . . . . 59
H
Half-Cells. . . . . . . . . . . . . . . . . . . . . 124 228
Item
Page
Item
Page
Item
Page
Item
Page
Magnetic.Holding.Devices . . . . 156,.158 Manometer. . . . . . . . . . . . . . . . . . . . 199 Manual.Micromanipulator. . . . . . . . 152 . Manual.Microsyringe.Pump. . . . . . . 199 MB2. . . . . . . . . . . . . . . . . . . . . . . . . 156 MBMPH5-7 . . . . . . . . . . . . . . . 121,.124 MBS. . . . . . . . . . . . . . . . . . . . . . . . . 179 MCL3-HS6. . . . . . . . . . . . . . . . . . . . 149 MCL3-SM325. . . . . . . . . . . . . . . . . . 148 McPherson-Vannas.Scissors. . . . . . . . 34 MD4L. . . . . . . . . . . . . . . . . . . . . . . . 155 MD4-M3-L. . . . . . . . . . . . . . . . . . . . 155 MD4-M3-R. . . . . . . . . . . . . . . . . . . . 155 MD4R. . . . . . . . . . . . . . . . . . . . . . . 155 . mechanical.allodynia . . . . . . . . . . . . . 44 MechanoCulture. . . . . . . . . . . . . . . . . 17 megohm.meter. . . . . . . . . . . . . . . . . 103 MEH145. . . . . . . . . . . . . . . . . . . . . 124 . MEH1F45. . . . . . . . . . . . . . . . . . . . . 124 MEH1R. . . . . . . . . . . . . . . . . . . . . . . 124 MEH1RF. . . . . . . . . . . . . . . . . . . . . . 126 MEH1S. . . . . . . . . . . . . . . . . . . . . . . 126 MEH1SF. . . . . . . . . . . . . . . . . . . . . . 126 MEH2R. . . . . . . . . . . . . . . . . . . . . . . 126 MEH2RF. . . . . . . . . . . . . . . . . . . . . . 126 MEH2RFW. . . . . . . . . . . . . . . . . . . . 126 MEH2RW. . . . . . . . . . . . . . . . . . . . . 126 MEH2S. . . . . . . . . . . . . . . . . . . . . . . 126 MEH2SF. . . . . . . . . . . . . . . . . . . . . . 126 MEH2SFW. . . . . . . . . . . . . . . . . . . . 126 MEH2SW. . . . . . . . . . . . . . . . . . . . . 126 MEH345. . . . . . . . . . . . . . . . . . . . . 126 . MEH3F45. . . . . . . . . . . . . . . . . . . . . 126 MEH3FW45. . . . . . . . . . . . . . . . . . . 126 MEH3R. . . . . . . . . . . . . . . . . . . . . . . 126 MEH3RF. . . . . . . . . . . . . . . . . . . . . . 126 MEH3RFW. . . . . . . . . . . . . . . . . . . . 126 MEH3RW. . . . . . . . . . . . . . . . . . . . . 126 MEH3S. . . . . . . . . . . . . . . . . . . . . . . 126 MEH3SB. . . . . . . . . . . . . . . . . . . . . . 126 MEH3SBW. . . . . . . . . . . . . . . . . . . . 127 MEH3SF. . . . . . . . . . . . . . . . . . . . . . 127 MEH3SFW. . . . . . . . . . . . . . . . . . . . 127 MEH3SW. . . . . . . . . . . . . . . . . . . . . 127 MEH3W45. . . . . . . . . . . . . . . . . . . . 127 MEH6RF. . . . . . . . . . . . . . . . . . . . . . 127 MEH6RFW. . . . . . . . . . . . . . . . . . . . 127 MEH6SF. . . . . . . . . . . . . . . . . . . . . . 127 MEH6SFW. . . . . . . . . . . . . . . . . . . . 127 MEH7. . . . . . . . . . . . . . . . . . . . . . . . 127 MEH7W. . . . . . . . . . . . . . . . . . . . . . 127 MEH8. . . . . . . . . . . . . . . . . . . . . . . . 127 MEH900R . . . . . . . . . . . . . . . . . . . . 127 MEH900S. . . . . . . . . . . . . . . . . . . . . 127 MES. . . . . . . . . . . . . . . . . . . . . . . . . 178 Metal.Microelectrodes. . . . . . . . . . . . 100 MF200.Microforge. . . . . . . . . . . . . . 175 MF200-H2. . . . . . . . . . . . . . . . . . . . 175 MF200-H3. . . . . . . . . . . . . . . . . . . . 175 MF200-H4. . . . . . . . . . . . . . . ..175,.177 MF28G-5. . . . . . . . . . . . . . . . . 123,.131 MF28G67-5. . . . . . . . . . . . . . . 123,.131 MF34G-5. . . . . . . . . . . . . . . . . 123,.131 Micro.Cannula . . . . . . . . . . . 59,.61,.122 Micro.Coaxial.Cables . . . . . . . . . . . . 137
Micro.pH.Electrodes . . . . . . . . . . . . . . 78 Micro.Sensors.for.NO. . . . . . . . . . . . . 63 Micro4.Controller. . . . . . . . . . . 195,.198 MicroBeveler. . . . . . . . . . . . . . . . . . . 179 MicroC . . . . . . . . . . . . . . . . . . . . . . . . 72 microCAPSTAR. . . . . . . . . . . . . . . . . . 49 Microcentrifuge. . . . . . . . . . . . . . . . . 131 Microcentrifuge.tube, . . . . . . . . . . . . 131 MICROCP. . . . . . . . . . . . . . . . . . . . . . 72 . Microdialysis.Pumps. . . . . . . . . . . . 186 Microdissection.Tools. . . . . . . . . . . . . 30 Microelectrode.Beveler. . . . . . . . . . . 178 Microelectrodes. . . . . . . . . . . . . . . . 100 . MicroFil .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. . 123,.131 MicroFlow. . . . . . . . . . . . . . . . . . . . . . 74 Microfluidics.Control. . . . . . . . . . . . . 204 Microforge . . . . . . . . . . . . . . . ..175,.176 Microforge.Application.Guide. . . . . . 174 Microforges,.Pullers.&.Bevelers . . . . 174 MicroImplant . . . . . . . . . . . . . . . . . . . 74 Microiontophoresis. . . . . . . . . . . . . . . 93 Microliter.Sample.Holder . . . . . . . . . 216 MicroLWCC. . . . . . . . . . . . . . . . . . . . 216 Micromanipulator. . 145,.148,.149,.152 Micromanipulators. . . . . . . . . . . . . . 144 Micrometer.Head . . . . . . . . . . . . . . . 146 Micrometer.Slide.Micromanipulator. 155 Micrometer,.Digital. . . . . . . . . . . . . . 135 Micropipette.Beveler. . . . . . . . . . . . . 178 Micropipette.Blanks . . . . . . . . . . . . . 121 Micropipette.Calibration. . . . . . . . . . 176 Micropipette.Holders . . . . . . . . . . . . 124 Micropipette.Storage. . . . . . . . . . . . . 121 Micropositioner .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..150 Micropressure.System. . . . . . . . . . . . 104 Microprobe.Thermometers. . . . . . . . . 56 Micro-Reference.Electrode. . . . . . . . . . 79 Micro-Scale.Compression. . . . . . . . . . 17 microscope.slides. . . . . . . . . . . . . . . 173 microscope.stage . . . . . . . . . . . . . . . 153 Microscope.Stage.Adapter . . . . . . . . 153 Microscopes.and.Cameras . . . . . . . . 160 MicroSquisher. . . . . . . . . . . . . . . . . . 17 . MicroTip. . . . . . . . . . . . . . . . . . . . . . . 74 Microvolume.Syringes . . . . . . . . . . . 195 Millivolt.&.megohm.meter . . . . . . . . 103 Mini.Sensors . . . . . . . . . . . . . . . . . . . 63 Miniature.Micropositioners. . . . . . . . 151 Miniature.Peristaltic.Pump. . . . . . . . 184 MiniFlow . . . . . . . . . . . . . . . . . . . . . . 74 MiniFoil . . . . . . . . . . . . . . . . . . . . . . . 74 Mini-Iris.Scissors . . . . . . . . . . . . . . . . 35 MINISTAR. . . . . . . . . . . . . . . . . . . . 184 . MiniTip. . . . . . . . . . . . . . . . . . . . . . . . 74 MityFlex.Peristaltic.Pump. . . . . . . . . 184 MITY-KIT . . . . . . . . . . . . . . . . . . . . . 184 MKB. . . . . . . . . . . . . . . . . . . . . . . . . . . 7 MM1 . . . . . . . . . . . . . . . . . . . . . . . . 151 MM3 . . . . . . . . . . . . . . . . . . . . . . . . 151 MMJR. . . . . . . . . . . . . . . . . . . . . . . 154 . MMP . . . . . . . . . . . . . . . . . . . . . . . . 199 MMP-KIT. . . . . . . . . . . . . . . . . . . . . 199 Mobile.Workstations. . . . . . . . . . . . . 43 . Modular.Lab.Microscope. . . . . . . . . . 167 Mosquito.Hemostatic.Forceps. . . . . . . 33
Motor.Action.Control.Panel. . . . . . . . . . 5 Motorized.Micromanipulator. . . 148,.149 Mounting.Supports,.KG . . . . . . . . . . . . 6 Mouse.Kit. . . . . . . . . . . . . . . . . . . . . . 38 MPH1. . . . . . . . . . . . . . . . . . . . . . . . 127 MPH3. . . . . . . . . . . . . . . . . . . . . . . . 127 MPH4. . . . . . . . . . . . . . . . . . . . . . . . 127 MPH6P. . . . . . . . . . . . . . . . . . . . . . . 127 MPH6R. . . . . . . . . . . . . . . . . . . . . . 127 . MPH6S. . . . . . . . . . . . . . . . . . . . . . . 127 MPH8. . . . . . . . . . . . . . . . . . . . . . . . 147 MPM10 . . . . . . . . . . . . . . . . . . . . . . 147 MPM20 . . . . . . . . . . . . . . . . . . . . . . 147 MPM-7. . . . . . . . . . . . . . . . . . . . . . . . 55 MPS-2 . . . . . . . . . . . . . . . . . . . . . . . 203 MS314. . . . . . . . . . . . . . . . . . . . . . . 149 MT-23/3. . . . . . . . . . . . . . . . . . . . . . . 57 MT-23/5. . . . . . . . . . . . . . . . . . . . . . . 57 MT-23/8. . . . . . . . . . . . . . . . . . . . . . . 57 MT-26/2. . . . . . . . . . . . . . . . . . . . . . . 57 MT-26/4. . . . . . . . . . . . . . . . . . . . . . . 57 MT-26/6. . . . . . . . . . . . . . . . . . . . . . . 57 MT-29/1. . . . . . . . . . . . . . . . . . . . . . . 57 MT-29/1B. . . . . . . . . . . . . . . . . . . . . . 57 MT-29/2. . . . . . . . . . . . . . . . . . . . . . . 57 MT-29/3. . . . . . . . . . . . . . . . . . . . . . . 57 MT-29/5. . . . . . . . . . . . . . . . . . . . . . . 57 MT-4 .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 57 MT-D . . . . . . . . . . . . . . . . . . . . . . . . . 57 Multi-Barrel.Glass .. .. .. .. .. .. .. .. .. .. .. .. .. ..120 Multi-barrel.micropipette.coupling. . 123 Multichannel.Perfusion.System. . . . . 203 Multi-Channel.Stimulator. . . . ..108,.109 Multi-Parameter.Monitor . . . . . . . . . . 55 Multi-pettes . . . . . . . . . . . . . . . . . . . 191 Multipipette.Puller . . . . . . . . . . . . . . 180 multi-port.measurement.chamber. . . . 70 muscle.hyperalgesia. . . . . . . . . . . . . . 45 Muscle.Physiology. . . . . . . . . . . . . . . . 2 Muscle.Research.System. . . . . . . . . . 7,.8 Muscle.Tester,.Basic. . . . . . . . . . . . . . . 5
NFGSK-5 . . . . . . . . . . . . . . . . . . . . . 201 NFINHLD. . . . . . . . . . . . . . . . . . . . . 201 NFQ34-5 . . . . . . . . . . . . . . . . . . . . . 201 Nitric.Oxide.Sensor.Guide . . . . . . . . . 64 Nitric.Oxide.Sensors. . . . . . . . . . . . . . 63 NMPH1 . . . . . . . . . . . . . . . . . . . . . . . 78 NMPH2 . . . . . . . . . . . . . . . . . . . . . . . 78 NMPH2B . . . . . . . . . . . . . . . . . . . . . . 78 NMPH3 . . . . . . . . . . . . . . . . . . . . . . . 78 NMPH3L .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 78 NMPH5 . . . . . . . . . . . . . . . . . . . . . . . 78 NOCHM-4 . . . . . . . . . . . . . . . . . . . . . 70 NOCHM-P .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 70 Non-Rotating.Micrometer. . . . . . . . . 146 NOVA-186. . . . . . . . . . . . . . . . . . . . 168 NOVAFLEX. . . . . . . . . . . . . . . . . . . . 168 NSA-3 . . . . . . . . . . . . . . . . . . . . . . . . 71 NVSL . . . . . . . . . . . . . . . . . . . . . . . . . 28 NVSLM1. . . . . . . . . . . . . . . . . . . . . . . 28
O
O.Ring. . . . . . . . . . . . . . . . . . . . . . . 178 Octyl.cyanoacrylate. . . . . . . . . . . . . . 134 Omega-Tip-Z . . . . . . . . . . . . . . . . . . 103 OMEGA-Z. . . . . . . . . . . . . . . . . . . . . 103 OmniDrill35. . . . . . . . . . . . . . . . . . . . 39 Oocyte.injection. . . . . . . . . . . . . . . . 198 Open.Circuit.Potential. . . . . . . . . . . . . 24 Operating.Scissors. . . . . . . . . . . . . . . 36 OPT . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Optical.Detection.Systems . . . . 207,.209 Optical.Detectors . . . . . . . . . . . . . . . 211 Optical.Fibers. . . . . . . . . . . . . . . . . . 223 Optical.Transducer.Amp. . . . . . . . . . . 95 Organ.System. . . . . . . . . . . . . . . . . . . . 9 Original.Pipetter.Stand. . . . . . . . . . . 192 OXELP . . . . . . . . . . . . . . . . . . . . . . . . 76 oxygen.dipping.probe . . . . . . . . . . . . 74 oxygen.electrode .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 76 Oxygen.Regulators. . . . . . . . . . . . . . . 43 oxygen.sensing.system . . . . . . . . . . . 75 Oxygen.Sensors. . . . . . . . . . . . . . 63,.66 OxyMicro . . . . . . . . . . . . . . . . . . . . . . 74 OxyMini. . . . . . . . . . . . . . . . . . . . . . . 74
PRODUCT INDEX
N
NANOFIL . . . . . . . . . . . . . . . . . . . . . 200 NanoFil.Application.Kits. . . . . . . . . . 202 Nanoliter.2000. . . . . . . . . . . . . . . . 198 . Nanoliter.Injector. . . . . . . . . . . . . . . 198 NanoSensor . . . . . . . . . . . . . . . . . . . . 64 Needle.Holders. . . . . . . . . . . . . . . . . . 36 NEEDLE.MICROPROBES. . . . . . . . . . . 57 Neely. . . . . . . . . . . . . . . . . . . . . . . . . 11 Neurotransmitter.Detection. . . . . . . . . 72 NF26BV-5 . . . . . . . . . . . . . . . . . . . . 200 NF33-36BL .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..201 NF33-36BV . . . . . . . . . . . . . . . . . . . 201 NF33BL-2. . . . . . . . . . . . . . . . . . . . . 201 NF33BV-2 . . . . . . . . . . . . . . . . . . . . 201 NF33FBL-2. . . . . . . . . . . . . . . . . . . . 201 NF33FBV-2. . . . . . . . . . . . . . . . . . . 201 . NF34BL-2. . . . . . . . . . . . . . . . . . . . . 201 NF34BV-2 . . . . . . . . . . . . . . . . . . . . 201 NF35BL-2. . . . . . . . . . . . . . . . . . . . . 201 NF35BV-2 . . . . . . . . . . . . . . . . . . . . 201 NF36BL-2. . . . . . . . . . . . . . . . . . . . . 201 NF36BV-2 . . . . . . . . . . . . . . . . . . . . 201
P
P-5-10. . . . . . . . . . . . . . . . . . . . . . . 121 P-5-50. . . . . . . . . . . . . . . . . . . . . . . 121 P-7-10. . . . . . . . . . . . . . . . . . . . . . . 121 Parallel.Rail . . . . . . . . . . . . . . . . . . . . 54 Patch.Clamp. . . . . . . . . . . . . . . . . . . 119 Paw.Pressure.Meter. . . . . . . . . . . . . . 45 Paw.Volume.Meter. . . . . . . . . . . . . . . 45 PB150F-4. . . . . . . . . . . . . . . . . . . . . 120 PB150F-6. . . . . . . . . . . . . . . . . . . . . 120 perfusion.chambers . . . . . . . . . . . . . . 26 Perfusion.System . . . . . . . . . . . . . . . 203 PERIPRO-2HS . . . . . . . . . . . . . . . . . 183 PERIPRO-4HS . . . . . . . . . . . . . . . . . 183 PERIPRO-4LS. . . . . . . . . . . . . . . . . . 183 PERIPRO-8LS. . . . . . . . . . . . . . . . . . 183 Peristaltic.pump. . . . . . . . . . . . 182,.184 Peri-Star.Pro. . . . . . . . . . . . . . . . . . . 182 Pette-Clamp . . . . . . . . . . . . . . . . . . . 192 229
Item
Page
Item
Page
Item
Page
Item
Page
PG10150-4. . . . . . . . . . . . . . . . . . . 119 PG10165-4. . . . . . . . . . . . . . . . . . . 119 PG52151-4. . . . . . . . . . . . . . . . . . . 119 PG52165-4. . . . . . . . . . . . . . . . . . . 119 pH.electrode. . . . . . . . . . . . . . . . . 78,.81 pH.Meter . . . . . . . . . . . . . . . . . . . 77,.81 pH.Meter,.Fiber.Optic. . . . . . . . . . . . . 77 pH.mini.sensors. . . . . . . . . . . . . . . . . 77 PH-OPTICA-MICRO. . . . . . . . . . . . . . . 77 PH-OPTICA-MINI. . . . . . . . . . . . . . . . 77 pHOptica. . . . . . . . . . . . . . . . . . . . . 77 Photocell. . . . . . . . . . . . . . . . . . . . . . 98 . pH-Silver . . . . . . . . . . . . . . . . . . . . . . 78 PI-305A. . . . . . . . . . . . . . . . . . . . . . 121 PicoNozzle.Kit. . . . . . . . . . . . . . . . . . 196 PiezoPatch . . . . . . . . . . . . . . . . . . . . 145 PiezoPatch.Micromanipulator. . . . . 145 Piezo-Translator. . . . . . . . . . . . . . . . 147 Piggyback. . . . . . . . . . . . . . . . . . . . . 120 Pipette.Tips . . . . . . . . . . . . . . . . . . . 193 Pipetter.Rack.Stand . . . . . . . . . . . . . 192 Pipetters. . . . . . . . . . . . . . . . . . . . . . 192 Planachromatic.Objective. . . . . . . . . 163 Plantar.Test . . . . . . . . . . . . . . . . . . . . 47 Platinum./.Iridium.Teflon.Wire. . . . . 137 Platinum./.Iridium.Wire . . . . . . . . . . 137 . Platinum.Wire. . . . . . . . . . . . . . . . . 137 Platinum-iridium.Microelectrodes. . . 100 Plethysmometer. . . . . . . . . . . . . . . . . 45 PM.Series. . . . . . . . . . . . . . . . . . . . . 199 PM01. . . . . . . . . . . . . . . . . . . . . . . . 199 PM015. . . . . . . . . . . . . . . . . . . . . . . 199 PM100. . . . . . . . . . . . . . . . . . . . . . . 199 PM5. . . . . . . . . . . . . . . . . . . . . 147,.149 PM6. . . . . . . . . . . . . . . . . . . . . . . . . 147 PM7. . . . . . . . . . . . . . . . . . . . . . . . . 147 PMP-107. . . . . . . . . . . . . . . . . . . . . 180 PNEU.transducers .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 98 PNEU01. . . . . . . . . . . . . . . . . . . . . . . 98 PNEU05. . . . . . . . . . . . . . . . . . . . . . . 98 PNEU15. . . . . . . . . . . . . . . . . . . . . . . 98 Pneumatic.PicoPump . . . . . . . . . . . . 196 Polishing.Patch.Pipettes. . . . . . . . . . 177 PolyFil . . . . . . . . . . . . . . . . . . . . . . . 123 Post . . . . . . . . . . . . . . . . . . . . . . . . . 142 Post.Stand . . . . . . . . . . . . . . . . . . . . 165 Posterior.Capsule.Polisher . . . . . . . . . 61 Potassium.Electrode. . . . . . . . . . . . . . 80 Potentiostat . . . . . . . . . . . . . . . . . . . . 72 Power.Frame.Enclosure. . . . . . . . . . . . 94 POWERCORDS. . . . . . . . . . . . . . . . . 141 PPM5000. . . . . . . . . . . . . . . . . . . . . 145 Preamplifier . . . . . . . . . . . . . . . . . 24,.25 Precision.Current.Sources. . . . . . . . . 111 Precision.SurgioScope. . . . . . . . . . . 161 . Pre-polarizer. . . . . . . . . . . . . . . . . . . . 71 Pressure.Ejection.Kit. . . . . . . . . . . . . 121 Pressure.Manometer. . . . . . . . . . . . . 199 Pressure.Pod . . . . . . . . . . . . . . . . . . 104 Pressure.Sensor. . . . . . . . . . . . . . . . . 98 Programmable.Syringe.Pump. . . . . . 185 ProGuide.Position/Holder. . . . . . . 65,.81 PSMB5. . . . . . . . . . . . . . . . . . . . . . . 161 PSMT5. . . . . . . . . . . . . . . . . . . . . . . 161 PTPxxx. . . . . . . . . . . . . . . . . . . . . . . 137 230
PTTxxxx. . . . . . . . . . . . . . . . . . . . . . 137 PTxxxx. . . . . . . . . . . . . . . . . . . . . . . 137 Puller,.Programmable. . . . . . . . . . . . 180 pulse.generator . . . . . . . . . . . ..107,.108 Pulse.Train. . . . . . . . . . . . . . . . . . . . 108 Pulsemaster.Stimulator . . . . . . . . . 108 Pumps.&.Fluid.Handling. . . . . . . . . . 181 Push-Pull.Pump. . . . . . . . . . . . . . . . 189 PV820. . . . . . . . . . . . . . . . . . . . . . . 197 PV830. . . . . . . . . . . . . . . . . . . . . . . 196 PZMIII . . . . . . . . . . . . . . . . . . . . . . . 164 PZMIII-AAC .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..164 PZMIII-BS. . . . . . . . . . . . . . . . . . . . . 164 PZMIV . . . . . . . . . . . . . . . . . . . . . . . 162 PZMIV-BS. . . . . . . . . . . . . . . . . . . . . 162 PZMTIII . . . . . . . . . . . . . . . . . . . . . . 164 PZMTIII-AAC. . . . . . . . . . . . . . . . . . . 164 PZMTIII-AAC-CCTV. . . . . . . . . . . . . . 164 PZMTIII-BS. . . . . . . . . . . . . . . . . . . . 164 PZMTIII-BS-CCTV. . . . . . . . . . . . . . . 164 PZMTIII-CCTV. . . . . . . . . . . . . . . . . . 164 PZMTIV . . . . . . . . . . . . . . . . . . . . . . 162 PZMTIV-BCS. . . . . . . . . . . . . . . . . . . 162 PZMTIV-BS. . . . . . . . . . . . . . . . . . . . 162 PZMTIV-CCTV. . . . . . . . . . . . . . . . . . 162
Ring.Light.Guide. . . . . . . . . . . . . . . 168 . Ringstand.Mounting.Kit. . . . . . . . . . . 91 Rodent.Brain.Matrices . . . . . . . . . . . . 29 Roger.Wirecutting.Scissors. . . . . . . . 135 RPE-KIT. . . . . . . . . . . . . . . . . . . . . . 202 RTD.sensor. . . . . . . . . . . . . . . . . . . . . 48 RTV.Coating. . . . . . . . . . . . . . . . . . . 133 RTV.Prime.Coat,. . . . . . . . . . . . . . . . 133 RTV.Sealant. . . . . . . . . . . . . . . . . . . 133
S
sample.cell. . . . . . . . . . . . . . . . . . . . 208 Sample.holder,.Microliter. . . . . . . . . 216 Sarcomere.Length.and.Spacing. . . . . . . 8 sarcomere.spacing . . . . . . . . . . . . . . . . 5 SBT-5. . . . . . . . . . . . . . . . . . . . . . . . . 56 Scalpel.Blades . . . . . . . . . . . . . . . . . . 37 Scalpel.Handle. . . . . . . . . . . . . . . . . . 37 Scissors . . . . . . . . . . . . . . . . . . . . . . . 34 Scotch-Weld. . . . . . . . . . . . . . . . . . . 132 . Screwdriver.Set. . . . . . . . . . . . . . . . 135 SDR2. . . . . . . . . . . . . . . . . . . . . . . . . 79 Sensor.Guide. . . . . . . . . . . . . . . . . . . 63 Septum.Theta. . . . . . . . . . . . . . . . . . 120 Seven-barrel.glass . . . . . . . . . . . . . . 120 SGE.syringes . . . . . . . . . . . . . . . . . . 195 SI-40-8 . . . . . . . . . . . . . . . . . . . . . . 168 SI-72-8 . . . . . . . . . . . . . . . . . . . . . . 168 SI-AOSC. . . . . . . . . . . . . . . . . . . . . . . . 5 SI-AOSU. . . . . . . . . . . . . . . . . . . . . . . 96 SI-BAM21LC. . . . . . . . . . . . . . . . . . . . . 6 SI-BAM21-LC . . . . . . . . . . . . . . . . . . . 95 SI-BMFA. . . . . . . . . . . . . . . . . . . . . . . 94 SI-BRIDGE80. . . . . . . . . . . . . . . . . . . 95 SI-COLU. . . . . . . . . . . . . . . . . . . . . . . . 5 SI-DAM800 . . . . . . . . . . . . . . . . . . . . 96 SI-DAS. . . . . . . . . . . . . . . . . . . . . . . . . 5 SI-ERG. . . . . . . . . . . . . . . . . . . . . . . . . 5 Signal.Conditioning.Amplifiers. . . . . . 94 Signal.Generator. . . . . . . . . . . . . . . . 107 SI-H,.Overview.of. . . . . . . . . . . . . . . . . 4 SI-IPOKIDNEY . . . . . . . . . . . . . . . . . . . 9 SI-KG2. . . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A. . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A-10. . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A-11. . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A-2 . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A-7 . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG2A-9 . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG4. . . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG4A. . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG7. . . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG7A. . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KG7B. . . . . . . . . . . . . . . . . . . . . . . . 6 SI-KGxx . . . . . . . . . . . . . . . . . . . . . . . . 6 SI-LANG1. . . . . . . . . . . . . . . . . . . . . . 10 SI-LANG2. . . . . . . . . . . . . . . . . . . . . . 10 SI-LANGC. . . . . . . . . . . . . . . . . . . . . . 13 SI-LANGWH. . . . . . . . . . . . . . . . . . . . 11 SI-LCU . . . . . . . . . . . . . . . . . . . . . . . . . 5 SI-LF-05-01-IPO. . . . . . . . . . . . . . . . . . 9 SILFLEX-2. . . . . . . . . . . . . . . . . . . . . 201 Silicone.RTV. . . . . . . . . . . . . . . . . . . 133 Silicone.Tubing. . . . . . . . . . . . . 183,.184 Silver.Epoxy. . . . . . . . . . . . . . . . . . . 133
Q
QFT1 . . . . . . . . . . . . . . . . . . . . . . . . 221 Quartz.Cuvettes . . . . . . . . . . . . . . . . 218 Quattro. . . . . . . . . . . . . . . . . . . . . . . . 44
R
Rackmounting.Hardware . . . . . . . . . 136 Radio.frequency.identification. . . . . . 60 . Randall.Selitto.Paw.Pressure.Meter . . 45 RBMA. . . . . . . . . . . . . . . . . . . . . . . . . 29 RC1 . . . . . . . . . . . . . . . . . . . . . 103,.129 RC1T . . . . . . . . . . . . . . . . . . . . . . . . 129 RC2 . . . . . . . . . . . . . . . . . . . . . . . . . 129 RC2F .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..129 RC3 . . . . . . . . . . . . . . . . . . . . . . . . . 129 RC4 . . . . . . . . . . . . . . . . . . . . . . . . . 129 RC5 . . . . . . . . . . . . . . . . . . . . . . . . . 129 RC6 . . . . . . . . . . . . . . . . . . . . . . . . . 129 RECTAL.PROBES. . . . . . . . . . . . . . . . . 57 Rectangular.Base. . . . . . . . . . . . . . . 142 Reference.Electrodes. . . . . . . . . . . . . . 79 Reflex.Clip . . . . . . . . . . . . . . . . . . . . . 37 Reflex.Clip.Applier. . . . . . . . . . . . . . . 37 REMS. . . . . . . . . . . . . . . . . . . . . . . . . 23 REMS.AutoSampler . . . . . . . . . . . . . . 22 REMS-24. . . . . . . . . . . . . . . . . . . . . . 23 REMS-96. . . . . . . . . . . . . . . . . . . . . . 23 REMS-KIT. . . . . . . . . . . . . . . . . . . . . . 23 Replacement.Electrode.Holder. . . . . . 152 Replacement.Needles. . . . . . . . . . . . 195 Replacement.Sleeves . . . . . . . . . . . . . 63 Replacement.Tubing. . . . . . . . . . . . . 183 RET-2. . . . . . . . . . . . . . . . . . . . . . . . . 57 RET-3. . . . . . . . . . . . . . . . . . . . . . . . . 57 Retractors. . . . . . . . . . . . . . . . . . . . . . 37 RFID.Tagging. . . . . . . . . . . . . . . . . . . 60 Ring.Light. . . . . . . . . . . . . . . . . . . . . 168 Ring.Light.Adapter. . . . . . . . . . . . . . 168
Silver.Wire. . . . . . . . . . . . . . . . . . . . 137 SI-MACP. . . . . . . . . . . . . . . . . . . . . . . . 5 SI-MB4. . . . . . . . . . . . . . . . . . . . . . . . 14 SI-MB8. . . . . . . . . . . . . . . . . . . . . . . . 14 SI-MKBM-CUVA/B . . . . . . . . . . . . . . . . 7 SI-MKBM-DUO. . . . . . . . . . . . . . . . . . . 7 SI-MKBM-LLCUV . . . . . . . . . . . . . . . . . 7 SI-MKBM-OXY. . . . . . . . . . . . . . . . . . . 7 SI-MKBM-TJUMP. . . . . . . . . . . . . . . . . 7 SI-MKBM-WIND. . . . . . . . . . . . . . . . . . 7 SI-MKB-OXY. . . . . . . . . . . . . . . . . . . . 7 . SI-MKB-WIND. . . . . . . . . . . . . . . . . . . 7 SI-MOTTEST. . . . . . . . . . . . . . . . . . . . . 5 SI-MT-L. . . . . . . . . . . . . . . . . . . . . . . . . 5 SI-MT-O. . . . . . . . . . . . . . . . . . . . . . . . 5 SI-MT-S . . . . . . . . . . . . . . . . . . . . . . . . 5 Single.Barrel. . . . . . . . . . . . . . . . . . . 118 Single.Channel.Pipetters. . . . . . . . . . 191 SI-OHO2F. . . . . . . . . . . . . . . . . . . . . . 15 SI-OHO2P. . . . . . . . . . . . . . . . . . . . . 15 . SI-OVO2F. . . . . . . . . . . . . . . . . . . . . . 15 SI-SARCCAM . . . . . . . . . . . . . . . . . . . . 5 SI-SARCSCR. . . . . . . . . . . . . . . . . . . . . 5 SI-SEN07RTH2. . . . . . . . . . . . 10,.11,.13 SI-SEN12AM4E-B. . . . . . . . . . 10,.11,.13 SI-SEN12AM4E-U .. .. .. .. .. .. .. .. . 10,.11,.13 SI-SEN13MAP . . . . . . . . . . . . 10,.11,.13 SI-TBR1000. . . . . . . . . . . . . . . . . . . . 97 SI-VIBU . . . . . . . . . . . . . . . . . . . . . . . . 5 Skinned.Muscle.Fiber. . . . . . . . . . . . . . 7 SM325. . . . . . . . . . . . . . . . . . . . . . . 148 SM325-M. . . . . . . . . . . . . . . . . . . . . 148 SNAP. . . . . . . . . . . . . . . . . . . . . . . . . 71 SNAP100. . . . . . . . . . . . . . . . . . . . . . 71 S-nitrosoglutathione. . . . . . . . . . . . . . 71 S-Nitroso-N-acetyl-D,L-penicillamine. 71 SP100i. . . . . . . . . . . . . . . . . . . . . . . 186 SP101i. . . . . . . . . . . . . . . . . . . . . . . 186 SP120p . . . . . . . . . . . . . . . . . . . . . . 189 SP200i. . . . . . . . . . . . . . . . . . . . . . . 187 SP210c. . . . . . . . . . . . . . . . . . . . . . 189 . SP210iw . . . . . . . . . . . . . . . . . . . . . 188 SP220i. . . . . . . . . . . . . . . . . . . . . . . 187 SP230iw . . . . . . . . . . . . . . . . . . . . . 188 SP250i. . . . . . . . . . . . . . . . . . . . . . . 187 SP260p . . . . . . . . . . . . . . . . . . . . . . 189 . Spatulated.Cannula. . . . . . . . . . . . . . 61 Specimen.Holder .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 28 SpectraView. . . . . . . . . . . . . . . . . . . 211 spectrometer. . . . . . . . . . . . . . . . . . . 210 SPLG .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ..190 SPLG200 . . . . . . . . . . . . . . . . . . . . . 190 SPLG210 . . . . . . . . . . . . . . . . . . . . . 190 SPLG212 . . . . . . . . . . . . . . . . . . . . . 190 SPLG270 . . . . . . . . . . . . . . . . . . . . . 190 SPLG272 . . . . . . . . . . . . . . . . . . . . . 190 SS316xx. . . . . . . . . . . . . . . . . . . . . 137 . SSM33xxxx . . . . . . . . . . . . . . . . . . . 101 SSTxxxxx . . . . . . . . . . . . . . . . . . . . . 137 stability.button,.SP200.Series . . . . . 188 Stainless.Steel.Rods. . . . . . . . . . . . . 142 Stainless.Steel.Wire . . . . . . . . . . . . . 137 Steel.Base.Plate . . . . . . . . . . . . . . . . 158 Stereo.Zoom.Microscope. . . . . . 162,.164 Stereotaxic. . . . . . . . . . . . . . . . . . . . . 50
PRODUCT INDEX
Item
Page
Item
Page
Item
Page
Item
Page
Stereotaxic.Accessories. . . . . . . . . . . . 52 Stereotaxic.Frame. . . . . . . . . . . . . . . . 50 Sterilizer. . . . . . . . . . . . . . . . . . . . . . . 41 Sterilizing.Trays . . . . . . . . . . . . . . . . . 41 stimulator. . . . . . . . . . . . . . . . ..107,.108 Stimulator,.Digital . . . . . . . . . . . . . . 114 Stimulator/Isolator. . . . . . . . . . . . . . 110 Stimulus.Isolator. ..111,.112,.113,.116 Stirrer. . . . . . . . . . . . . . . . . . . . . . . . 135 STM3. . . . . . . . . . . . . . . . . . . . . . . . 149 Stopcock. . . . . . . . . . . . . . . . . . . . . . 139 STX100 . . . . . . . . . . . . . . . . . . . . . . . 20 STX100C . . . . . . . . . . . . . . . . . . . . . . 20 STX100C96. . . . . . . . . . . . . . . . . . . . 20 STX100F . . . . . . . . . . . . . . . . . . . . . . 20 STX100M. . . . . . . . . . . . . . . . . . . . . . 20 STX2 . . . . . . . . . . . . . . . . . . . . . . . . . 19 STX3 . . . . . . . . . . . . . . . . . . . . . . . . . 19 Sub-microliter.injection. . . . . . . . . . . 200 Substrate,.Cell.Culture .. .. .. .. .. .. .. .. .. .. .. .. 17 Super.Adhesive. . . . . . . . . . . . . . . . 134 . SuperCut. . . . . . . . . . . . . . . . . . . . . . 35 . SUPER-Dri-Ref. . . . . . . . . . . . . . . . . . 79 Surgical.&.Microdissection.Tools . . . . 30 SurgioScope. . . . . . . . . . . . . . . . . . . 161 Sylgard. . . . . . . . . . . . . . . . . . . . . . . 134 Syringe.Pump. . . . . . . . . . . . . . 190,.202 Syringe.Pumps. . . . . . . . . . . . . 185,.186 Syringes.with.Luers . . . . . . . . . 188,.195 Syringes.with.Needles . . . . . . . . . . . 195 SYS-121. . . . . . . . . . . . . . . . . . . . . . 102 SYS-260. . . . . . . . . . . . . . . . . . . . . . . 93 SYS-705. . . . . . . . . . . . . . . . . . . . . . . 85 SYS-773. . . . . . . . . . . . . . . . . . . . . . . 87 SYS-900A. . . . . . . . . . . . . . . . . . . . . 104 SYS-A300. . . . . . . . . . . . . . . . . . . . . 109 SYS-A310. . . . . . . . . . . . . . . . . . . . . 107 SYS-A320D . . . . . . . . . . . . . . . . . . . 110 SYS-A320R. . . . . . . . . . . . . . . . . . . . 110 SYS-A362. . . . . . . . . . . . . . . . ..110,.111 SYS-A365D . . . . . . . . . . . . . . . . . . . 111 SYS-A365R. . . . . . . . . . . . . . . . . . . . 111 SYS-A382. . . . . . . . . . . . . . . . . . . . . 112 SYS-A385R. . . . . . . . . . . . . . . . . . . . 112 SYS-A385RC. . . . . . . . . . . . . . . . . . 112 . SYS-ABM . . . . . . . . . . . . . . . . . . . . . . 93 SYS-BP1. . . . . . . . . . . . . . . . . . . . . . . 59 SYS-DAM50. . . . . . . . . . . . . . . . . . . . 91 SYS-DAM80. . . . . . . . . . . . . . . . . . . . 91 SYS-DVC1000 . . . . . . . . . . . . . . . . . . 25 SYS-EVC4000. . . . . . . . . . . . . . . . . . . 24 SYS-ISO2. . . . . . . . . . . . . . . . . . . . . . 76 SYS-LPF30. . . . . . . . . . . . . . . . . . . . . 93 SYS-MICROC . . . . . . . . . . . . . . . . . . . 72 SYS-OMEGAZ. . . . . . . . . . . . . . . . . . 103 SYS-PV820. . . . . . . . . . . . . . . . . . . . 196 SYS-PV830. . . . . . . . . . . . . . . . . . . . 196 SYS-TBM4M. . . . . . . . . . . . . . . . . . . 105
T
Tail.Flick.Test . . . . . . . . . . . . . . . . . . . TAXIC-600. . . . . . . . . . . . . . . . . . . . . TAXIC-603. . . . . . . . . . . . . . . . . . . . . TAXIC-650. . . . . . . . . . . . . . . . . . . . . TAXIC-653. . . . . . . . . . . . . . . . . . . . . 47 50 50 50 50
TAXIC-900. . . . . . . . . . . . . . . . . . . . . 51 TAXIC-903. . . . . . . . . . . . . . . . . . . . . 51 TAXIC-950. . . . . . . . . . . . . . . . . . . . . 51 TAXIC-953. . . . . . . . . . . . . . . . . . . . . 51 TB-1. . . . . . . . . . . . . . . . . . . . . . . . . 152 TBM4M . . . . . . . . . . . . . . . . . . . . . . 105 TBR1025. . . . . . . . . . . . . . . . . . . . . . 68 TBR4100. . . . . . . . . . . . . . . . . . . . . . 69 TBS. . . . . . . . . . . . . . . . . . . . . 149,.153 . TCJ3050. . . . . . . . . . . . . . . . . . . . . . 137 TCK3050. . . . . . . . . . . . . . . . . . . . . 137 TEER.measurement. . . . .19,.20,.21,.22 . Temperature.Controller. . . . . . . . . . . . 48 temperature.probe . . . . . . . . . . . . . . 169 Temperature.Probes . . . . . . . . . . . . . . 56 Temperature.Sensor . . . . . . . . . . . . . . 66 TGWxxxx . . . . . . . . . . . . . . . . . . . . . 137 Thermocouple.Wire. . . . . . . . . . . . . 137 . Thin.Wall. . . . . . . . . . . . . . . . . . . . . 118 Three-barrel.glass. . . . . . . . . . . . . . 120 . Tidas.I . . . . . . . . . . . . . . . . . . . . . . . 210 TidasDAQ. . . . . . . . . . . . . . . . . . . . . 211 TIDASI . . . . . . . . . . . . . . . . . . . . . . . 210 Tilt.Base. . . . . . . . . . . . . . . . . . 149,.153 Tilt.Base.Assembly. . . . . . . . . . . . . . 179 TIP01TW1F . . . . . . . . . . . . . . . . . . . 122 TIP01TW1F-L. . . . . . . . . . . . . . . . . . 122 TIP02TW1F . . . . . . . . . . . . . . . . . . . 122 TIP02TW1F-L. . . . . . . . . . . . . . . . . . 122 TIP03TW1F . . . . . . . . . . . . . . . . . . . 122 TIP03TW1F-L. . . . . . . . . . . . . . . . . . 122 TIP04TW1F . . . . . . . . . . . . . . . . . . . 122 TIP04TW1F-L. . . . . . . . . . . . . . . . . . 122 TIP05TW1F . . . . . . . . . . . . . . . . . . . 122 TIP05TW1F-L. . . . . . . . . . . . . . . . . . 122 TIP10TW1. . . . . . . . . . . . . . . . . . . . 122 TIP10TW1-L. . . . . . . . . . . . . . . . . . . 122 TIP10TW1LS01 . . . . . . . . . . . . . . . . 122 TIP10TW1LS02 . . . . . . . . . . . . . . . . 122 TIP10XV119 . . . . . . . . . . . . . . 122,.198 TIP1TW1. . . . . . . . . . . . . . . . . . . . . 122 TIP1TW1-L. . . . . . . . . . . . . . . . . . . . 122 TIP2TW1. . . . . . . . . . . . . . . . . . . . . 122 TIP2TW1-L. . . . . . . . . . . . . . . . . . . . 122 TIP30TW1. . . . . . . . . . . . . . . . . . . . 122 TIP30TW1-L. . . . . . . . . . . . . . . . . . . 122 TIP30TW1LS01 . . . . . . . . . . . . . . . . 122 TIP30TW1LS02 . . . . . . . . . . . . . . . . 122 TIP5TW1. . . . . . . . . . . . . . . . . . . . . 122 TIP5TW1-L. . . . . . . . . . . . . . . . . . . . 122 TIP5TW1LS01 . . . . . . . . . . . . . . . . . 122 TIP5TW1LS02 . . . . . . . . . . . . . . . . . 122 TIPCA. . . . . . . . . . . . . . . . . . . . . . . . . 80 TIPH. . . . . . . . . . . . . . . . . . . . . . . . . . 80 TIPK. . . . . . . . . . . . . . . . . . . . . . . . . . 80 TIPMIX01-05. . . . . . . . . . . . . . . . . . 122 TIPMIX01-05-L . . . . . . . . . . . . . . . . 122 TIPMIX05-10. . . . . . . . . . . . . . . . . . 122 TIPMIX05-10-L . . . . . . . . . . . . . . . . 122 TIPTPP. . . . . . . . . . . . . . . . . . . . . . . . 80 . Tissue.Bath. . . . . . . . . . . . . . . . . . . . 14 Tissue.Bath.Cooler. . . . . . . . . . . . . . . 29 Tissue.Bath.for.Liver. . . . . . . . . . . . . . . 9 Tissue.Holders. . . . . . . . . . . . . . . . . . 15 Titanium.wire. . . . . . . . . . . . . . . . . . 137
TIxxxx . . . . . . . . . . . . . . . . . . . . . . . 137 TM31xxxx . . . . . . . . . . . . . . . . . . . . 101 TPP.Electrode. . . . . . . . . . . . . . . . . . . 80 Transbridge . . . . . . . . . . . . . . . . . . . 105 Transducer.Amplifier. . . . . . . . . . . . 105 . Transducers . . . . . . . . . . . . . . . . . . . . 98 Transmission.probes. . . . . . . . . . . . 217 . Trio. . . . . . . . . . . . . . . . . . . . . . . . . . . 44 TST150-6. . . . . . . . . . . . . . . . . . . . . 120 TST33xxxx. . . . . . . . . . . . . . . . . . . . 101 TTL.Control.Module . . . . . . . . . 183,.184 Tubing.Cartridge. . . . . . . . . . . . . . . . 183 Tungsten.Halogen.lamp . . . . . . . . . . 163 tungsten.light.source . . . . . . . . . . . . 213 Tungsten.Microelectrodes. . . . . . . . . 100 Tungsten.Wire . . . . . . . . . . . . . . . . . 137 TurtleSkin.Gloves. . . . . . . . . . . . . . . . 61 TW100-3. . . . . . . . . . . . . . . . . . . . . 118 TW100-4. . . . . . . . . . . . . . . . . . . . . 118 TW100-6. . . . . . . . . . . . . . . . . . . . . 118 TW100F-3. . . . . . . . . . . . . . . . . . . . 118 TW100F-4. . . . . . . . . . . . . . . . . . . . 118 TW100F-6. . . . . . . . . . . . . . . . . . . . 118 TW120-3. . . . . . . . . . . . . . . . . . . . . 118 TW120-4. . . . . . . . . . . . . . . . . . . . . 118 TW120-6. . . . . . . . . . . . . . . . . . . . . 118 TW120F-3. . . . . . . . . . . . . . . . . . . . 118 TW120F-4. . . . . . . . . . . . . . . . . . . . 118 TW120F-6. . . . . . . . . . . . . . . . . . . . 118 TW150-3. . . . . . . . . . . . . . . . . . . . . 118 TW150-4. . . . . . . . . . . . . . . . . . . . . 118 TW150F-3. . . . . . . . . . . . . . . . . . . . 118 TW150F-4. . . . . . . . . . . . . . . . . . . . 118 TW150F-6. . . . . . . . . . . . . . . . . . . . 118 Two-barrel.glass. . . . . . . . . . . . . . . . 120
USS8L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS8S. . . . . . . . . . . . . . . . . . . . . . . . 27 Ussing.System. . . . . . . . . . . . . . . . . . 26 Ussing.Tubing.Kit .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. 27 UV.Safety.Goggles. . . . . . . . . . . . . . 212
V
Vannas.Scissors. . . . . . . . . . . . . . . . . 34 Vaporizer.Pole.Mount. . . . . . . . . . . . . 43 Ventilator.Connection.Kit. . . . . . . . . . 43 Ventilators. . . . . . . . . . . . . . . . . . . . . 49 Vertical.Tissue.Bath. . . . . . . . . . . . . . 14 Vetbond. . . . . . . . . . . . . . . . . . . . . . 134 Vibration.Isolation.Platform. . . . . . . 159 Vibration.Unit . . . . . . . . . . . . . . . . . . . 5 Vibration-Free.Tables. . . . . . . . . . . . 159 Vibration-Free.Workstation. . . . . . . 159 . Vibroslice. . . . . . . . . . . . . . . . . . . . . . 28 Vidaurriv.Cannula . . . . . . . . . . . . . . . 61 Voltage.Clamp. . . . . . . . . . . . . . . 24,.25 Voltage.Electrode. . . . . . . . . . . . . . . . 24 Voltage/Current.clamp. . . . . . . . . . . . 25 von.Frey.Anesthesiometer . . . . . . . . . 44 von.Frey.Probe. . . . . . . . . . . . . . . . . . 44 VSLM1C. . . . . . . . . . . . . . . . . . . . . . . 28 VSLM1H. . . . . . . . . . . . . . . . . . . . . . 28 . VSP1. . . . . . . . . . . . . . . . . . . . . . . . 202 V-Vette. . . . . . . . . . . . . . . . . . . . . . . 216
W
W30.Microscope . . . . . . . . . . . . . . . 167 W30S. . . . . . . . . . . . . . . . . . . 167,.177 . W30ST. . . . . . . . . . . . . . . . . . 167,.177 . Wall.Mount.Plate. . . . . . . . . . . . . . . 163 Wall-Mount.Plate. . . . . . . . . . . . . . . 165 Water.Bath. . . . . . . . . . . . . . . . . . . . . 27 Waveguide.Cleaning.Kit. . . . . . 209,.215 Window.Discriminator. . . . . . . . . . . 102 Wire. . . . . . . . . . . . . . . . . . . . . . . . . 137 Wire.Cutters. . . . . . . . . . . . . . . . . . . 135 WSA1001 . . . . . . . . . . . . . . . . . . 65,.81 WSA2001 . . . . . . . . . . . . . . . . . . 65,.81
U
UCK. . . . . . . . . . . . . . . . . . . . . . . . . 217 ultra-fine.wire. . . . . . . . . . . . . . . . . . 137 UltraMicroPump.III. . . . . . . . . . . . . . 194 UltraPath . . . . . . . . . . . . . . . . . . . . . 208 UMP3. . . . . . . . . . . . . . . . . . . . . . . . 194 UMS. . . . . . . . . . . . . . . . . . . . . . . . . 146 Universal.Focus.Mount. . . . . . . . . . . 165 Universal.Manipulator.Stand . . . . . . 146 Universal.Pipette.Tips. . . . . . . . . . . . 193 UPUV. . . . . . . . . . . . . . . . . . . . . . . . 209 UPVIS. . . . . . . . . . . . . . . . . . . . . . . . 209 USBCAM100 . . . . . . . . . . . . . . . . . . 170 USBCAM33 . . . . . . . . . . . . . . . . . . . 170 USBCAM50 . . . . . . . . . . . . . . . . . . . 170 USS1L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS1S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS2L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS2S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS3L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS3S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS4L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS4S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS5L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS5S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS6L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS6S . . . . . . . . . . . . . . . . . . . . . . . . 27 USS7L . . . . . . . . . . . . . . . . . . . . . . . . 27 USS7S . . . . . . . . . . . . . . . . . . . . . . . . 27
PRODUCT INDEX
Z
ZBEECAL . . . . . . . . . . . . . . . . . . . . . . 78 Zoom.Microscope. . . . . . . . . . . 162,.164
231
Terms & Conditions

WPIvaluesitscustomersandwillmakeeveryefforttomaintainthehighest professionalandethicalstandards.However,WPIregardsasinvalidany specialtermsandconditionssetforthbyanyotherparty,includingpurchasing, quotations,warrantiesorotherstatements.WPIsresponsetoaquotation, purchaseorderorinquiryshallnotbeconstruedasacceptanceofanyconditions statedtherein.
Taxes
Wereservetherighttoaddanytaxesrequiredbylocallaworor i ance. dn Institutionsoperatingundertax-freeconditionsmuststateapplicablelicenseor contractnumberandbepreparedtofurnishnecessaryexemptioncertificate.
Credit Terms
Net30daysfromdateofinvoicetocustomerswithsatisfactorycreditreferences.
Packaging and Shipping

Equipmentisshippedinadequatecommercialpacking.Allpackagesshouldbe checkedthoroughlybeforebeingdiscarded.Shippingandhandlingexpenses, includingadequateinsurancecoverage,arepaidbythecustomer.
Standard Equipment & Accessories

Toinsureagainstmisunderstandingsordelays,alwaysincludemodelnum er, b name,andsignificantspeci aionsofsystemsandac es o ieswhenordering. if c t c s r Alsospecifyanyopionsdesired.WPIretainstherighttochangespeci aions t if c t ordiscontinueproductswithoutpriornoticeandwith utre pon i ilyforin oro s s b it c po atngsuchchangesintoequipmentpre i usysold.Pleasestatethedesired r i vo l operatinglinevoltageandfrequency.
Claims and Returns

Inspectallshipmentsuponreceipt.Missingcartonsorobviousdamageto cartonsshouldbenotedonthedeliveryreceiptbeforesigning.Concealed lossordamageshouldbereportedatoncetothecarrierandaninspection requested.Allclaimsforshortageordamagemustbemadewithinten(10) daysafterreceiptofship ent.Claimsforlostshipmentsmustbemadewithin m thirty(30)daysofreceiptofinvoiceorothernotificationofshipment.Please savedamagedorpilferedcartonsuntilclaimissettled.Insomeinstances, photographicdocumentationmayberequired.Someitemsaretime-sensitive; WPIassumesnoextendedwarrantyoranyliabilityforusebeyondthedate specifiedonthecontainer Donotreturnanygoodstouswithoutobtainingpriorapprovalandinstructions fromourReturnsDepartment.Goodsreturnedunauthorizedorbycollectfreight mayberefused.Goodsacceptedforrestockingwillbeexchangedorcreditedto yourWPIaccountandaresubjecttoarestockfeeofupto25%.Goodsreturned whichwereorderedbycustomersinerroraresubjecttoa25%restockfee. Equip entwhichwasbuiltasaspecialordercannotbereturned. m
Warranty
WPIstrivestomaintainthehighestqualitystandardsinallproducts.We warrantytheseproductsagainstdefectsinworkmanshipormaterials,andall WPIproductsretainawarrantythatisstatedintheproductsmanual.(Typically, oneyearforpartsandlaborexceptforconsumableitemssuchaselectrodes, glass,etc.,forwhichwarrantyvariesfrom30daystosixmonths.)However, WPIherebyspecifiesthatnouseorapplicationofanyproductmaybesuitable orsuccessfulforaspecificapplicationandthereforewaivesallliabilityinthat regard.Itisthesoleresponsibilityofthebuyer/usertoapplytheproductina mannerconsistentwithitsintendeduse. WPIproductsarenotapprovedforhumanuseunlessspecificallystatedin writingwithaccompanyingFDA(orapplicable)documents.WPIassumesno liabilityorlegal,moral,ethical,orfiduciaryresponsibilityforauseofany productintheWPIcatalogintreatingorstudyinghumans.
Repairs
ContactourReturnsDepartmentforassistanceintherepairofap a aus.Do p r t notreturngoodsuntilinstructionshavebeenreceived.Returneditemsmustbe securelypackedtopreventfurtherdamageintransit.TheCustomerisre pons si leforpayingshippingexpenses,includingadequateinsuranceonallitems b returnedforrepairs.Identificationoftheitem(s)bymodelnumber,name,serial numberandproofofpurchase(packingslipnumberorinvoicenumber)aswell ascompletedescriptionofthedifficultiesexperiencedshouldbewrittenonthe RMArequestformandacopyoftheformmustbeincludedwiththeitem.
Prices
WPImaintainscompetitiveworldwidepricing.Priceslistedforstandarditemsas describedarenetandsubjecttochangewithoutnotice.Prices(inU.S.dollars) donotincludeshippingcharges.Formalquo aionsarevalidforaperiodof t t 30daysunlessotherwisespecified.Pur has smaybechargedtoyourVISA, c e MasterCard,orAmericanExpressaccount.
Circulating Bath
TheJulabocirculatingbathisidealforcontrollingtemperaturesofexternalsystems.Witha powerful15L/minflowrate,thepumpprovides optimumheatexchange.Thetapwatercooling featureisstandardwitharangeof20-100C. Thebathopeningis15cmx15cmx15cmand canhold34.5Lofliquid. l LEDtemperaturedisplay(0.1Cresolution) l Stainlesssteelbathtank l Adjustablehightemperaturecutoutanddry runningprotection. l PIDtemperaturecontrol l Largecapacityfortemperatureapplicationswithlargerexternalsystemsandopen systems l Internalbathforsimultaneousapplications withsmallerobjects l Builtincoolingcoilfortapwaterconnection whenyourequireatemperaturelessthanthe 503843 503844 ambienttemperature
JULABO BATH SPECIFICATIONS

TemperatureSelection. . . . . . . . . . . . . . . . . . . . . digital TemperatureIndication . . . . . . . . . . . . . . . . . . . . . . LED . Resolution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .0.1C TemperatureControl. . . . . . . . . . . . . . . . . . . . . . . . PID1 HeaterWattage . . . . . . . . . . . . . . . . . . . .230V2.0kW . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .115V1.0kW Circulating Pump D ischarge,maxa0bar . . . . . . . . . . . . . . . . . . 15L/min P ressure,max.at0I. . . . . . . . . . . . . . . . . . . . . 0.35bar AmbientTemperature. . . . . . . . . . . . . . . . . . . . . 5-40C MainsPowerConnection(230V/50Hz). . . 190-253V/50Hz CurrentInput(230V). . . . . . . . . . . . . . . . . . . . . . . . . . 9A MainsPowerConnection(115V/60Hz). . . 103-127V/60Hz CurrentInput(115V). . . . . . . . . . . . . . . . . . . . . . . . . . 9A BathTank. . . . . . . . . . . . . . . . . . . . . . . . . Stainlesssteel WorkingTemperatureRange. . . . . . . . . . . . . 20-100C TemperatureStability. . . . . . . . . . . . . . . . . . . . . . 0.03 BathOpening(WxL). . . . . . . . . . . . . . . . . . .15x15cm BathDepth. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15cm FillingVolume. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4.5L Dimensions . . . . . . . . . . . . . . . . . . . . . 17x33x36cm Weight . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.0kg RecommendedBathFluid. . . . . soft/decalcifiedwater
Julabo Circulating Bath, 115V Julabo Circulating Bath, 230V
232
UK: Tel: 01438-880025..wpiuk@wpi-europe .com....Germany: Tel: 030-6188845..wpide@wpi-europe .com....China: Tel: 21.68885517..chinasales@china .wpiinc .com
Ordering Information
Orders from North America should be directed to WPIs main office: World Precision Instruments, Inc. 175 Sarasota Center Boulevard Sarasota, Florida 34240-9258 Telephone: 941-371-1003 (collect calls not accepted). Facsimile copies of purchase orders, inquiries or other correspondence may be transmitted to WPIs Fax number: 941-377-5428. When sending written purchase orders to confirm a telephone order, please clearly mark CONFIRMING on the order to avoid it being shipped a second time. Our Sales Departments e mail address is: sales@wpiinc.com North American customers may also order many products on-line through WPIs Web site www.wpiinc.com. All customers may use the on-line Quote Request Form and on-line Purchase Order Form. Orders from Belgium, Denmark, Eire, Finland, Luxembourg, Norway, Portugal, Spain, Sweden, Switzerland (FR) and the United Kingdom should be directed to WPI UK: Astonbury Farm Business Centre Aston, Stevenage, Herts SG2 7EG England Tel: +44 (0)1438-880025 Fax: +44 (0)1438-880026 E-mail: wpiuk@wpi-europe.com. Customers in France may call 0870 44 9000 or e-mail wpifr@wpieurope.com. Orders from Austria, Germany, Greece, Italy, Malta, Netherlands, Russian States, Switzerland (DE) and Turkey should be directed to WPI Germany: Zossener Strasse 55-58 D-10961 Berlin, Germany Tel: +49 (0)30-6188845 Fax: +49 (0)30-6188670 E-mail: wpide@wpi-europe.com Orders from China, Hong Kong and Taiwan should be directed to WPI China: WPI Shanghai Trading Co., Ltd., Rm 20a No8 Dong Fang Rd., Lu Jia Zui Financial District Shanghai PRC Tel: + 86 688 85517 Email: chinasales@china.wpiinc.com Orders from the countries listed below should be directed to the appropriate WPI distributors. All other international orders should be directed to WPIs main office and factory in Sarasota, Florida. To expedite shipment of orders outside North America (other than to areas served by the international offices above), payment must be made in advance via wire transfer, check payable in U.S. dollars, or charged to a credit card. Proforma Invoices will gladly be furnished upon request. Please specify proper electrical current for your order.
WPI Distributors
Albania, Belarus, Bosnia, Bulgaria, Croatia, Czech Republic, Estonia, Herzegovina, Hungary, Latvia, Lithuania, Poland, Republic of Makedonija, Romania, Serbia and Montenegro, Slovakia, Slovenia
Experimetria Ltd. 87 Podmaniczky St. Budapest, 1062 Hungary Tel: +36 1 269 0191 Fax: +36 1 353 3451 Website: www.experimetria.com
Chile
Equilab Ltda. DiazYCompaa Ltd. El Quillay 627 sitio 96 Ciudad Empresarial Valle Grande Santiago Chile Fono: 56-2-4370217 Fax: 56-2-4650066 E-mail: secvtas3@equilab.cl Pgina Web: www.equilab.cl Contact: Benilde Ardiles
Korea
SciTech Korea, Inc. 40-5 Wooi-dong Kangbuk-gu Seoul 142-8-71 Tel: 822-999-4419 Fax: 822-999-4416 E-mail: scitech00@scitechkorea.co.kr
India
Argentina
Summit Research S.A Rodrigo de Ibarrola 3140, 1D C1419CGB Ciudad de Buenos Aires, Argentina Telefono: (5411)-4566-8246 Fax: (5411) 4638-5049 E-mail: summit@summitar.com.ar
Australia, New Zealand
Labindia Instruments Pvt. Ltd. Head Office: 201, Nand Chambers, L B S Marg, Near Vandana Cinema, Thane 400 602 Tel.: 022 2598 6062 Email: borgaonkarhv@labindia.com Website: www.labindia.com <http://www. labindia.com> Other Labindia offices: Chandigarh, Delhi, Gurgaon, Lucknow, Guwahati, Baroda, Bhopal, Kolkata, Pune, Hyderabad, Bangalore, Chennai, and Thiruvananthapuram
Coherent Life Sciences Pty. Ltd. 116 Sir Donald Bradman Dr. Hilton, SA 5033 Tel: (61) 8-8150-5200 Fax: (61) 8-8352-2020 E-mail: sales@coherent.com.au
Israel
Alta Tecnologia en Laboratorios S.A. de C. Sucursales: GUADALAJARA, JAL. Av. Inglaterra #2588 Col. Arcos Vallarta Guadalajara, Jalisco C.P. 44150 Telefono: 52 (33) 36 16 52 04 Y 36 16 24 69 Fax: 52 (33) 36 16 97 30 E-mail: altatecenlabs@prodigy.net.mx Website: www.atlsadecv.com.mx MEXICO D.F. Comoporis #43, Col el Caracol Coyoacan, Mexico D.F. C.P. 04739 Telefono: 52 555 606 24 69 Y 52 04 Fax: 52 555 665 79 68 E-mail: atl@prodigy.net.mx Website: www.atlsadecv.com.mx
Mxico
Brasil
Sellex (S.A.C.) Rua Arandu, 205 / 1105 04562-030 - Sao Paulo - SP Tel: (11) 5506-4646 Fax: (11) 5505-7433 E-mail: vendas@sellex.com Website: www.sellex.com
NBT NewBiotechnology Ltd. Uri Schechter, Managing Director 3 Mekor Haim St. P.O. Box 8662 Jerusalem 91086 Tel: 972-2-6732001 Fax: 972-2-6731611 E-mail: nbtsales@nbtltd.com Website: www.nbtltd.com
Singapore, Malaysia, Indonesia, Thailand & Pakistan

Prime Bioscience Pte Ltd Block 431 Clementi Avenue 3, #01-358 Singapore 120 431 Tel: + 65 6364 0391 Fax: + 65 6269 0745 E-mail: info@primebioscience.com Website: www.primebioscience.com
Japan
LMS Co., Ltd. Tanaka Bldg. 3-6-7 Hongo Bunkyo-Ku, Tokyo 113-0033 Tel: 03-5842-4171 Fax: 03-3818-7095 E-mail: intldpt@lms.co.jp Website: www.lms.co.jp
United Arab Emirates
Mr. Vijay Parab Labgulf fzc 125 M2 Warehouse Q4-203 Saif Zone, Sharjah Tel: +971 6 557 9893 Fax: +971 6 557 9894 Mobile: +971 55 470 5663
Muscle Physiology Epithelial Physiology
page 2
Signal Conditioning Amplifier System

See Page 94
page 18
Crystal Pipetters
See Page 191
Microdissecting, Microsurgery
page 30
Animal Surgery & Support

page 42
Biosensing
page 62
Compact ff Langendor
See Page 12
Amplifiers, Electrometers Stimulators
page 83
page 106
Glass, Holders, Electrodes

page 117
Laboratory Supplies
page 130
Micromanipulators Microscopes, Cameras Microforges, Pullers
ssors Iris Scige 35 a

See P
page 144
page 160
Vertica l
See Pag
Tissue Bath e 14
page 174
See Page 204
Pumps, Microinjection
page 18
Spectroscopy
page 205
Index
page 224
Copyright 2010, World Precision Instruments, Inc. All rights reserved.

2011intl Medicla Equipment

Uploaded by

Copyright:

Available Formats

2011intl Medicla Equipment

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

2011intl Medicla Equipment

Uploaded by

Copyright:

Available Formats

Laboratory Equipment

for the Life Sciences

Muscle Physiology Epithelial Physiology

Animal Surgery & Support

Amplifiers, Electrometers Stimulators

Glass, Holders, Electrodes

Micromanipulators Microscopes, Cameras Microforges, Pullers

Pumps, Microinjection Spectroscopy

World Precision Instruments

Expanding Your Reach

Surgery Related Equipment

Signal Conditioning Amplifier System

Tools for Molecular Biology

Animal Surgery & Support . . . . . 42

Glass, Holders, Electrodes . . . . . . 117

Laboratory Supplies . . . . . . . . . . . 130

Micromanipulators, Stands . . . . 144

Microscopes, Cameras . . . . . . . . . . 160

Microforges, Pullers . . . . . . . . . . . . 174

Pumps, Microinjection . . . . . . . . . 181

Front cover background image Copyright Dennis Kunkel Microscopy, Inc.

UK: Tel: 01438-880025 wpiuk@wpi-europe.com

Germany: Tel: 030-6188845 wpide@wpi-europe.com

China: Tel: 21 68885517 chinasales@china.wpiinc.com

SI-H Systems Offer Choices and Convenience

M U SCLE PHYS IOLOGY

Overview of SI-H Research Platforms

M U SCLE PHYS IOLOGY

SI-MKB Standard Muscle Research Platforms with Micrometer

SI-MKBM Standard Muscle Research Platforms with Linear Motor

SI-MB Tissue / Organ Bath Systems

SI-LANG Isolated Perfused Organ Systems

Isolated Perfused Organ (Kidney) System

UK: Tel: 01438-880025 wpiuk@wpi-europe.com

Germany: Tel: 030-6188845 wpide@wpi-europe.com

Basic Muscle Tester

M U SCLE PHYS IOLOGY

Modular Flexible Expandable

SI-MT-L SI-MT-S SI-MT-O

MUSCLE TESTEr SPECIfICaTIOnS

KG Optical Force Transducers

M U SCLE PHYS IOLOGY

TrAnSdUCEr SPECIFICATIOnS Unloaded transducer without tissue mounting support

contact us for specialty transducers with different ranges.

Optical Force Transducer Amplifier

SI-BAM21-LC optical transducer Amplifier, Single Channel mt/mKB/opt/mB/LAng

UK: Tel: 01438-880025 wpiuk@wpi-europe.com

Germany: Tel: 030-6188845 wpide@wpi-europe.com

China: Tel: 21 68885517 chinasales@china.wpiinc.com

MKB Muscle Research System

M U SCLE PHYS IOLOGY

M U SCLE PHYS IOLOGY

Optical Measurements from Muscles using SI-H Research Systems

OPT Muscle Research System

Intracellular Calcium Concentration

UK: Tel: 01438-880025 wpiuk@wpi-europe.com

Germany: Tel: 030-6188845 wpide@wpi-europe.com

China: Tel: 21 68885517 chinasales@china.wpiinc.com

Isolated Perfused Organ System