Nature 7951 2023 03-09
Nature 7951 2023 03-09
Celebrate women
that they can be at the cutting edge of discovery and knowl-
edge production, Díaz notes. “More and more women take
leading roles in coming up with groundbreaking ideas,
and every day that, for a woman, engaging in a scientific career does not
necessarily mean working in the shadows as a follower.
Wade will be lauding the success of programmes
designed to support early-career researchers, such as
International Women’s Day can serve to the Rising Stars scheme at the Massachusetts Institute
bring hope, highlight progress and inspire of Technology (MIT) in Cambridge, and the many similar
research communities to continue their schemes it has inspired around the world. Rising Stars
offers mentoring and support for researchers from
efforts to push hard for true gender equality.
historically marginalized or under-represented groups,
I
as they move through their careers. The programme is a
nternational Women’s Day falls on 8 March; it aims direct result of the work of MIT biologist Nancy Hopkins,
to draw attention to women’s achievements and the who showed the institute’s male leadership that women had
fight for gender equality. The day has its critics: too less lab space, lower salaries and fewer grants compared
performative, say some; an opportunity for institu- with men. This activism led the institute down a path of
tions to put on a facade of change by doing a photo change, as a new book, The Exceptions by Kate Zernike,
shoot, say others, or to load over-burdened women in their describes. Wade also writes and edits Wikipedia articles
organizations with yet more duties. But they are wrong. It takes on scientists from historically marginalized groups. She
There is a need to raise awareness. Women in science still, courage for finds that, when she creates or edits a page for a US-based
on average, publish less and win fewer grants and promo- scientist, very often they will have gone through a Rising
tions than do men. Harassment, assault and marginaliza-
women to Stars-style programme.
tion drive promising researchers out of science, especially enter into Tanya Monro, Australia’s chief defence scientist, will be
those whose race, ethnicity, disability or sexual orientation and persist in celebrating courage. “It takes courage for women to enter
makes them targets for discrimination. into and persist in the scientific workforce,” says Monro,
Activism and action can engender change — if the sys-
the scientific who works in a field that is more male-dominated than
tems that have long oppressed researchers who are not workforce.” most. “It takes courage for women to speak out when they
male can be made to shift. Part of achieving that goal are expected to shoulder the brunt of changing scientific
involves raising awareness of what is possible if barriers workplaces, so that the girls and women that follow them
are broken down. “We don’t need another massively shiny have better odds of thriving,” she adds. “Women and girls
campaign,” says Jess Wade, a physicist at Imperial College in science need every ounce of that courage for themselves,
London and a campaigner for gender equality. “We actu- to overcome the lingering confidence gap many of us
ally need to support the women scientists that we have.” carry through life. And I’m glad that these women persist,
It’s in that spirit that Nature asked six women research- because it is that courage that allows them to contribute to
ers how they will be celebrating International Women’s creating the knowledge and impact that shapes our world.”
Day. Martina Anto-Ocrah is an epidemiologist at the Gihan Kamel, a physicist at SESAME, the Synchro-
University of Pittsburgh in Pennsylvania who researches tron-light for Experimental Science and Applications in
sex and gender disparities with an emphasis on women’s the Middle East, based in Jordan, will also be celebrating
health and global health, particularly in sub-Saharan breaking barriers. “There is progress,” she says. “Not least
Africa. Anto-Ocrah says she wants to celebrate the con- in breaking the extremes in cultural and religious traditions
tribution of social scientists to the advancement of gender and rules that are made by society and forced on women —
equality. Social scientists “are the people who highlight all usually inherited from one generation to another.”
the cultural issues in our society that hold women back”, Aster Gebrekirstos, a senior scientist at the World Agro-
she says. One example is how, during the COVID-19 pan- forestry Centre in Nairobi, will be marking women who have
demic, publication rates for women scientists dropped succeeded in their roles despite facing significant chal-
more markedly than did those for men — confirming that lenges. These challenges include wars and conflict, says
women shouldered a greater share of responsibilities dur- Gebrekirstos, who is from Tigray, a region of Ethiopia that
ing that time, such as caring for families, leaving less time has been at the centre of a devastating conflict. The United
for research (E. B. Madsen et al. eLife 11, e76559; 2022). Nations Economic Commission for Africa has published
Sandra Díaz is an ecologist at the National University Earth, Oceans and Skies (www.africanwomenscientists.
of Córdoba in Argentina and one of the leaders of IPBES, com), an open-access anthology of writing from and about
the Intergovernmental Science-Policy Platform on Bio African women scientists (including Gebrekirstos). The
diversity and Ecosystem Services. Díaz wants to celebrate book is honest about the hardships women have endured
women as science leaders. Although they make up far “to reach where we are”, Gebrekirstos says. Take a moment
from half of the researchers running major laboratories to acknowledge those hardships and to advance equity –
or winning big awards, women are increasingly realizing today, tomorrow and every day after that.
‘Elite university’
this month. A board of expert advisers to the nation’s Min-
istry of Education, Culture, Sports, Science and Technol-
ogy will select the candidates by the autumn. But it is the
strategies might government, not the research community, that will make
the final call, which is far from ideal.
J
ing a well-trodden path. Others argue that if redistribution
apan is an exemplar in global research funding. It is of funding is needed, universities in Japan’s poorer parts
one of a small cluster of countries, including Israel, should benefit more, and that this would tap into previ-
South Korea and Sweden, that consistently spend ously unexplored avenues for boosting economic growth.
upwards of 3% of gross domestic product on research Japan’s fund It’s not often that countries shake up their funding
and development (R&D). The 2020 average for coun- is a public arrangements so radically, but Germany offers an exam-
tries in the Organisation for Economic Co-operation and ple. In 2005, the nation ushered in its Excellence Initiative,
Development comes in at just under 2.7%.
endowment, at least in part to distribute more funding among a subset
But investment alone doesn’t guarantee R&D success, fuelling of its largest universities. France has wanted to move in a
and the nation’s policymakers worry that not enough of concerns similar direction, but researchers have resisted the idea.
Japan’s top universities have the kind of autonomy afforded Predictably, the German initiative has widened the
to their counterparts in Western nations, as Nature Index
about funding gap between those institutions that have received
reports in a Japan-focused issue this week (see page S86). possible excellence money and those that have not (L. Mergele and
Officials are also concerned about the fact that Japan’s political F. Winkelmayer High. Educ. Policy 35, 789–807; 2022). And,
universities have been dropping in international rankings. interference.” after more than a decade, the initiative is changing. In its
The government’s response, announced in 2021, is to latest iteration, comparatively more funding is going to
create a ¥10-trillion (US$75-billion) national endowment smaller universities and to interdisciplinary research. The
fund for research. This will be invested, with the annual United Kingdom is also facing calls for its next Research
returns — expected to be around ¥300 billion — distributed Excellence Framework — the scoring system for assessing
between a select group of institutions. These will be called research and distributing QR funding — to give greater
universities for international research excellence. weight to measures of research culture and the quality of
Japan’s move to separate a subset of its universities is not a research environment.
unprecedented. Indeed, it comes at a time when prominent Japan’s chosen universities must increase the value
institutions elsewhere, such as those of the US Ivy League, of their research, develop new disciplines, target global
Australia’s Group of Eight and the United Kingdom’s Russell issues and gain worldwide visibility. Loss of visibility is
Group, are having to think harder about the consequences evident among Japan’s top universities, some of which have
of their exclusivity, both positive and negative — particu- dropped in the rankings in recent years. In 2013, 5 Japanese
larly when it comes to diversity, equity and inclusion. universities made the top 200 of the Times Higher Educa-
The inspiration for Japan’s fund comes, at least in part, tion’s World University Rankings; a decade later, that figure
from the endowment model of private institutions in the has dropped to just 2. Concentrating research funding at
United States, but there are key differences that must be a handful of institutions is one way to help universities
borne in mind. Harvard University in Cambridge, Massa- achieve league-table positions, because some ranking
chusetts, for instance, has the world’s largest endowment, methodologies give weight to funding for research, along-
totalling $50.9 billion at the end of the fiscal year 2022, and side staff numbers and publication data.
this delivers an annual payout to the university of around Japan is embarking on a path that is likely to enrich a
$2 billion. Some of this is used for research. But Harvard’s small number of universities and might well have positive
endowment is made up of contributions from more than results in areas including research outputs and rankings.
14,000 individual donors, whereas Japan’s fund is a public But amid mounting evidence of rising levels of burnout
endowment. As Nature Index reports, this is fuelling con- and staff turnover — and low job satisfaction — in academia
cerns about possible political interference (see page S84), worldwide, the country’s policymakers should consider
which risks undermining the ambition for more autonomy. both what might be gained and what might be lost by pur-
Eligible Japanese universities must apply by the end of suing a strategy of concentrating funding in this way.
World view
By Zia Mehrabi
I
We know where people live and can quantify their demand
n April 2020, I sat outside with a colleague on a deserted the effects for various foods using purchasing-power data, and we have
campus amid a COVID-19 lockdown. Shelves were emp-
of multiple granular information on international trade volumes for
tying in supermarkets across Europe and North Amer- major commodities. Logistics researchers have modelled
ica. Panic buying underpinned that, but worker illness simultaneous how food flows from producers to consumers for coun-
and restrictions on mobility and trade were looming: stressors — tries including the United States — models just waiting to be
it was not clear how these would create supply-side dis- disease draped over representations of real-world infrastructure.
ruptions. As food-systems scientists, we agreed we simply Putting together these pieces will bring immense ben-
didn’t have the tools to answer that question.
outbreaks, efits, allowing near-real-time assessment of the impact of
In recent years, global food security has had shocks from conflicts extreme weather, export restrictions or labour shortages.
the COVID-19 pandemic, the Russian invasion of Ukraine, or energy We will be able to model the effects of multiple simulta-
extreme weather events and more. My colleagues and I neous stressors — disease outbreaks, conflicts or energy
scramble to find convincing answers quickly when devel-
shocks.” shocks — and assess how long it would take to re-route flows
opment outfits, aid organizations and government think to alternative ports, offset losses and buffer shocks.
tanks come calling. What would be the impact of COVID-19 Technical challenges will need attention. Many maps
mobility restrictions on harvests in sub-Saharan Africa? of processing facilities and the agricultural workforce are
How would Germany’s move away from Russian gas affect incomplete, but machine learning and AI offer opportuni-
global fertilizer production and use? How would heatwaves ties to fill these gaps. Integrating public and private data
change the ability of the poorest people to afford food? while ensuring producer and consumer privacy is also dif-
As we talked back in 2020, it was clear to both me and my ficult, but can be done with current cryptographic tools.
colleague what we needed: next-generation food-systems Implementing digital twins will be an vast undertaking,
models, hooked up to real-world data, that consistently and must be done right. On average, poorer nations have
capture patterns of food production, transport, processing less capacity to build and use food-system models: they lack
and consumption, allowing stress-testing and real-time funds, they have less-mature monitoring systems and data
informed responses to systemic shocks. infrastructure, and more of their economic activity hap-
Such representations of physical reality — ‘digital twins’ pens in unrecorded informal markets. Global efforts must
— already exist in some sectors. They are used in aerospace counter these inequities and democratize access to models.
engineering to prepare for and respond to critical system Promoting data and model sharing will be key. Digital
failures, and in manufacturing to maintain product quality. twins built behind closed doors by industry — particularly
The European Union is funding an initiative to develop large commodity traders and the consultants and insurers
digital twins of Earth systems to tackle climate change and that serve them — might not best serve the public interest
aid protection of nature. Digital twins of food systems will or the resilience of the food system. Hoarding of privileged
— at least at first — have fewer data to draw on, because the information is a real concern given increasing corporate
ability to sense food flows varies with location, food type power. Terrorism and security risks are considerable, if
and stage of processing. But with advances in data genera- in-depth understandings of food-system fragilities are
tion, computing power and artificial intelligence (AI), I am made public or inadequately protected from hacking.
convinced the time for these models is now. Only through partnership between the public and pri-
Historically, major food emergencies such as the global vate sectors, strong governance and clear oversight will
price crises of 1972–75 and 2007–08 have triggered leaps in the risks be mitigated and the full benefits realized. United
food-system modelling. But efforts have been fragmented. Nations bodies could guide this effort, bringing together
Economists can create complex models of prices and trade Zia Mehrabi is an the organizations equipped to maintain the core compo-
for policy analysis, but with limited geospatial resolution. assistant professor nents and setting rules for data sharing and governance.
Agronomists have excellent high-resolution renderings of in environmental To make digital twins of food systems a success, funding
crop production and yield, but these typically stop at the studies at the agencies must step beyond their silos and pay for initiatives
NATASCHA MEHRABI
farm gate. What’s missing are the details of how food flows University of on the same scale as large physics projects.
through supply chains — for example, how lentils from Colorado Boulder. The world must stop putting off food-systems data sci-
Canada make their way to a restaurant in India. e-mail: ziamehrabi@ ence until emergency strikes. With real-time insights, we
Yet most of what’s needed exists. Satellites can monitor gmail.com could see key fragilities in food systems before it’s too late.
Research highlights
SUNSCREEN RECIPE BONING UP: THE STEM
THAT KEEPS SEAS CELLS THAT GIVE MINI
SAFE FOR CORAL ANTLERS TO MICE
A new sunscreen could protect Every spring, deer lose their
fragile corals in addition to our antlers; by early autumn, they
skin. have a new set. This bony
Chemical sunscreens on headgear sprouts by about
the market today use organic 2.75 centimetres a day, one of
molecules that absorb the fastest rates of bone growth
ultraviolet radiation to protect
US COASTS FACING among mammals.
FEMALE SCIENTISTS
MORE FREQUENT MISS OUT ON CAREER
skin from damage and reduce Tao Qin at Northwestern
the risk of cancer. These Polytechnical University in Xi’an,
molecules are small enough to DOUBLE CYCLONES China, and his colleagues used ADVANCES ABROAD
penetrate the skin, and have the RNA sequencing to examine
potential to disrupt the body’s In coming decades, the US almost 75,000 cells from sika Researchers often move to
hormonal activity. Sunscreen eastern and Gulf coasts face a deer (Cervus nippon), before, another country to advance their
that washes off swimmers’ skin growing risk of being hit by two during and after the antlers were careers, but this opportunity
into the ocean can bleach coral hurricanes in quick succession lost. The authors identified a isn’t afforded to men and women
— possibly killing it. — a development brought on by specific family of stem cells that equally. Female researchers
To develop safer sunscreens, climate change. was key to antler renewal. are less internationally mobile
Yuan Zeng at Tsinghua A one-two punch of one Ten days before the antlers than their male counterparts, an
University in Beijing and hurricane followed quickly were shed, one subtype of analysis finds — but this gender
colleagues made a variety of by another causes extra these stem cells was abundant gap has shrunk.
molecules containing ring- devastation. In 2021, for in the stumps that remain on Xinyi Zhao at the Max Planck
shaped structures that absorb example, parts of Louisiana the day of shedding. By day five Institute for Demographic
UV light; similar structures flooded when Hurricane after shedding, these cells had Research in Rostock, Germany,
are found in conventional Nicholas struck soon after generated a separate subtype and her colleagues used data
sunscreens. The researchers Hurricane Ida unleashed heavy of stem cell. By day ten after on 33 million publications
linked these molecules with rains. shedding, the new subtype of from 10 million researchers to
water-soluble molecules to To understand how frequently stem cells in the stumps began track researchers’ international
make several polymers. They pairs of hurricanes might to develop into cartilage and movements from 1998 to 2007.
screened these to find the one strike in the future, Ning Lin bone cells. When the team The team found that women
that absorbed the most UV light. at Princeton University in transplanted day-five stem were under-represented
In laboratory tests, the New Jersey and her colleagues cells to the foreheads of mice, among those whose affiliations
winning material protected analysed data on hurricanes the rodents grew antler-like changed from one country to
mice from UV-induced skin that made landfall in the United structures (pictured) within another, but this is shifting.
burn better than commercial States between 1949 and 2018. 45 days. The number of internationally
sunscreens. It did not irritate or The scientists then simulated These stem cells could lead to mobile female researchers
get absorbed into the rodents’ how storms could evolve by the treatments for bone or cartilage almost tripled during the study
Nature Clim. Change https://doi. Proc. Natl Acad. Sci. USA 120,
org/grt9bz (2023) e2214664120 (2023)
University of Southern aren’t hunted, suggesting that likely that one exploded at the
Mindanao in Kabacan, the unsustainable hunting is a driver Nature Commun. 14, 860 (2023) appropriate time to supply
Philippines, and his colleagues of population decline. Thus, the aluminium in the dust. The
found that 19% of the bat species the authors call for investments answer: 2,000–20,000 stars,
they surveyed are hunted. Bats in creating economic security depending on how long it took
that live on nectar and other and reliable sources of meat the Solar System to form.
plant products are the top from domesticated animals for Previous researchers
targets, especially the fruit- people living in key bat habitats. estimated that the birth cluster
eating flying foxes and other Efforts to limit bat hunting could held just 500 stars.
members of the superfamily both protect bats and prevent
Pteropodoidea, along with the transmission of infectious Astron. Astrophys. 670, A105
some of the Rhinolopoidea, diseases from bats to humans. (2023)
or horseshoe bats. Other key
predictors that a species is Biol. Conserv. 279, 109944 (2023)
News in focus
SALWAN GEORGES/THE WASHINGTON POST VIA GETTY
A 7.8-magnitude earthquake struck Turkey and Syria on 6 February, killing more than 50,000 people.
T
More than 10,000 buildings are completely northwest Syria are internally displaced, hav-
or partially destroyed, leaving 11,000 people ing fled bombing attacks by the government of
he 7.8-magnitude earthquake that homeless, according to the United Nations Bashar al-Assad, which has military backing from
struck Turkey and Syria on 6 February Office for the Coordination of Humanitarian Russia. The UN and aid agencies are struggling
has killed more than 50,000 people Affairs. The earthquake also destroyed ware- to get supplies and expertise to earthquake-af-
and flattened multiple cities. More houses that store medicines. Nature spoke to fected areas, because there are only three tem-
than 4,500 of those who died, and doctors, engineers and other experts on the porary crossing points along the 911-kilometre
8,500 of those injured were in northwest Syria, ground, as well as those helping remotely from border with Turkey (see ‘Crossing continents’).
a region with no unified government that has Europe and from elsewhere in the Middle East.
been cut off from the world for more than 12 This is what they have said. Medical emergency
years amid a devastating war. Its already-de- After the 2011 Arab Spring, Syria’s govern- Hospitals in this region have been over-
pleted health-care system — 4.7 million people ment used military force against all opposi- whelmed as they attempt to help thousands of
share just one MRI machine — is on its knees. tion. Around 60% of the 4.7 million people in injured people in spaces with severely limited
SOURCE: EARTHQUAKE INTENSITY DATA, USGS; WATERWAYS, HUMANITARIAN OPENSTREETMAP TEAM; BUILDUP,
Buildings in danger of collapsing are being
reinforced with whatever materials are availa-
KILOGRAMS AFTER
killer asteroid a week from next Tuesday?’ I
would have had to say no,” adds Tom Statler,
SPACECRAFT COLLISION
DART’s programme scientist at NASA head-
quarters in Washington DC. Now that astron-
omers have surveyed the skies to identify
nearly all the dangerous asteroids — and now
Studies reveal final moments before NASA’s that DART has been shown to work —“we will
know what to do about it when something new
DART probe crashed into asteroid Dimorphos. is found”, he says.
Researchers are continuing to work through
By Alexandra Witze
L
the main body of the spacecraft collided with the DART data to learn more about the physics,
the rocky surface next to the boulder — and the chemistry and geology of both Dimorphos and
ast September, NASA’s Double Asteroid US$330-million DART shattered to bits. The Didymos. This work is being done with the help
Redirection Test (DART) spacecraft impact ejected at least one million kilograms of a network of amateur astronomers co-led by
smashed into an asteroid, altering the of rock from Dimorphos’s 4.3-billion-kilogram Marchis. The network’s members observed the
rock’s trajectory through space in a first mass. The debris formed a tail that stretched asteroids with their telescopes before, during
test of planetary defence. Now scientists for tens of thousands of kilometres behind and after the impact. They discovered that the
have deconstructed the collision and its after- the asteroid. Various telescopes watched over rocks seemed to become significantly redder
math — and learnt just how successful human- weeks as the tail shifted and evolved under the immediately after the spacecraft hit5.
ity’s punch at the cosmos really was. pressure of the Sun’s rays; the Hubble Space A later colour change to blue was spotted by
DART, which was the size of a golf cart, Telescope even detected a second tail, which NASA’s Infrared Telescope Facility in Hawaii,
collided with a Great Pyramid-sized aster- had disappeared by 18 days after the impact3. as reported by Cristina Thomas, a planetary
oid called Dimorphos. The crash caused the Dimorphos is 151 metres wide and orbits the scientist at Northern Arizona University in
asteroid’s orbit around another space rock to larger asteroid Didymos. NASA’s goal was to Flagstaff, at a meeting of the American Geo-
shrink — Dimorphos now completes an orbit alter Dimorphos’s orbit enough for astrono- physical Union last December. “We think this
33 minutes faster than before the impact, mers to spot the changes by monitoring the is likely because we have a lot of material from
researchers report1 in Nature. If a dangerous brightness of the pair over time using ground- Dimorphos thrown off,” she says. The impact
asteroid were ever detected heading for Earth, based telescopes. Neither asteroid is, or will blasted through the asteroid’s weathered
a mission to smash into it would probably be ever be, a threat to Earth. Images taken as interior and exposed part of its insides, mak-
able to divert it away from the planet. DART approached Dimorphos on 26 Septem- ing the asteroid appear temporarily blue, a few
DART’s success has been reported before; ber show the asteroid covered in boulders. It hours after impact.
now, five studies in Nature describe the final seemed to be loose rubble barely held together
moments of the crash and how it affected the by gravity — whose surface would probably 1. Thomas, C. A. et al. Nature https://doi.org/10.1038/s41586-
asteroid. One group combined data on the shatter spectacularly when DART hit it. 023-05805-2 (2023).
spacecraft’s trajectory with photographs of 2. Daly, R. T. et al. Nature https://doi.org/10.1038/s41586-023-
05810-5 (2023).
the asteroid’s surface just before impact2. As Crash test 3. Li, J.-Y. et al. Nature https://doi.org/10.1038/s41586-023-
DART hurtled towards Dimorphos at more than The discovery of more details is helping 05811-4 (2023).
6 kilometres per second, the first part that hit researchers to understand why the impact 4. Cheng, A. F. et al. Nature https://doi.org/10.1038/s41586-
023-05878-z (2023).
was one of its solar panels, which smashed into was so successful in shunting the asteroid, 5. Graykowski, A. et al. Nature https://doi.org/10.1038/
a 6.5-metre-wide boulder. Microseconds later, says Carolyn Ernst, a planetary scientist at s41586-023-05852-9 (2023).
Protecting poultry
Poultry farms are a key battleground in
the fight against H5N1, the strain of avian
influenza that is currently circulating.
Outbreaks on farms threaten food security
and provide opportunities for the virus A goose being vaccinated against avian influenza in China.
to spread to farm workers. For decades,
farmers have controlled the disease by variety of bird breeds to stop the virus, says which species of wild bird are most severely
culling infected animals. But now, with Nichola Hill, an ecologist at the University affected by avian flu, and the implications
many countries experiencing outbreaks of Massachusetts in Boston. In Asia, where this has for the spread of the disease. As well
on dozens of farms every month, this is farmers have a long history of navigating as helping scientists direct conservation
becoming untenable. outbreaks of bird flu, some have switched to measures, this research could give farmers a
Some countries, including China, breeds that are less susceptible to the virus. better idea of when bird flu might be heading
vaccinate poultry to limit the spread and their way if, for example, it is combined with
severity of bird flu, and other governments Conserving wildlife when certain birds are known to migrate.
around the world are now implementing H5N1 has become entrenched in wild bird That knowledge could help farmers target
vaccination policies or contemplating doing populations over the past year, but there are measures to protect poultry, such as cleaning
so. One problem with existing vaccines is “some small Band-Aids we can put on things”, up grain that could attract wild birds and
that they cause birds to test positive for says epidemiologist David Stallknecht at the washing boots before entering farms. “It’s
the virus, meaning farmers can’t guarantee University of Georgia in Athens. Administering extremely hard to do that 365 days of the
their birds are free of H5N1. This has “huge vaccines to wild birds is logistically difficult. year,” Hill says.
international trade and export implications”, So, for the most part, birds have to develop
says Keith Poulsen, a specialist in infectious resistance to the disease through being Stopping a human pandemic
diseases who directs the Wisconsin infected, and many will die in that process. The death of the girl in Cambodia — and the
Veterinary Diagnostic Laboratory in Madison. Vaccines could help to protect certain fact that her father also tested positive for
Scientists are in the early stages of species, Stallknecht says. Bald eagles avian influenza — has renewed concerns
developing vaccines that might solve this (Haliaeetus leucocephalus), for example, can about whether bird flu could spark widespread
WEI LIANG/CHINA NEWS SERVICE/GETTY
problem. Microbiologist Adel Talaat at the be severely affected by the virus, and some infection in people, or even a pandemic.
University of Wisconsin–Madison and his scientists are worried about the impact of bird “That’s hard to say,” says Thijs Kuiken, a
colleagues are developing a vaccine that flu on the population. But the strategy could veterinary pathologist at the Erasmus
uses only a small part of the virus’s DNA. only be used for species under grave threat, University Medical Center in Rotterdam,
Tests targeting other genetic regions could when “you’re doing everything you possibly the Netherlands.
differentiate between birds that have been can to keep them on the planet”, he says. Ancestral versions of today’s H5N1 virus
vaccinated and those that are infected. At the moment, Stallknecht and other have been circulating among birds for about
Poultry farmers could also raise a wider wildlife researchers are trying to understand 25 years and have not yet gained the ability to
L
that these pioneers left no genetic trace in
be transmitted between mammals increase later hunter-gatherers.
the risk that it could start spreading in ike retirees who flock to the Costa del Instead, a landmark 2016 study3 identified a
humans. Kuiken would like to see increased Sol, ancient European hunter-gatherers genetic signature in 35,000-year-old remains
surveillance of people who work in the sought out Spain’s warmer climate from the Goyet cave system in Belgium, which
poultry sector to make sure anyone who during the peak of the last ice age. persisted in hunter-gatherer populations that
becomes infected is quickly isolated A pair of ancient-genome studies lived tens of thousands of years later. The
and treated. shows that humans who had holed up in the Goyet remains were associated with artefacts
If bird flu does trigger a human pandemic, Iberian Peninsula repopulated western Europe from the Aurignacian, a Europe-wide material
there are a number of tools for combating after the retreat of glaciers that covered large culture known for its elaborate cave-wall art
the disease. Approved human vaccines parts of the continent from about 26,000 to and ‘Venus’ figurines.
against avian flu exist, and the World 19,000 years ago1,2.
Health Organization monitors the evolution The research — based on newly sequenced Missing persons
of H5N1 so that these vaccines can be genomes from more than 100 individuals — But the 2016 study raised a mystery. The Goyet
updated appropriately. In the United States, offers the most detailed look yet at groups of ancestry was missing in remains from a roughly
the Biomedical Advanced Research and hunter-gatherers who lived in Europe before, 20,000-year period leading up to and during
Development Authority has a stockpile of during and after the last ice age. the peak of the ice age, before reappearing
vaccines, although the supply is too low Ancient genomes from this period are later in hunter-gatherers in western Europe.
to be used to vaccinate widely around the scarce, so “even adding one data point is “Where were these people hiding for 20,000
world. Animal studies and observational really important”, says Mateja Hajdinjak, a years?” asks Cosimo Posth, a palaeogeneticist
data in humans suggest the antiviral drug molecular biologist at the Max Planck Institute at the University of Tübingen in Germany.
Tamiflu is effective against H5N1 in people for Evolutionary Anthropology in Leipzig, To find out, Posth and his colleagues
(J. R. Smith J. Antimicrob. Chemother. 65, Germany, who was not involved in either study. sequenced ancient DNA from 116 hunter-gath-
ii25–ii33; 2010), although there have been Homo sapiens migrating out of Africa erers who lived in Europe and western Asia
reports of resistant strains (M. D. de Jong reached Europe at least 45,000 years ago between 35,000 and 5,000 years ago, and
et al. N. Engl. J. Med. 353, 2667–2672; 2005). — and possibly earlier. But the handful of analysed previously sequenced genome data
Non-pharmaceutical tools including face ancient genomes from this period suggest from hundreds more.
masks can also limit disease spread.
For a world still reeling from COVID-19, the
prospect of another pandemic is alarming.
Bird flu’s current mortality rate in humans is
around 50%, although that would be likely
to drop if the virus gained the ability to
infect cells in the upper respiratory tract — a
prerequisite for efficient human-to-human
spread. But several scientists say that an
H5N1 pandemic would probably be more
manageable than COVID-19 because of
the drugs and vaccines that are already
available, and because of tools such as
mRNA vaccines that were developed as a
JÜRGEN VOGEL/LVR-LANDESMUSEUM BONN
Ice-age refuges
SHADOW OF US CHINA
INITIATIVE LOOMS
Iberia wasn’t Europe’s only ice-age holdout,
says Posth. His team discovered a genetic
O
There is currently no ancient DNA from this away — researchers are just being pressured
period to confirm that hunch, he adds, leaving in a new way, says Jenny Lee, a social scien-
a “big empty spot on the map”. ne year after the US government ended tist at the University of Arizona in Tucson
Colin Wren, an archaeologist at the Univer- its controversial China Initiative, who studies research collaborations and
sity of Colorado Colorado Springs, says those scientists of Chinese heritage say that geop olitics. Since the initiative’s official
findings confirm his own work, suggesting that they are still being targeted unfairly shutdown, the US government has adopted
ice-age Italy was less hospitable to humans and fear for their safety. various anti-China policies. And although
than was Iberia4. Italy was once connected to The initiative — which was aimed at safe- the DoJ is pursuing fewer criminal charges,
Croatia by a now-submerged plain, so it makes guarding US laboratories and businesses it says that it will work increasingly with fed-
sense that eastern hunter-gatherers moved from espionage — created the perception of eral agencies to investigate researchers and
in, he adds. bias against researchers of Chinese descent, issue civil and administrative penalties for
The studies paint a dynamic picture of said assistant attorney-general Matthew noncompliance. Universities are also taking
European hunter-gatherer populations, which Olsen when shutting it down in February 2022, a more active role in assisting investigations
don’t always line up with cultural shifts, says although he denied that the programme had and pursuing potential wrongdoing, sources
Natasha Reynolds, a palaeolithic archaeologist actually used racial profiling. While it was tell Nature.
at the University of Bordeaux, France. They active, more than 150 people were crimi- Unfortunately, the scrutiny “has only inten-
also show that, for parts of Europe at least, the nally charged for actions such as failing to sified”, says Gang Chen, a mechanical engineer
coldest period of the ice age wasn’t as inhos- disclose funding or partnerships with insti- at the Massachusetts Institute of Technology
pitable as it’s often made out to be. “People tutions in China, according to an analysis by in Cambridge, who was arrested in January
weren’t just huddling in caves waiting for the MIT Technology Review. Nearly 90% of them 2021 under the China Initiative, only for the
glaciers to retreat,” she says. were of Chinese heritage. Many of the charges DoJ to drop the charges a year later. He and
DAVID MCNEW/AFP/GETTY
brought by the US Department of Justice (DoJ) others who have had their lives upended by
1. Posth, C. et al. Nature 615, 117–126 (2023). after the initiative’s launch in 2018 were even- the initiative have been speaking out about
2. Villalba-Mouco, V. et al. Nature Ecol. Evol. https://doi. tually dropped or dismissed, and some prose- the damage that it has done.
org/10.1038/s41559-023-01987-0 (2023).
3. Fu, Q. et al. Nature 534, 200–205 (2016). cutions ended in acquittal. “The government has not done enough” to
4. Wren C. D. & Burke, A. PLoS ONE 14, e0217996 (2019). The climate of fear and anxiety hasn’t gone ease the situation, Chen adds. The DoJ did not
SHIFTING SCIENCE
tists from China are potential spies, Lee says.
In August 2022, the US Congress passed into
COLLABORATIONS
law the CHIPS and Science Act, which earmarks
an extra US$280 billion for research and inno-
vation and includes measures designed to
tighten research security. For example, it asks
US institutions to report gifts of $50,000 or Nature analysis suggests that Russia is
more from a foreign government, down from
the previous minimum of $250,000. increasing partnerships with China and India.
In January, Congress also voted to form a
By Richard Van Noorden
A
bipartisan committee to assess the economic sharply reduced its scholarly ties with Russia,
and competitive threats that China poses to and seems to have increased research connec-
the United States. The Association of Ameri- year into Russia’s war on Ukraine, its tions with Poland.
can Universities has said that the creation of effects on global research collabora- The data available so far can only hint at
the committee signals an intent in Congress tions might be starting to show up in possible changes, which will become more
to monitor China’s influence on the nation’s the scientific literature. apparent later this year. Many of the papers
scientific enterprise. Nature analysed co-authorship published in 2022 were submitted to journals
The US government has caught genuine patterns on papers in the Scopus database. well before Western institutions halted scien-
Chinese spies stealing trade secrets and sci- The results suggest that, last year, an increased tific partnerships with Russia in response to
entific and technological developments. But share of Russia’s internationally collaborative the full-scale invasion, which began on 24 Feb-
many say that the government’s broad-brush papers had co-authors from China and India, ruary that year. And databases of scientific
scrutiny of researchers of Chinese descent is whereas the proportion co-written with US or papers will continue filling up their 2022 col-
excessive, and could actually harm national German authors fell. Ukraine, meanwhile, has lections for another month or two, owing to
Co-authorship changes
Last year, just over one-quarter of Russia’s 25
papers and review articles — as recorded in
25
The Ukrainian government has strongly dis-
Share of international papers
United Kingdom
10 nations are becoming more aware of the
competitive geopolitical aspects of research
collaboration, Flanagan adds, with countries
5
expanding export controls and introducing
restrictions on overseas collaboration in
0
activities that have been deemed sensitive to
2012 2014 2016 2018 2020 2022 national security.
A
rtificial-intelligence systems that often get them wrong. In one early test of its researchers in artificial intelligence (AI).
can churn out fluent text, such as reasoning abilities, ChatGPT scored just 26% “The chatter in the community is that this
OpenAI’s ChatGPT, are the newest when faced with a sample of questions from is really kind of astounding,” says Sébastien
darlings of the technology industry. the ‘MATH’ data set of secondary-school-level Bubeck, a machine-learning specialist at
But when faced with mathematical mathematical problems1. Microsoft Research in Redmond, Washington.
queries that require reasoning to This is to be expected: given input text, an Minerva had the advantage that it was
answer, these large language mod- LLM simply generates new text in accordance trained on mathematics-related texts. But
els (LLMs) often stumble. Take, for with statistical regularities in the words, sym- Google’s study suggested another important
instance, this algebra problem: bols and sentences that make up the model’s reason the model did so well — its sheer size.
training data. It would be startling if just learn- It was around three times the size of ChatGPT.
A line parallel to y = 4x + 6 passes ing language patterns could allow LLMs to The Minerva results hint at something that
through (5, 10). mimic mathematical reasoning reliably. some researchers have long suspected: that
What is the y-coordinate of the point But back in June 2022, an LLM called training larger LLMs, and feeding them more
where this line crosses the y-axis? Minerva, created by Google, had already data, could give them the ability, through
defied these expectations — to some extent. pattern-recognition alone, to solve tasks that
Although LLMs can sometimes answer Minerva scored 50% on questions in the are supposed to require reasoning. If so, some
these types of question correctly, they more MATH data set2, a result that shocked some AI researchers say that this ‘bigger is better’
AND BETTER.”
output cannot be trusted, and that they might year slightly revised this. In March, the Lon-
exacerbate the spread of misinformation, they don-based AI firm DeepMind argued that it’s
are expensive and suck up huge amounts of best to scale up model size and training data
energy. together, and that smaller models trained
Critics argue that, ultimately, big LLMs will um-sized model reached 43% and the largest on more data do better than bigger models
never be able to mimic or acquire skills that breached the 50% mark. trained on fewer data5 (see ‘Different routes
allow them to answer reasoning problems con- The biggest model also used the least to scale’). For example, DeepMind’s Chin-
sistently. Instead, some scientists say, smaller, amount of fine-tuning data — it was fine- chilla model has 70 billion parameters, and
more energy-efficient AI is the way to make tuned on only 26 billion tokens, whereas the was trained on 1.4 trillion tokens, whereas its
progress — inspired, in part, by the way the smallest model looked at 164 billion tokens. 280-billion-parameter Gopher model, was
brain seems to learn and make connections. But the biggest model took a month to fine- trained on 300 billion tokens. Chinchilla out-
tune, on specialized hardware that had eight performs Gopher on tasks designed to evalu-
Big, bigger, better? times as much computing capacity as used ate what the LLM has learnt.
LLMs such as ChatGPT and Minerva are giant for the smallest model, which was fine-tuned Scientists at Meta Research built on this
networks of computing units (also called arti- for only two weeks. Ideally, the biggest model concept in February with their own small-pa-
ficial neurons), arranged in layers. An LLM’s would have been fine-tuned on more tokens, rameter model called LLaMA, trained on up
size is measured in how many parameters it says Ethan Dyer at Google Research in Moun- to 1.4 trillion tokens. The 13-billion-parameter
has — the adjustable values that describe the tain View, California, who is a member of the version of LLaMA outperformed ChatGPT’s
strength of the connections between neurons. Minerva team; this could have led to an even forerunner GPT-3 (175 billion parameters), the
Training such a network involves asking it to better performance. But the team felt that the researchers say, whereas the 65-billion-param-
predict masked portions of a known sentence computational expense wasn’t feasible. eter version was competitive with Chinchilla
and tweaking these parameters so that the and even PaLM (see go.nature.com/3kje2fj).
algorithm does a little better next time. Scaling laws Last October, Ethan Caballero at McGill
Do this repeatedly over billions of That the biggest Minerva model did best was University in Montreal, together with Rish
human-written sentences, and the neural net- in line with studies that have revealed scaling and others, reported finding more complex
work learns internal representations that model laws — rules that govern how performance relationships between size and performance6.
how humans write language. At this stage, an improves with model size. A study in 2020 In some instances, multiple power laws can
LLM is said to be pre-trained: its parameters
capture the statistical structure of written lan- THE DRIVE TO BIGGER AI MODELS
guage that it saw during training, including all The scale of artificial-intelligence neural networks is growing exponentially, as measured
by the models’ parameters (roughly, the number of connections between their neurons)*.
the facts, biases and errors in the texts. It can
then be ‘fine-tuned’ on specialized data. Language Image generation Vision Other
To make Minerva, for instance, research- 1 trillion
ers started with Google’s Pathways Language
100 billion
ADAPTED FROM OUR WORLD IN DATA, AND FROM J. SEVILLA ET AL. PREPRINT
100 million
case, the tokens were gleaned from English and
(log scale)
COMPANY WILL
says. “Which I think is a reasonable thing.” computing time8. And in November, the US
Minerva also took advantage of a key inno- Department of Energy awarded supercom-
vation called chain-of-thought prompting.
The user prefixes their question with text that NOW ATTEMPT TO puting time to a project from Rish and her
colleagues, to build large models to study their
includes a couple of examples of questions and
solutions, including the reasoning — illustrat-
ing a typical chain of thought — that led to the
DEPLOY LLMS.” behaviour. “We hope to train a Chinchilla-like
70-billion-parameter model — not necessarily
the largest, but rather the one whose perfor-
answers. During inference, the LLM takes its mance scales more effectively,” says Rish.
cues from this context and provides a step-by- nally model the intentions of others. “These Regardless of who gets to build them, LLMs
step answer that looks surprisingly like reason- models that are doing nothing but predicting also raise concerns about electricity consump-
ing. This doesn’t require updates to the model’s sequences develop an extraordinary range of tion. For example, Google reported that train-
parameters, and so doesn’t involve the addi- capabilities, including theory of mind,” says ing PaLM took about 3.4 gigawatt-hours over
tional computing power that fine-tuning needs. Agüera y Arcas. But he concedes that these about two months. That’s the annual energy
The ability to respond to chain-of-thought models are error-prone, and he, too, is unsure consumption of about 300 US households.
prompts shows up only in LLMs with more than whether scaling alone, although it seems nec- Google trained PaLM at its Oklahoma data cen-
about 100 billion parameters. Such discover- essary, is sufficient for reliable reasoning. tre, which it said operated on 89% carbon-free
ies have helped bigger models to improve in Even when LLMs get the answers right, how- energy, being powered mostly by wind and
accordance with empirical scaling laws, says ever, there is no understanding involved, says other renewable sources. But a survey of indus-
Blaise Agüera y Arcas at Google Research in Chollet. “When you try to probe it a little bit, try AI models has shown that the majority are
Seattle, Washington. “The bigger models keep it becomes immediately obvious that it’s all trained using electricity grids that are still
doing better and better.” empty. ChatGPT has no model of what it is talk- largely powered by fossil fuels9.
ing about,” he says. “You’re watching a puppet Chollet’s concern is that as multiple firms
Reasonable concerns show and believing the puppets are alive.” begin training and using bigger models,
François Chollet, an AI researcher at Google So far, LLMs still make absurd mistakes that they could start to suck up more electricity.
in Mountain View, is among the sceptics who humans never would, says Melanie Mitch- “Every big tech company will now attempt to
argue that no matter how big LLMs become, ell, who studies conceptual abstraction and deploy LLMs into their products, regardless of
they will never get near to having the ability analogy-making in AI systems at the Santa Fe whether it’s a good idea or not,” he says.
to reason (or mimic reasoning) well enough Institute in New Mexico. This has contributed to
to solve new problems reliably. An LLM only the many concerns about the safety of unleash- Smarter and smaller?
appears to reason by using templates that it ing LLMs without guardrails into society. For many scientists, then, there’s a pressing
has encountered before, whether in the train- An issue with the debate over whether LLMs need to reduce LLM’s energy consumption
ing data or in the prompt, he says. “It cannot, can ever tackle genuinely new, unseen prob- — to make neural networks smaller and more
on the fly, make sense of something that it has lems is that we have no way of comprehensively efficient, as well as, perhaps, smarter. Besides
Number of parameters
500 a massive 540
answered 230,768 queries (many fewer than billion parameters.
ChatGPT, which hit 100 million active users a 400
(billions)
month in February), it consumed, on average, Some relatively smaller
models, such as DeepMind’s
1,664 watts10. 300
Chinchilla, are trained on
For comparison, our own brains are much vastly more tokens‡.
200
more complicated and larger than any LLM, OpenAI’s GPT-3 has
with 86 billion neurons and some 100 trillion 175 billion parameters.
100
synaptic connections. And yet, the human
brain consumes somewhere between 20 and 0
50 watts of power, says Friedemann Zenke at 0 200 400 600 800 1,000 1,200 1,400 1,600
the Friedrich Miescher Institute for Biomedical Number of tokens trained on
(billions)
Research, Basel, Switzerland.
*Parameters: roughly, the number of connections between neurons. †Compute: number of computing operations executed during
So some researchers hope that mimicking training, measured as floating point operations (flops). ‡Tokens: words, digits or other units of information that models are trained on.
CHRISTOPHE KETELS/ALAMY
DISEASES IN THE ROOM
Dance clubs and other indoor spaces in Belgium will soon post information about air quality.
The COVID pandemic has brought attention to the importance of healthy indoor air,
and could spur countries to make lasting improvements. By Dyani Lewis
B
ars in Belgium could be among the indoor spaces safer in the face of infectious developing standards that take infection risk
healthiest places to have a drink, diseases caused by viruses such as SARS-CoV-2 into account by June 2023.
come July. That’s when a new law and influenza. Last June, the United Kingdom’s leading
goes into effect, requiring public In March 2022, the US government launched engineering bodies released a report, com-
venues to meet air-quality targets a Clean Air in Buildings Challenge to spur missioned by the government, that called for
and display real-time measure- building owners and operators to improve enforceable clean-air regulations to make
ments of carbon dioxide concen- their ventilation and indoor air quality. In buildings safe over their entire lifetimes (see
trations — a proxy for how much October last year, the state of California passed go.nature.com/3kgsmjt). Other countries are
clean air is piped in. a law requiring all school buildings to provide also taking steps — for example, by deploying
Consumers in Belgium will get even more clean indoor air. And in December, the White air-quality monitors in classrooms.
information in 2025, when gyms, restau- House announced that all federal buildings — Specialists in indoor air quality are buoyed
rants and indoor workspaces must all show some 1,500 in total — would meet minimum by the prospect that the pandemic could bring
air-quality ratings given through a certifica- air-safety requirements. Also in December, lasting improvements to the air we breathe
tion system. In the event of a future pandemic, the American Society of Heating, Refrigerating indoors. The SARS-CoV-2 virus that causes
Belgium’s rating system could determine and Air Conditioning Engineers (ASHRAE) — COVID-19 is spread mainly in indoor spaces,
whether or not a venue is closed. a construction-industry body whose recom- as are the pathogens that lead to other infec-
The law, enacted in July 2022, is the boldest mendations are adopted into law through tious diseases, such as chicken pox, measles,
in a string of moves that countries have taken local building codes in the United States tuberculosis and seasonal influenza.
in the wake of the COVID-19 pandemic to make and elsewhere — announced that it would be “There’s never been, in history, so much
Centuries of development led to the bicycle’s spoked wheel — which brought mobility and freedom for many.
T
travel and improved trade. Wheels with wire
spokes led to the bicycle, a source of freedom
en thousand years ago, the most The spring, for example, she characterizes for many who couldn’t afford carriages or cars.
advanced tools were made of chipped as “humanity’s first tool that allowed us to
stone. Today, much technology is so store energy and then release it when we Gear change
complicated that it’s almost “indistin- wanted”. She charts its development from Serrated wheels became gears, tools for chang-
guishable from magic”, to borrow Arthur bows and arrows to the vast steel coils that help ing the direction and magnitude of forces that
C. Clarke’s phrase. How did we get here? In Nuts skyscrapers to withstand earthquakes, and the prompted advances of the Industrial Revolu-
and Bolts, structural engineer Roma Agrawal silicon hairsprings that maintain the accuracy tion and beyond. In the late nineteenth century,
investigates the story of basic technological of the most exclusive mechanical watches. for instance, Josephine Cochran used wheels
developments, and shows how intimately With a clear, lively and engaging style — and and gears to develop the first commercially
entwined they are with humanity’s own history. viable dishwasher — one of myriad appliances
She contends that the modern world has Nuts and Bolts: Seven that would cut the time spent on housework
its foundations in seven humble inventions: Small Inventions That and free many women to enter the workforce.
the nail, wheel, spring, magnet, lens, string Changed the World (in a And wheels are ancestors of the gyroscopes
Big Way)
and pump. Building on her lifelong fascina- that steer the International Space Station. As
Roma Agrawal
tion with opening things up to see what makes Hodder & Stoughton Agrawal says, 5,000 years of change have been
them work, she explores the science of each of (2023) driven by constant reinvention of the wheel.
these mini ‘machines’, and follows their history Refreshingly, this world-trotting tale
from ancient beginnings to manifestations of focuses on “the often hidden or unacknowl-
modern engineering, small and large. edged contribution of minoritised people”.
Comment
AKHTAR SOOMRO/REUTERS
A family navigates flood waters to reach a village in Mehar, Pakistan, after heavy rains in August 2022.
L
Shifting weather, changing ast year, around two-thirds of Pakistan more devastating in drylands than in wetter
was affected by widespread flash flood- areas. Surges can result from relatively small
settlement patterns and a ing, with more than 1,500 people killed amounts of rain, as little as 10 millimetres in
lack of preparedness mean and around 33 million made homeless. one hour. By comparison, floods in wetter
Almost 2,000 people died in flash regions typically follow more prolonged
that dryland areas are floods across Africa, and parts of the United bouts of rainfall.
most at risk from flooding. Arab Emirates, Iran, Saudi Arabia, Qatar, Rapid run-off also erodes soils, adding
Researchers need to focus on Oman and Yemen were inundated with water. sediment and debris to the water. The dan-
Flash floods are a growing threat in some of gers are greatest in mountainous areas, where
data collection, early-warning the world’s driest regions. Deluges can trigger water can gush suddenly through gullies and
systems, flood protection sudden and rapid torrents of run-off that flow down slopes. For example, a flash flood last
and more. down dry river beds and rocky channels. year in Datong town in Qinghai province,
Because parched soils repel water rather China, washed away more than 1,500 homes
than allowing it to soak in, flash floods can be in less than one hour.
in drylands (mm)
that, since 2000, such regions experienced 80 parched soils. 100
less than half (47%) of deadly flash floods
globally, yet saw almost three-quarters (74%)
of related deaths (see ‘Global flash-flood dis- 40 50
asters’). The majority of these floods (87%)
and associated deaths (97%) occurred in
low- and middle-income countries. 0 0
SOURCE: EM-DAT, CRED/UC LOUVAIN (WWW.EMDAT.BE); ANALYSIS BY J. YIN ET AL.
A slew of other factors will put many more 1980s 2010s 1980s 1990s 2000s 2010s
people at risk from flash floods in future (see
‘Drylands: flash-flood risks’). Climate change More people Bigger cities
Populations are rising in drylands — from 40% of the Urban expansion is rapid in dry areas, notably in the
is making such events more intense and fre- global total in 2000 to 44% in 2020. Middle East, India and China.
quent1–3. In parts of Pakistan, for example, the 4 30
People living in drylands (billions)
FRED GREAVES/REUTERS
Vehicles cross a bridge over the Yolo Bypass in Sacramento, California, where weirs divert flood waters away from houses onto floodplains.
disaster-management agencies with real-time areas — as was the case in Columbia, South Car- divert flood waters away from houses and
information around flash-flood threats (see olina, which experienced extensive damage onto natural floodplains. Large residential
go.nature.com/3xsw4fg). So far, 28 warning from a flash flood in 2015. And dams and levees areas should adopt ‘sponge city’ techniques
systems are up and running, with another 39 in built to hold back small floods could offer a that reduce run-off, such as permeable pave-
development. Eight of the operational systems false sense of security from rare, extreme ments, green roofs, rainwater harvesting and
are in drylands, together with ten of those still inundations7, including one that flooded the swales (ditches). These are being installed
in development. More dryland nations need Atacama region in South America in 2015. in cities throughout China, including Xining
to be engaged. Failure of one protection element, such as a in Qinghai province, the largest city on the
Forecasting of flash floods in drylands will reservoir, can send flood waters cascading Tibetan Plateau.
need tailoring to local contexts, including soil Researchers should aim to quantify how
types, terrains and sediment loads. Where data “Past experience is effective natural features are at storing and
are scarce, uncertainties and limits need to conveying water, and how resilient they
be better understood. Use of wireless sensors important for recognizing are to extreme floods. Local differences
and alternative sources of local data, such as risks and adapting in soil and vegetation conditions must be
use of social media and crowdsourcing, need behaviours.” considered. More needs to be known about
to be explored. how the systems degrade and how to main-
tain them. Promising projects include the
Boost resilience to sudden floods downstream, as was narrowly averted at Cal- World Bank’s Global Program on Nature-
Dams, barriers and dikes will need to be ifornia’s Oroville Dam in 2017. The environ- Based Solutions for Climate Resilience and
installed in drylands to protect settlements. mental impacts need to be understood, such the Sindh Resilience Project in Pakistan, as
For example, China has been building thou- as those resulting from stopping the silt and well as government-led water and soil con-
sands of kilometres of levees along the main sediment that fertilize the floodplain. servation initiatives in the Loess Plateau in
stream and tributaries of the Yellow River. This Nature-based solutions are cheaper. For north-central China.
is expensive, however, involving hundreds of example, in Pakistan, the government of Land-use regulations need to be tight-
projects with costs ranging from millions to Khyber Pakhtunkhwa province has restored ened, such as by preventing informal devel-
billions of dollars. almost 350,000 hectares of forests in its opment in floodplains. Flood-protection
Researchers need to examine the trade- ‘Billion Tree Tsunami’ planting drive. In the standards for buildings need to be improved.
offs. For example, protection measures might Yolo Bypass project in Sacramento, Califor- For example, the International Residential
encourage more development in flood-prone nia, levees are being replaced with weirs to Code, used as the basis of many national and
*Based on the Köppen climate classification, in which regions other than ‘dry’ are classed as ‘wet’. The authors declare no competing interests.
Correspondence
ChatGPT: not all Brazil: plan for zero PhD training: HOW TO SUBMIT
languages are equal vegetation loss in the exposing obstacles CORRESPONDENCE
Cerrado to reform Please consult the full author
The machine-learning system guidelines and policies at
ChatGPT has a remarkable Brazil’s new government aims Training for a PhD must be go.nature.com/cmchno before
capacity to generate to achieve zero deforestation reformed if it is to meet society’s e-mailing your submission
sophisticated and intelligible in the Amazon rainforest. This expectations (see Nature 613, to correspondence@nature.
text, with far-reaching welcome initiative should 414; 2023). At Lehigh University, com. It should not be sent as an
implications for research be extended to the Cerrado, we investigated the feasibility attachment.
development and dissemination the world’s most biodiverse of implementing a model The following cannot be
(see Nature 614, 214–216 woodland savannah. solution known as the Pasteur considered: technical comments
(2023); Eva A. M. van Dis et al. The Cerrado covers 2 million Partnership PhD, which hinges on peer-reviewed research
Nature 614, 224–226; 2023). square kilometres and is home on use-inspired research and papers; responses to articles
However, current debate over to more than 5% of all Earth’s professional development in published in journals other than
the technology focuses on users’ known plant and vertebrate partnership with industry (see Nature; contributions that present
experiences in English. I asked species. But agricultural go.nature.com/3jo7pfz). primary research data; and
ChatGPT a set of neuroscience monocultures have expanded More than 70% of the students submissions that do not comply
questions in English; when I steadily across the region, admitted to our science, with the section’s strict length and
asked for answers to the same which is now a major producer technology, engineering and style requirements. Submissions
set in French and Arabic, the of commodities, with the loss mathematics PhD programmes must not be under consideration
results were surprising. of almost half its area of natural in the past year were interested elsewhere.
French and Arabic are among vegetation. The extent of in this option but only 3% Please make clear in your
the world’s most commonly deforestation exceeds that in enrolled, because industry proposed text its pertinence
spoken languages and they the Amazon and in the Atlantic partnerships are hard to to Nature’s global readership.
have a widespread presence Forest. Pesticides, excessive organize. Governments should Ensure that you include a link
on the Internet. However, the water use and dam construction help to meet this training to any article under discussion
richness of ChatGPT’s response have damaged the Cerrado’s challenge, which is driven by and references or links for fact-
and the intelligibility of its freshwater systems. The rapid societal needs. checking of all statements, in
writing in both languages were and aggressive occupation Senior faculty members often addition to the limited number
notably inferior to those in of the region’s lands has led see no need to change the system. of references necessary for
English. In Arabic, answers to conflicts with Indigenous Younger researchers are willing publication.
sometimes included inaccurate people and other traditional to adapt but are constrained by
or nonsensical sentences. populations. tenure, promotion and funding
Without details of the The Cerrado’s remaining expectations that reward
quality of the data used to protections for natural conventional research output.
train ChatGPT and other large vegetation depend on the Academic performance criteria
language models, it is hard to consolidation of an existing need to be revised to allow
gauge the scale of such bias. regional conservation network training time and to incorporate
Under-studied languages could that connects public and private innovative research.
end up being excluded from the protected areas, Indigenous University leaders are
chatbot revolution. Dialogue lands and portions of private too often preoccupied with
between developers and users of lands that require special intellectual property and an
large language models must be protection under Brazilian open research ethos. And
transparent to ensure that this legislation. This will not harm short-term profitability by
does not happen. Brazil’s economy, because publicly traded companies takes
modern technologies and priority over industrial research
Mohamed L. Seghier Khalifa improved land use can boost and its associated financial
University of Science and the region’s agricultural commitments. To ‘turn the PhD
Technology, Abu Dhabi, United output without threatening its tanker’, these misalignments
Arab Emirates. biodiversity. must be addressed.
mseghier@gmail.com
Ricardo B. Machado, Ludmilla Himanshu Jain, Nathan Urban
M. S. Aguiar University of Brasilia, Lehigh University, Bethlehem,
Brasilia, Brazil. Pennsylvania, USA.
rbmac@unb.br h.jain@lehigh.edu
Work Your
story
Send your careers story
to: naturecareerseditor
@nature.com
ILLUSTRATION BY BEX GLENDINING
Replacing historical chemical names, such as the Grignard reagent, with descriptive ones helps to decolonize chemistry courses.
CHEMISTRY REACTS
TO CHANGE
Textbooks imply that chemistry is done only by white men. Curricula
must change to better reflect reality. By Katharine Sanderson
F
lick through a chemistry textbook of ancient Egyptians, Chinese medicine and To better reflect this breadth, chemis-
at school or university, and you’d be distillation methods developed in early Arab try departments across the globe need to
forgiven for thinking that chemistry cultures. Contributions to modern chemis- revamp curricula, say those who are push-
— touted as the central science that con- try are truly global, meaning that low- and ing for change. It must and will happen, says
nects all other physical-science fields — middle-income countries can take advantage Avtar Matharu, director of the master’s course
is the domain of almost exclusively white men. of chemical advances in areas such as agricul- in green chemistry at the University of York,
Yet chemistry has origins going back millennia ture and medicine as they seek to develop their UK. Matharu, who is Sikh, was born in Nairobi
— such as in the papyrus-making procedures economies. and moved to the United Kingdom as a child.
But wholesale rewriting and reprinting of text- accept change more readily, in her experience,
books, as well as adopting a different name for but “staff need to be persuaded, sometimes,
a historically well-known procedure, is likely by rational argument and an appeal to the
to be a slow process, he adds. values of the liberal institutions. Some staff
Smith emphasizes that the department isn’t Avtar Matharu helps students identify biases. will never be convinced, and we have to live
trying to dictate to lecturers what they must with that too”, she says.
include in their teaching material. Instead, “it of the corresponding authors and realized that Uleanya has showcased her chemistry-
has been a bit more about role modelling the there were hardly any from the countries where decolonization resource at a number of con-
contexts of chemistry”, he says. For instance, coffee is actually produced. Now, for all the ferences on equity, diversity and inclusion in
lecturers could use examples of chemistry that projects in his postgraduate course on green science, and interest has been high, she says. A
solves a problem in low-income countries, or chemistry, the students must write a narrative common concern that she hears is that decolo-
of science done by researchers outside the about the trend they see in cited authorship. nizing the curriculum means a loss of quality.
countries that conventionally dominate the “That’s really eye-opening,” says Matharu. Her advice is to start slowly, including a few new
literature, he suggests. “When they start to write their narrative, or even examples. “It has nothing to do with losing the
see the plot, the plot should already encourage chemistry we have,” she says, but rather about
Charting prejudices them that their literature is biased.” Matharu including things to make chemistry more
Matharu isn’t convinced that this kind of colla- now gives points, which count towards a stu- global. “Where everybody can feel a sense of
tion exercise is ambitious enough. “The easiest dent’s final degree mark, for completing this belonging. And then to build better chemists.”
thing to do is find lots of examples in the liter- exercise. “It’s not something that’s too onerous,”
ature for minority ethnic researchers,” he says, he says, “but it’s something that starts to change Katharine Sanderson is a locum senior
but describes this approach as too simple. If their behaviour; it gets them to think.” reporter at Nature.
N
early 240 data scientists have proved designed,” Seo says. “But visualization is only grants. And it’s an even smaller fraction of the
themselves nimble enough at their one of the representation methods. We can number of individuals with visual disabilities
work to be certified instructors for represent data in multimodal ways.” overall: in 2017, some 7 million people in the
the ‘tidyverse’, a popular package for There are no good estimates of how many United States (2.17% of the population) were
manipulating and visualizing data in scientists with low vision are working today, living with ‘uncorrectable’ loss of visual acu-
the R programming language. JooYoung Seo is but a 2020 study1 found that fewer than ity or with blindness2. “If the goal is parity with
unique among them — the first blind instructor 100 of 52,124 researchers applying for fund- prevalence in the US — which I argue it should
to gain certification. ing from the US National Institutes of Health be — we aren’t close,” she says.
Most tidyverse users present data in the form (NIH) in 2018 self-identified as having a visual
of charts and graphs. Seo, an information and impairment. “It’s a fraction of a fraction,” says Avoiding workarounds
learning scientist at the University of Illinois at Bonnielin Swenor, an epidemiologist and direc- That’s in part because, all too often, even the
Urbana–Champaign, who lost his sight at age tor of the Disability Research Center at Johns most basic research activities — accessing the
ten owing to glaucoma, uses touch, sound and Hopkins University in Baltimore, Maryland, literature, submitting papers, attending con-
speech. He is one of a small but growing group who led that work. That’s far short of the total ferences and reviewing manuscripts — require
of researchers working to make science more number of scientists with vision disabilities, time-intensive, personalized workarounds.
accessible to people with limited vision. “The Swenor adds, because ableist hurdles prevent “Blind scientists probably have a way that
overarching challenge is that content is visually many scientists from applying for research works for them,” says Daniel Hajas, an
I
Where I work ’m an astronaut with the European
Space Agency. Last year, I spent five
space, but also on Earth.
The photo was taken in the Japanese
Samantha months on the International Space
Station (ISS) — from late April to mid-
Experiment Module. This is the largest
single ISS module and the least cramped,
Cristoforetti October — and spent the last month as
station commander. Before returning to
so we often use it for talking to the media or
to schoolchildren. When we communicate
Earth, my team and I set aside time for a with them, we use props, such as the balls
water ‘play date’. Here, inside the ISS, I am behind me, which are models of planets and
demonstrating how water behaves in zero the Moon. The round thing behind me is the
gravity. module’s airlock. We use it for deploying
You can use little tricks to make sure satellites, as well as hardware such as
the water stays where you want it. Surface scanners for science experiments.
tension keeps the water bubble together, This was my second time on the ISS. I
and you can move it by using a straw to adapt quickly to space — I really enjoy that
pull on it gently, or by blowing on it. If the feeling of weightlessness. It’s a lot harder for
bubble is small enough, you can drink it. We me to come back to Earth.
recycle all the water onboard. I don’t know when I’m going up there
Weightlessness is not just exhilarating, it’s again — or if I will. We’ll see how the US-led
also an opportunity to study fundamental Artemis programme — which will return
physics. There’s a lot of research on the people to the Moon in the coming decade —
space station on fluid dynamics. One study evolves. Maybe there will be an opportunity
I was personally involved in looked at for me.
the sloshing behaviour of different kinds
of fluid and mixes of fluids and gases in Samantha Cristoforetti is a European Space
Photographed containers. The results are important for Agency astronaut who lives in Cologne,
by ESA/NASA. designing fuel tanks, especially for use in Germany. Interview by Linda Nordling.
talks to the brain the need for intracranial surgery7. Hsueh and
colleagues have extended the applications
of this molecular tool by using it to control
the activity of (to pace) an entire organ and
Yoni Couderc & Anna Beyeler
to determine any heart-to-brain influences
During periods of anxiety, the brain affects the heart, but does on anxiety.
a racing heart also talk to the brain to cause anxiety-related The authors applied their approach to test
whether an increase in heart rate to 900 beats
behaviour? Use of a light-stimulated pacemaker in mice shows per minute (36% higher than the baseline
that it does, and pinpoints a brain region involved. See p.292 frequency) could alter levels of anxiety in
freely behaving mice. Hsueh et al. used two
methods to assess anxiety — placing the ani-
Have you ever been so anxious that you could light-sensitive protein, the opsin ChRmine. mals in a maze or in an open field, both of which
feel your heart racing in your chest? This When illuminated with red light, positively include safe and exposed areas. The authors
tachycardia is one of the main symptoms charged ions flow through this protein, found that optically induced tachycardia led
of anxiety1, and can be so intense that the which depolarizes cells that express it. In the to a greater avoidance of exposed areas in both
person experiencing it sometimes mistakes authors’ experiments, the cells targeted were assays, reflecting an increase in anxiety-related
it for a heart attack. Experimental research heart muscle cells, the depolarization of which behaviour. This is an unequivocal demon-
has revealed numerous pathways that con- triggers muscle contraction. stration that, at least in mice, heart rate can
vey signals from the brain to the heart. But By mounting a red micro-light-emitting affect anxiety, and can probably influence
in both clinical psychiatry and fundamental
neuroscience, the reverse — the effect of heart
rate on emotions — has remained a debated Blinking laser
Fabric vest
question for almost a century2. Hsueh et al.3
address this issue on page 292 , identifying a
mechanism by which the brain detects heart Brain
rate, and showing how this, in turn, controls Blinking Posterior
emotional behaviour. micro-LED insula
Interoception is the continuous percep- Heart
tion by the brain of internal signals in the
body, including those from the respiratory,
gastrointestinal and cardiac systems4. In
people who have anxiety disorders, sensitiv-
ity to these internal signals — especially heart Red light Blue light
Outside cell
rate — is altered1. Studies in animals have high-
lighted the link between cardiac changes and ChRmine iC++
emotional states5,6, but whether an increased
Inside cell Positively Negatively
heart rate contributes directly to anxiety had charged ions charged ions
remained unclear.
Tachycardia Tachycardia-induced
So far, only nonspecific electric shocks,
Anxiety-related behaviours anxiety blocked
vagal-nerve stimulation and pharmacologi- Activity in posterior insula
cal approaches — all of which involve major
side effects — have been used to increase or
decrease heart rate and to evaluate its effect on
Figure 1 | Controlling anxiety with a non-invasive optical pacemaker. Hsueh et al.3 studied the effects of a
emotions. Researchers have lacked tools with
racing heart on anxiety-related behaviour in mice. They injected the animals with a heart-selective viral vector
the necessary temporal and spatial resolution
encoding a red-light-sensitive opsin protein called ChRmine. They dressed the mice in a vest containing a red
to adequately investigate the effects of heart
micro-light-emitting diode (micro-LED), blinking at 900 beats per minute, that was fastened to the animals’
rate on anxiety. chests over their hearts. The red light activated ChRmine in heart muscle cells, opening up the protein to let
The first of Hsueh and colleagues’ break- positively charged ions flow through it. This caused depolarization of the cells and an increase in the animals’
throughs was the development of such a heart rate (tachycardia). This, in turn, led to an increase in anxiety-related behaviours, and activated the
tool: a non-invasive optical pacemaker. It was posterior insula (among other brain regions). Hsueh et al. then inhibited the posterior insula using a blue-
based on the systemic delivery into mice of light-sensitive opsin, iC++, through which negatively charged ions flow. They activated iC++ using a blue laser,
a viral vector carrying a gene that encodes a while optically increasing heart rate. This prevented tachycardia-induced anxiety.
The authors’ comprehensive study raises new dsRNA serves as the origin of small regula- dsRNA
questions, and opens up areas for research. For tory RNAs that include microRNAs (miRNAs)
example, the neural circuits and mechanisms and short-interfering RNAs (siRNAs). In both
that allow the posterior insula to be activated cases, the dsRNA precursors are cleaved by a Platform
by tachycardia — as well as the circuits that particular class of enzyme that is characterized
PAZ
induce anxiety behaviours — have yet to be by having what is termed an RNase III domain3.
identified. The miRNAs are processed from stem-loop-
Another unexplored aspect is the long- structured precursors, also described as a hair-
term effect of days (or weeks) of optically pin, and they require the consecutive action of Figure 1 | Structural clues to how human Dicer
induced tachycardia — a question with sub- two RNase III enzymes. In animals, the enzyme enzyme functions. Some small RNAs, such as
stantial clinical implications. This study lays Drosha conducts the first cut and Dicer the microRNAs, that function in gene silencing undergo
the foundation for testing whether chronic second. Both enzymes define the ends of a a maturation step in which a double-stranded RNA
increases in heart rate induce long-term short double-stranded miRNA intermediate (dsRNA) is cleaved by Dicer. Lee et al.1 reveal that
changes in the brain, which could under- from which one miRNA strand is selected and an RNA sequence that the authors term GYM has a
lie harmful levels of anxiety. Testing this incorporated into the protein complex RISC, role in facilitating this process. The authors’ second
hypothesis would raise technical challenges, in which the RNA directly binds to a member paper2 presents structural data obtained using cryo-
electron microscopy, which captured the enzyme
because the micro-LED vest used here is not of the Argonaute protein family.
at the stage associated with RNA cleavage. This
suitable for such long periods of stimulation. The siRNAs are typically processed from
structure reveals the orientation of the dsRNA with
Finally, from a translational and therapeu- the ends of long dsRNAs by only one enzyme,
respect to various domains of Dicer, a subset of which
tic perspective, it might be possible to design Dicer 4. This scenario, however, requires are shown here: helicase domain, RNase III (RIII)
experiments to slightly decrease heart rate. that Dicer moves along the dsRNA. Therefore, domain, dsRNA-binding domain (dsRBD), platform
Would this change reduce anxiety-related Dicer enzymes can generally be divided into domain and PAZ domain. The helicase domain was
behaviours? Hsueh and colleagues’ work what are called non-processive and processive not clearly visible in the structure, which suggests
has provided the means to investigate this enzymes, depending on whether they gener- that it is in a flexible conformation at this step.
prospect. ate more than one small RNA from a dsRNA (Adapted from Fig. 5 of ref. 2.)
200
particularly amenable to this pairing mecha-
nism because hydrogen is the lightest chemical
element, which means it has the highest vibra-
100
tion frequency. According to theory4, this high
1. Li, M., Shen, F. & Sun, X. Sci. Rep. 11, 12288 (2021). frequency should increase the temperature at
2. Bernath, P., Boone, C. & Crouse, J. Science 375, 1292–1295
(2022).
which a material can superconduct. 1911
3. Solomon, S. et al. Proc. Natl Acad. Sci. USA 119, In 1968, physicist Neil Ashcroft predicted
e2117325119 (2022).
0
that pure hydrogen could superconduct 0 100 200 300
4. Solomon, S. et al. Nature 615, 259–264 (2023).
5. Molina, M. J. & Rowland, F. S. Nature 249, 810–812 (1974).
at room temperature5. However, hydrogen Pressure (GPa)
6. Solomon, S., Garcia, R. R., Rowland, F. S. & Wuebbles, D. J. becomes metallic only when H2 molecules
Nature 321, 755–758 (1986). are dissociated at intense pressures of around Figure 1 | The road to high-temperature
7. Molina, M. J., Tso, T.-L., Molina, L. T. & Wang, F. C.-Y.
Science 238, 1253–1257 (1987).
500 gigapascals (1 GPa is 109 Pa)6. This is about superconductors. Researchers have been trying
8. Brasseur, G. & Granier, C. Science 257, 1239–1242 (1992). five million times that of atmospheric pres- to achieve a superconducting (zero electrical
9. Abbatt, J. P. D., Lee, J. K. Y. & Thornton, J. A. sure, and extremely difficult to achieve with resistance) state at ambient temperatures and
Chem. Soc. Rev. 41, 6555–6581 (2012). pressures for more than a century. Several
10. McNeill, V. F., Loerting, T., Geiger, F. M., Trout, B. L.
current experimental techniques. Ashcroft
superconductors have been reported, albeit at
& Molina, M. J. Proc. Natl Acad. Sci. USA 103, 9422–9427 later suggested that hydrogen-rich com-
(2006).
very low temperatures. In 1968, it was predicted
pounds could become superconducting at
11. Zobrist, B., Marcolli, C., Pedernera, D. A. & Koop, T. that pure hydrogen could superconduct at room
Atmos. Chem. Phys. 8, 5221–5244 (2008). lower pressures than can pure hydrogen, temperature5. Dasenbrock-Gammon et al.3 provide
12. Keith, D. W., Weisenstein, D. K., Dykema, J. A. & owing to the chemical compression induced possible evidence that a hydride compound
Keutsch, F. N. Proc. Natl Acad. Sci. USA 113, 14910–14914 by the other elements7. superconducts at 294 kelvin and 1 gigapascal
(2016).
Experiments have since shown that (109 Pa), close to ambient conditions. (Adapted from
The authors declare no competing interests. several polyhydride compounds transition Fig. 1 of ref. 20, with extra data from refs 10, 11.)
Fatty acids prime the lung that required lipid breakdown to generate the
metabolic intermediate acetyl coenzyme A
YYYLS
nature.com/srep
A116069
©
2
0
2
3
S
p
r
i
n
g
e
r
N
a
t
u
r
e
L
i
m
i
t
e
d
.
A
l
l
r
i
g
h
t
s
r
e
s
e
r
v
e
d
.
Article
https://doi.org/10.1038/s41586-022-05676-z John J. Tobin1 ✉, Merel L. R. van ’t Hoff2, Margot Leemker3, Ewine F. van Dishoeck3,
Teresa Paneque-Carreño3,4, Kenji Furuya5, Daniel Harsono6, Magnus V. Persson7,
Received: 2 June 2022
L. Ilsedore Cleeves8, Patrick D. Sheehan9 & Lucas Cieza10,11
Accepted: 21 December 2022
英文杂志全球首发QQ群:855583774
We observed V883 Ori (located in the Orion molecular clouds) using sublimate at a similar temperature (roughly 130 K)3. C17O, however, is
the Atacama large millimetre/submillimetre array (ALMA) at roughly more extended than water and methanol because it sublimates at
0.1″ resolution (40 AU diameter at its distance of 400 pc; ref. 11). around 25 K (ref. 16) (Fig. 2). The apparent depression of emission in the
The full extent of the proto-planetary disk surrounding V883 Ori is centre of some images in Fig. 2 is due to the opacity of the continuum,
well-resolved in our observations, with the dust and gas emission absorbing gas emission at radii less than 40 AU. The high dust optical
extending to roughly 125 and 320 AU, respectively6. The disk around depth at smaller radii, even for more-evolved disks17, may obscure
V883 Ori is young, similar to the well-known HL Tau system12, and the molecular line emission coming from the disk midplane and make the
disk mass of roughly 0.02–0.09 M⊙ is about ten times greater than midplane water emission of lower luminosity systems difficult to
the surrounding envelope mass6,13. The accretion burst (which may characterize.
have begun more than 130 years ago7,14) has heated a large fraction The warm nature of V883 Ori’s disk enables us to characterize its
of the disk above the sublimation temperature of water, and we illus- water reservoir with spatially resolved observations, unlike most
trate how V883 Ori and a more typical proto-planetary disk differ proto-planetary disks (Fig. 1)18. We measured the column densities of
in Fig. 1. HDO and H218O in several ways to test the robustness of our measure-
We detect three emission lines of gas phase water in the disk of V883 ments (Methods). For our primary method, we extracted the integrated
Ori: HDO at 225.89672 and 241.561550 GHz and H218O at 203.40752 GHz spectra within a 0.4″ (160 AU) radius to measure the total flux of the
(Methods). The HDO and H218O kinematics are consistent with Keple- emission lines (Extended Data Fig. 4). We also extracted radial intensity
rian rotation (Extended Data Figs. 1 and 2). The emission from all three profiles from the integrated intensity maps in Fig. 2 using Keplerian
lines peak at a radius of 50 to 60 AU, but extend to roughly 160 AU (Fig. 2 masks. The spectral extraction method yields a disk-averaged measure-
and Extended Data Fig. 3). HDO is substantially brighter than H218O ment, whereas the integrated intensity method yields the measure-
(despite the D:H ratio less than 1) owing to the ratio of 16O:18O and its ments as a function of disk radius. The integrated fluxes of the HDO
molecular properties (Methods). The structure and extent of the water lines are 0.644 ± 0.028 and 0.595 ± 0.037 Jy km s−1 for the 225 and
emission is very similar to complex organic molecules (COMs), such 241 GHz lines, respectively, whereas the H218O line flux is 0.126 ±
as methanol9,15, which makes sense given that methanol is expected to 0.025 Jy km s−1.
1
National Radio Astronomy Observatory, Charlottesville, VA, USA. 2Department of Astronomy, University of Michigan, Ann Arbor, MI, USA. 3Leiden Observatory, Leiden University, Leiden, The
Netherlands. 4European Southern Observatory, Garching, Germany. 5National Astronomical Observatory of Japan, Mitaka, Japan. 6Institute of Astronomy, Department of Physics, National Tsing
Hua University, Hsinchu, Taiwan. 7Department of Space, Earth and Environment, Chalmers University of Technology, Onsala Space Observatory, Onsala, Sweden. 8Department of Astronomy,
University of Virginia, Charlottesville, VA, USA. 9Center for Interdisciplinary Exploration and Research in Astronomy, Northwestern University, Evanston, IL, USA. 10Núcleo de Astronomı́a,
Facultad de Ingenierı́a y Ciencias, Universidad Diego Portales, Santiago, Chile. 11Millennium Nucleus on Young Exoplanets and their Moons (YEMS), Universidad Diego Portales, Santiago, Chile.
✉e-mail: jtobin@nrao.edu
Fig. 1 | Illustrations comparing a typical proto-planetary disk and the disk and COM emission to be detected and resolved. Orange and red regions denote
surrounding the outbursting protostar V883 Ori. a, A typical disk in which the warmer regions of the disk where the ices are sublimated and the light blue/
water and COMs are frozen out onto dust grains at most radii except the very grey denotes the colder regions where the water and COMs are frozen out. The
inner disk. b, The case of V883 Ori in which the disk has a much larger region black points alone denote dust grains with no ice coating, whereas the black
where water and COMs are sublimated from the dust grains, enabling the water points with grey circles around them denote icy dust grains.
a b
0.0200
–7:02:25.4 HDO 225.896 GHz 0.06 H218O 203.407 GHz
0.0175
25.6 0.05
0.0150
25.8 0.04
0.0125
Dec. (ICRS)
0.0075
26.2 0.02
0.0050
26.4 0.01
0.0025
0.1" (40 AU) 0.1" (40 AU)
26.6 0 0
c d
–7:02:25.4 CH3OH 241.85 GHz C17O (J = 2 – 1)
0.4 0.04
25.6
25.8
Dec. (ICRS)
26.0
0.2 0.02
26.2
0.01
0.1
26.4
Fig. 2 | Integrated intensity images of water and other molecular lines in temperature of roughly 25 K, extending beyond the continuum emission.
the disk of V883 Ori. a–d, We show the HDO 225 GHz line (a), the H2 18 O 203 GHz The central depression in emission for all lines is the result of optically thick
line (b), CH3OH (c) and C17O (d), as the colour scale, whereas the outer extent of continuum emission attenuating the molecular emission at radii smaller than
the dust continuum emission is shown as a white contour; the integrated roughly 40 AU (0.1″); the extent of this optically thick region is denoted with
intensity maps were extracted from the data using the Keplerian masks whose the dashed thick grey line in the centre of each image. The depression is
outer extent are marked as dotted lines in a, b. The white cross marks the less obvious for H2 18 O in b due to its lower signal to noise ratio and some
location of the continuum emission peak and the position of the protostar. contamination of its integrated intensity map from a neighbouring line.
The HDO and H2 18 O lines show emission that is smaller in radial extent than the The ellipses in the lower right corner denote the resolution of the line
continuum and C17O emission. The CH3OH (methanol) image shows a very observations (orange, roughly 0.1″) and the continuum (white, roughly
similar structure and extent relative to the HDO and H2 18 O lines. C17O more 0.08″). Dec., declination; ICRS, International Celestial Reference System;
fully traces the extent of the disk gas emission with its lower sublimation RA, right ascension.
1016 100
Temperature (K)
HDO:H2O
10–3
HDO Tex profile
1015 10
H218O
HDO
Disk-averaged temperature HDO:H218O Trot = 199.1 K
Disk-averaged HDO HDO:H218O Tex profile
1014 Disk-averaged H218O
1 HDO:H218O disk averaged
10–4
0 0.05 0.10 0.15 0.20 0.25 0.30 0.35 0.40 0 0.05 0.10 0.15 0.20 0.25 0.30 0.35 0.40
Radius (arcsec) Radius (arcsec)
Fig. 3 | Radial column density measurements of water and the HDO:H2O the disk-averaged value, which has has the contamination of the HDO 241 GHz
ratio along with their disk-averaged measurements. a,b, The radial column line removed. The same excitation temperature profile derived from the HDO
density profiles of HDO and H2 18 O (a) and the HDO:H2O ratio as a function of radial intensity profiles (a) (red dashed line) is used to calculate both the HDO
deprojected radius in the disk of V883 Ori (b). The disk-averaged values are and H2 18 O column density profiles (Methods). The HDO:H2O ratio calculated
plotted at 0.2″ in both panels. The HDO column density is the average of the with a fixed, 199 K, excitation temperature (Tex) is shown as the dashed line and
column density derived from the two HDO transitions (this only reduces the the solid line uses the HDO excitation temperature profile. The error bars are
uncertainties because the HDO column density will be identical for the two only shown on the solid line for clarity, but are similar for a constant excitation
transitions). The HDO column densities have some contamination from a temperature. The uncertainties drawn correspond to 1 s.d. in the measurements
neighbouring COM line for the 241 GHz transition, which has been quantified in from standard error propagation. We shade the radius less than 0.1″ (40 AU)
the Methods. This contamination could affect the temperature and the where the disk is optically thick and the measurements are unreliable.
HDO:H2O profile, but the overall effect is small as shown by the agreement with
The ratio of the upper level column densities for the two HDO lines comets (Fig. 4). This makes sense because comets are icy relics that are
is used to estimate the water excitation temperature (199 ± 42 K). This expected to have formed in the outer parts of the proto-planetary disk.
temperature is used to derive the column densities for HDO and H218O It is important to note that it was previously thought that the Jupiter
of (6.98 ± 1.15) × 1015 and (5.52 ± 1.13) × 1015 cm−2, respectively. The H218O Family and Oort cloud comets formed at different locations in the Solar
column density translates to a H2O column density of (3.09 ± 0.70) ×
1018 cm−2 (Methods). The radial column density profiles of HDO and –2
H218O are shown in Fig. 3 and are consistent with the disk-averaged –2 Young proto-
planetary disk
measurements. The midplane water snowline is estimated to be roughly Class 0
OCC
80 AU, corresponding to the radius at which the HDO and H218O column JFC
V883Ori
–3
density begins to rapidly decline (Fig. 3). The total gaseous water mass
log(HDO:H2O)
–3
in the disk is 1.69 × 1027 g, equivalent to roughly 1,200 Earth oceans. 67P
log(D:H)
This is a lower limit because it does not include water at radii less than
40 AU or the water ice in the outer disk. Finally, we calculate a Earth’s oceans –4
disk-averaged HDO:H2O ratio of (2.26 ± 0.63) × 10−3, consistent with –4
the HDO:H2O radial profile (Fig. 3). The measurements of the HDO:H2O Protosolar
ratios from different methods are all consistent within their 1 s.d. uncer- Local ISM
–5
tainties, demonstrating that the measurement method does not
strongly influence the results (Extended Data Table 4). –5
Water (H2O, HDO, and D2O) is expected to form as ice mantles on dust Fig. 4 | HDO:H2O ratio for Class 0 protostars, V883 Ori, Jupiter Family comets
grains in the cold interstellar medium (ISM) through grain surface reac- (JFC, with 67P labelled), Oort Cloud comets (OCC), Earth’s oceans, the Sun
tions. The abundance of deuterated species becomes enhanced in the and the local ISM. The points are arranged to highlight a potential evolutionary
cold ISM due to deuterium becoming locked into H2D+, and the dissocia- scenario with the forming protostars on the right, the ‘evolved’ Solar System
tive recombination of deuterium bearing molecules increases the free bodies on the left, and V883 Ori fills in a region of parameter space for a young
deuterium available for HDO and D2O formation within ice mantles18,19. proto-planetary disk, just before or contemporaneous with planet formation.
The HDO:H2O ratio in ice mantles is not well-constrained, only upper The ellipses drawn around the different groups are meant to guide the eye, but
limits of roughly 10−2 are available20. However, within the warm gas at the horizontal lines within each ellipse denote the mean HDO:H2O ratio for each
group, and the vertical lines associated with each point represent the 1 s.d.
small radii around Class 0 protostars, where these ices have sublimated,
uncertainties. If a vertical line is not visible, the uncertainty is less than the size of
the HDO:H2O ratios are found to be between roughly 6 × 10−4 and 2 × 10−3
the symbol. In the context of other measurements, V883 Ori indicates that the
(refs. 21–23). Then comets range from 3 × 10−4 to 10−3 (refs. 24,25), and Earth’s
HDO:H2O ratio does not strongly evolve from the protostar phase to the disk,
oceans are 3.11 × 10−4 (Extended Data Table 5). The HDO:H2O ratios for providing further observational evidence that the water is directly inherited
V883 Ori and these different objects are summarized in Fig. 4. from the envelope to the disk without significant chemical changes. Moreover,
The HDO:H2O ratio of V883 Ori is comparable to the youngest the HDO:H2O ratio of comets are similar to V883 Ori (but slightly below),
(Class 0) protostars22, and then compared to more-evolved objects indicating that the water we probe in the gas phase within the disk of V883 Ori is
that formed within the Solar System, V883 Ori’s HDO:H2O ratio is also similar to the water that becomes incorporated into comets. The individual
similar to many Oort Cloud comets and 67P from the Jupiter Family measurements are tabulated in the Methods (Extended Data Table 5).
COMs does affect the excitation temperature, and hence the line col-
umn densities and HDO:H2O ratios. However, the HDO:H2O ratios are where h is Planck’s constant, ν is the frequency of the transition, and Aul
all consistent within their 1σ uncertainties, so the choice of model does is the Einstein A coefficient for the transition. An estimate of the excita-
not significantly affect the results as a whole. tion temperature is then needed to determine total column densities,
The line fluxes were measured from the spectrum with the contami- which we obtain from the ratio of column densities in the HDO 225 and
nating COM lines subtracted and uncertainties are derived from the 241 GHz lines through
root mean square of the residual spectrum with all fitted lines removed.
This approach takes into account any uncertainties associated with
Eu,225 GHz − Eu,241 GHz
Tex =
( ) (3)
Nu,225 GHz g u,241 GHz
imperfect fitting of the contaminating lines. We also tested Markov ln Nu,241 GHz g u,225 GHz
chain Monte Carlo methods to fit the spectra, but the results did not
differ from the maximum likelihood fit using scipy’sminimize function.
However, to validate our assumption of a fixed velocity and not allow the where Eu is the upper level energy of the two HDO transitions in units
source velocity to be optimized, we randomly sampled velocities within of Kelvin and gu is the statistical weight for each transition. Then the
5% of 4.25 km s−1 and determined whether the width of the distribution total column density for each transition is given by
of fitted line flux densities was smaller or larger than the statistical
Eu
uncertainty from the root mean square of the residuals. For all the water Nu
N= Q rot(Tex)eTex (4)
lines, the statistical uncertainty was smaller than the error in flux that gu
could result from an imperfect system velocity. The line fluxes derived
from the spectral template models are given in Extended Data Table 4. where Qrot(Tex) is the partition function and Tex is the excitation tem-
The measurements of the line fluxes for all spectral template models perature. We use the tabulated partition functions from the JPL data-
are not entirely in agreement between the spectral fitting methods, base as a function of temperature for HDO and H218O, and for Tex values
Keplerian mask extraction methods and scaled moment 0 methods. in between the tabulated temperatures we interpolate. Also, we use
Some differences can be explained by contamination of the HDO the full partition function for H218O that includes both the ortho and
241 GHz line in particular, but the largest differences are for the HDO para states, implicitly correcting for the ortho to para ratio (OPR) of
225 GHz line flux from the Keplerian mask and the scaled moment 0 H218O. The calculated values for the interpolated partition functions
line flux from the 5.05 to 7.05 km s−1 moment 0 map. But, most flux are listed in Extended Data Table 4. The OPR for H218O is assumed to
differences are within 3σ, and the with HDO 241 GHz and H218O being be three, substantial differences from this amount are not expected.
consistent within 2σ. Some difference can be expected for several rea- The comet 67P was found to have an OPR of 2.94 ± 0.06 (ref. 46), which
sons. First, we integrate the spectra over the same circular aperture in is consistent with the laboratory work finding that evaporating ices
all channels, whereas the Keplerian mask has more limited spatial extent have an OPR of three47. We convert the H218O column density to an H2O
because it only covers the portion of the disk expected to be emitting column density by multiplying by the 16O:18O ratio of 560 ± 25 (ref. 48).
at a particular velocity. However, the projected outer extent of the However, we do know that the 16O:18O in 67P for H2O is 445 ± 35 (ref. 49).
Keplerian masks is comparable to 0.4″ spectral extraction radius. Therefore, it is possible that the actual H2O column densities in V883
Second, the masks are also more limited in their spectral extents to Ori are lower, which would further elevate the HDO:H2O ratio.
avoid too much contamination from other lines, particularly for HDO The uncertainties in the column densities and ratios are derived from
at 241 GHz and H218O. Third, some true line emission can extend beyond standard error propagation. The uncertainty on the HDO column den-
the Keplerian mask at a given velocity channel and this would be spe- sities includes the random measurement error from the noise in each
cifically excluded from the Keplerian mask line flux, but included in channel, the roughly 5% absolute flux density calibration uncertainty
the integrated spectrum. The most easily quantified difference is the (only included once in the average HDO column density as both lines
difference in spectral range of the Keplerian mask, which results in just are observed simultaneously), and the uncertainty in the excitation
a 2% flux difference. The impact of these differences on the resultant temperature. The H218O also includes the further uncertainty on the
Article
ratio of 16O to 18O (neglecting the possibility of a large systematic uncer- mentioned in the text below are also provided in Extended Data Table 4,
tainty). These uncertainties are all propagated into the HDO:H2O ratio in addition to the HDO:H2O ratios.
such that the uncertainties on our derived ratio include all the known We examined line flux measurements that used the full Keplerian
uncertainties and better reflect the absolute accuracy of the measure- mask, which includes some unavoidable contamination from COMs
ment versus only including statistical measurement uncertainties. in the 241 GHz and H218O channel maps. The contamination is difficult
Finally, we did not make a correction for extra dust attenuation of the to avoid when using an identical Keplerian mask to the HDO 225 GHz
225 and 241 GHz HDO lines relative to H218O at 203 GHz when calculat- line. Because of the contaminated line fluxes to the HDO 241 GHz line,
ing the HDO:H2O ratio. This correction would have a radial dependence the lower excitation HDO transition (Extended Data Table 3), the exci-
and would depend on the adopted power-law dust opacity dependence tation temperature is found to be lowest for the full Keplerian mask
with frequency. The application of such a correction would only result measurement at 112 ± 3 K. Then the HDO and H218O column densities
in a higher HDO column density and a higher HDO:H2O ratio as dust are measured to be (5.07 ± 0.26) × 1015 and (4.75 ± 0.44) × 1015 cm−2,
attenuation is larger at higher frequencies. respectively. These measurements are both lower than those from the
We further note that the excitation temperature derived is not spectral extraction, but are consistent at the 1.4 and 0.5σ levels, respec-
expected to be very accurate because of the small range of upper level tively. The inferred H2O column density is (2.66 ± 0.28) × 1018 cm−2,
energies sampled by the HDO lines (95 and 167 K), but the HDO:H2O ratio which is corrected for the 16O:18O ratio and the OPR of three. The HDO
only varies by a factor of roughly 2 for temperatures between 75 and and H2O column densities then yield a HDO:H2O ratio of (1.91 ± 0.22) ×
225 K, so the precision of the excitation temperature is not extremely 10−3, which is consistent with the value from spectral extraction within
important. the uncertainties.
The assumption of LTE is appropriate for the V883 Ori disk. The Because of the known significant contamination to HDO 241 GHz and
critical densities of the HDO 225, 241, and H218O 203 GHz are 9.72 × 105, H218O using the same Keplerian mask as HDO 225 GHz, without further
1.06 × 106 and 3.79 × 105 cm−3, respectively, using the collision coeffi- optimization, we also examined the measurements obtained by inte-
cients for a temperature of roughly 200 K from the Leiden Atomic and grating the flux density within a mostly contamination free region of
Molecular Database (coefficients for para-H2O are used for para- the data cube (5.05 to 7.05 km s−1) and scaling the line flux from that
H218O)50,51. These critical densities are satisfied even for protostars in spectral range to the expected flux from the full spectral range using
which the origin of the emission is likely to have contributions from the ratio of HDO 225 GHz flux integrated within a Keplerian mask to the
the envelope outside the disk. Moreover, previous analyses have exam- HDO 225 GHz flux present between 5.05 and 7.05 km s−1 (0.37 ± 0.008),
ined the difference between LTE and radiative transfer models that also within a Keplerian mask. The HDO:H2O ratio remains unchanged
take into account non-LTE effects21,22. Those studies find that the whether we only compare line fluxes between 5.05 and 7.05 km s−1 or
HDO:H2O ratios derived from non-LTE modelling are consistent with scale to the expected full line flux, but to compare the column densities
the LTE calculations or differ by factors of only 3 to 4. Also, they often consistently, we need to make use of the scaled line fluxes.
indicate even higher HDO:H2O ratios and are thus not regarded as being The HDO, H218O , and inferred H2O column densities derived from
more accurate. Finally, a simple estimate of the disk density in the upper scaled line fluxes measured within a Keplerian mask from 5.05 to
layers at a height of 50 AU and a radius of 80 AU we find that the density 7.05 km s−1 are (5.36 ± 0.35) × 1015, (3.76 ± 0.58) × 1015 and (2.11 ± 0.34) ×
would be roughly 7.4 × 106 cm−3. All other emission would be from lower 1018 cm−2, respectively, using the calculated excitation temperature of
layers at higher density and also fulfilling the conditions for LTE. We 162 ± 11 K. These measurements are both lower than those from the
estimated the disk density by assuming parameters typical for an irra- spectral extraction, but are consistent at the 1.1 and 1σ levels, respec-
diated disk using a parameterized surface and vertical density profile52 tively. The HDO and H2O column densities then yield a HDO:H2O ratio
of (2.54 ± 0.44) × 10−3, which is consistent within the uncertainties with
Σ(r ) z2 the value from spectral extraction.
ρ( r , z ) = exp− 2 . (5)
2π H (r ) 2H (r ) Then, if we instead derive the column densities using the line fluxes
measured from the standard moment 0 image computed between 5.05
where r is the cylindrical radius, z is the height above the midplane, and 7.05 km s−1, we measure HDO, H218O and inferred H2O column den-
and Σ(r) is sities of (6.78 ± 0.62) × 1015, (5.92 ± 1.00) × 1015, (3.31 ± 0.59) × 1018 cm−2
and, respectively, using the calculated excitation temperature of
r −1
Σ(r ) = Σ 0 (6) 182 ± 19 K. These values are consistent with the values from spectral
10 AU extraction within the uncertainties. The HDO and H2O column densities
then yield a HDO:H2O ratio of (2.05 ± 0.41) × 10−3, which is consistent
and Σ0 = 100 g cm−2, as is typical for a roughly 0.01 M⊙ proto-planetary within the uncertainties with the value from spectral extraction.
disk17, chosen as a conservative lower limit. H(r) for the gas disk is param- The high degree of consistency of the methods of spectral extraction,
eterized as standard Keplerian mask, Keplerian mask between 5.05 and 7.05 km s−1
and a standard moment 0 between 5.05 and 7.05 km s−1 indicates that
r 1.25
H = 1.0 AU (7) several methods arrive at compatible measurements for the HDO and
10 AU H218O column densities and consistent measurements of the HDO:H2O
ratio. Although the line contamination present in the case of the stand-
which is typical for an irradiated disk. ard Keplerian mask of the full velocity range is not ideal, it also does
not significantly alter the main result. Thus, we conclude that the
HDO:H2O results from Keplerian mask and moment 0 line fluxes. method of line flux measurement does not significantly affect our
We noted earlier that the line fluxes extracted using a Keplerian mask results on the column densities and HDO:H2O ratio measured. The
and integrated intensity maps from 5.05 to 7.05 km s−1 differed from Keplerian mask and standard moment 0 measurements do, however,
those derived from the spectrum and it is worthwhile examining how tend to have lower uncertainties because they make use of measure-
line flux extraction using the Keplerian mask would affect our results. ments over smaller ranges of velocity and/or a smaller number of pix-
Note that we correct for the 2% reductions to the HDO 241 GHz and els (through the mask), which reduces the noise that is added from the
H218O line fluxes due to the smaller channel ranges used relative to HDO summation of several channels. We still favour the spectral analysis
225 GHz in their line flux measurements in the calculations that follow. method because this makes use of the full spectral range of the data
The values for the line fluxes used to calculate the column densities rather than subsets of the full data set.
40. Yen, H.-W. et al. Stacking spectra in protoplanetary disks: detecting intensity profiles from
hidden molecular lines in HD 163296. Astrophys. J. 832, 204 (2016).
Birth environment of V883 Ori relative to the Sun and other
41. Ginsburg, A., Bally, J., Goddi, C., Plambeck, R. & Wright, M. A Keplerian disk around Orion
protostars SrCI, a ~15 M⊙ YSO. Astrophys. J. 860, 119 (2018).
V883 Ori is compared with Class 0 protostars, comets and water in 42. Brinch, C. & Hogerheijde, M. R. LIME - a flexible, non-LTE line excitation and radiation
transfer method for millimeter and far-infrared wavelengths. Astron. Astrophys. 523, A25
Earth’s oceans in Fig. 4 attempting to determine whether there is an (2010).
evolutionary sequence in the HDO:H2O ratios. However, we already 43. Möller, T., Endres, C. & Schilke, P. eXtended CASA line analysis software suite (XCLASS).
know that V883 Ori has formed in a different environment compared to Astron. Astrophys. 598, A7 (2017).
44. Goldsmith, P. F. & Langer, W. D. Population diagram analysis of molecular line emission.
the Sun/Solar System and other Class 0 protostars. V883 Ori is forming Astrophys. J. 517, 209–225 (1999).
within the Orion A giant molecular cloud and is roughly 10 pc from the 45. Pickett, H. M. et al. Submillimeter, millimeter and microwave spectral line catalog.
main cluster/nebula and the nearest protostar is roughly 0.4 pc away: J. Quant. Spectrosc. Radiat. Transf. 60, 883–890 (1998).
46. Cheng, Y. C. et al. Water ortho-to-para ratio in the coma of comet 67P/Churyumov-
both measurements are in projected distances, thus it is relatively iso- Gerasimenko. Astron. Astrophys. 663, A43 (2022).
lated within Orion. By contrast, the Class 0 protostars with measured 47. Hama, T., Kouchi, A. & Watanabe, N. Statistical ortho-to-para ratio of water desorbed from
HDO:H2O ratios come from a mix of isolated and protostars within small ice at 10 Kelvin. Science 351, 65–67 (2016).
48. Wilson, T. L. & Rood, R. Abundances in the interstellar medium. Annu. Rev. Astron.
clusters22 and the isolated Class 0 protostars have systematically higher Astrophys. 32, 191–226 (1994).
HDO:H2O ratios. V883 Ori’s HDO:H2O ratio is most similar to the isolated 49. Altwegg, K. et al. Molecule-dependent oxygen isotopic ratios in the coma of comet
Class 0 protostars. This may make sense because it is relatively isolated 67P/Churyumov-Gerasimenko. Mon. Not. R. Astron. Soc. 498, 5855–5862 (2020).
50. Schöier, F. L., van der Tak, F. F. S., van Dishoeck, E. F. & Black, J. H. An atomic and
itself, but the isolated protostars are forming in truly isolated cores molecular database for analysis of submillimetre line observations. Astron. Astrophys.
and are not part of a larger molecular cloud, unlike V883 Ori. It is still 432, 369–379 (2005).
unknown what causes the higher HDO:H2O ratios for isolated systems, 51. Faure, A., Wiesenfeld, L., Scribano, Y. & Ceccarelli, C. Rotational excitation of mono- and
doubly-deuterated water by hydrogen molecules. Mon. Not. R. Astron. Soc. 420,
but it remains to be seen whether the difference between isolated and 699–704 (2012).
clustered protostars remains with larger samples. 52. Williams, J. P. & Cieza, L. A. Protoplanetary disks and their evolution. Annu. Rev. Astron.
The Sun and Solar System were probably formed in a cluster within Astrophys. 49, 67–117 (2011).
53. Adams, F. C. The birth environment of the Solar System. Annu. Rev. Astron. Astrophys. 48,
a giant molecular cloud, which could have been similar to Orion53,54. 47–85 (2010).
However, the dynamical constraints that are available for the evolution 54. Desch, S. J., Young, E. D., Dunham, E. T., Fujimoto, Y. & Dunlap, D. R. Short-lived radionuclides
in meteorites and the Sun’s birth environment. Preprint at https://arxiv.org/abs/2203.11169
of the Solar System point to its formation environment being closer to,
(2022).
or within the main cluster55. Thus, V883 Ori is not forming in completely 55. Pfalzner, S. & Vincke, K. Cradle(s) of the Sun. Astrophys. J. 897, 60 (2020).
analogous conditions relative to the early Solar System. Nonetheless, it 56. Robitaille, T. & Bressert, E. APLpy: astronomical plotting library in Python. Astrophysics
Source Code Library, record ascl:1208.017 (ASCL, 2012).
is still extremely relevant to compare the measurements for V883 Ori to
57. Astropy Collaboration et al. The Astropy Project: building an open-science project and
comets within the Solar System and Earth given that they represent the status of the v2.0 core package. Astron. J. 156, 123 (2018).
only available measurements of more-evolved bodies. Furthermore, if 58. Greenfield, P. et al. Astropy: community Python library for astronomy (ASCL, 2013).
59. Thyng, K. M., Greene, C. A., Hetland, R. D., Zimmerle, H. M. & DiMarco, S. F. True colors of
water is inherited relatively unchanged from the cold molecular cloud
oceanography: guidelines for effective and accurate colormap selection. Oceanography
phase, the fact that both the Sun/Solar System and V883 Ori formed 29, 9–13 (2016).
within giant molecular clouds suggests that it is reasonable to compare 60. Hagemann, R., Nief, G. & Roth, E. Absolute isotopic scale for deuterium analysis of natural
waters. absolute D/H ratio for smow. Tellus 22, 712–715 (1970).
the HDO:H2O ratios of these systems.
61. de Laeter, J. R. et al. Atomic weights of the elements. Review 2000 (IUPAC technical
report). Pure Appl. Chem. 75, 683–800 (2003).
Measurements of deuterium to hydrogen ratios from the 62. Brown, R. H., Lauretta, D. S., Schmidt, B. & Moores, J. Experimental and theoretical
literature simulations of ice sublimation with implications for the chemical, isotopic, and physical
evolution of icy objects. Planetary Space Sci. 60, 166–180 (2012).
To create Fig. 4, we collected various published measurements for 63. Bockelée-Morvan, D. et al. Deuterated water in comet C/1996 B2 (Hyakutake) and its
protostars and comets from the literature. We have assembled these implications for the origin of comets. Icarus 133, 147–162 (1998).
64. Meier, R. et al. A determination of the HDO/H2O ratio in comet C/1995 O1 (Hale-Bopp).
measurements in Extended Data Table 5 for reference. Science 279, 842 (1998).
65. Gibb, E. L. et al. Chemical composition of comet C/2007 N3 (Lulin): another ‘atypical’
comet. Astrophys. J. 750, 102 (2012).
Data availability 66. Villanueva, G. L. et al. A sensitive search for deuterated water in comet 8p/Tuttle.
Astrophys. J. L. 690, L5–L9 (2009).
The images used for analysis in the paper are available in the Harvard Dat- 67. Bockelée-Morvan, D. et al. Herschel measurements of the D/H and 16O/18O ratios in water
averse repository (https://doi.org/10.7910/DVN/MDQ JEU), along with in the Oort-cloud comet C/2009 P1 (Garradd). Astron. Astrophys. 544, L15 (2012).
68. Hutsemékers, D., Manfroid, J., Jehin, E., Zucconi, J. M. & Arpigny, C. The 16OH/18OH and
the reduction scripts used to process the ALMA visibility data and create OD/OH isotope ratios in comet C/2002 T7 (LINEAR). Astron. Astrophys. 490, L31–L34
images. Owing to their size, the raw (and ALMA-pipeline-calibrated) (2008).
visibility data are only available from the ALMA science archive (https:// 69. Biver, N. et al. Radio wavelength molecular observations of comets C/1999 T1
(McNaught-Hartley), C/2001 A2 (LINEAR), C/2000 WM1 (LINEAR) and 153P/Ikeya-Zhang.
almascience.nrao.edu/aq/). Astron. Astrophys. 449, 1255–1270 (2006).
70. Biver, N. et al. Isotopic ratios of H, C, N, O, and S in comets C/2012 F6 (Lemmon) and
C/2014 Q2 (Lovejoy). Astron. Astrophys. 589, A78 (2016).
Code availability 71. Lis, D. C. et al. A Herschel study of D/H in water in the Jupiter-family comet 45P/Honda-
Mrkos-Pajdušáková and prospects for D/H measurements with CCAT. Astrophys. J. L. 774,
Codes used for analysis are available in the Harvard Dataverse reposi- L3 (2013).
tory (https://doi.org/10.7910/DVN/MDQ JEU), along with the ALMA 72. Hartogh, P. et al. Ocean-like water in the Jupiter-family comet 103P/Hartley 2. Nature 478,
218–220 (2011).
images used for analysis. Documentation and requirements for various 73. Lis, D. C. et al. Terrestrial deuterium-to-hydrogen ratio in water in hyperactive comets.
parts of the code are documented. Astron. Astrophys. 625, L5 (2019).
36. McMullin, J. P., Waters, B., Schiebel, D., Young, W. & Golap, K. CASA architecture and Acknowledgements This paper makes use of the following ALMA data: ADS/JAO.
applications. In Astronomical Data Analysis Software and Systems XVI Vol. 376, Proc. ALMA#2021.1.00186.S. ALMA is a partnership of ESO (representing its member states), National
Astronomical Society of the Pacific Conference Series (eds Shaw, R. A. et al.) 127 (Astron. Science Federation (NSF) (USA) and NINS (Japan), together with NRC (Canada), MOST and
Soc. Pacific, 2007). ASIAA (Taiwan), and KASI (Republic of Korea), in cooperation with the Republic of Chile.
37. Teague, R. richteague/keplerian_mask: initial release. Zenodo https://doi.org/10.5281/ The Joint ALMA Observatory is operated by ESO, AUI/NRAO and NAOJ. The National Radio
zenodo.4321137 (2020). Astronomy Observatory is a facility of the National Science Foundation operated under
38. Teague, R. & Foreman-Mackey, D. A robust method to measure centroids of spectral lines. cooperative agreement by Associated Universities, Inc. This research made use of APLpy,
Rese. Notes Am. Astron. Soc. 2, 173 (2018). an open-source plotting package for Python56, Astropy (http://www.astropy.org), a
39. Teague, R. Statistical uncertainties in moment maps of line emission. Res. Notes Am. community-developed core Python package for Astronomy57,58, the Python package
Astron. Soc. 3, 74 (2019). spectral-cube (https://github.com/radio-astro-tools/spectral-cube) and matplotlib colour
Article
maps from the Python package cmocean59. J.J.T. acknowledges support from the National Author contributions J.J.T. wrote the main text and led the data analysis. M.L.R.v.H. assisted
Radio Astronomy Observatory and NASA XRP 80NSSC22K1159. M.L.R.v.H. acknowledges with the analysis and writing. M.L. assisted with the snowline analysis and writing T.P.-C.
support from the University of Michigan Society of Fellows. M.L. acknowledges support from assisted with the snowline analysis and writing. E.F.v.D. and K.F. contributed to the
the Dutch Research Council (NWO) grant no. 618.000.001. E.F.v.D. acknowledges support the interpretation of results. M.V.P. created two of the figures and contributed to the interpretation
NWO, EU A-ERC grant no. 101019751 MOLDISK and the Danish National Research Foundation of results. L.I.C., D.H., P.D.S. and L.C. contributed to the interpretation of the results and the
‘InterCat’ grant (no. DNRF150). T.P.-C. acknowledges support from the European Southern proofing of the manuscript. All authors contributed to obtaining the observations.
Observatory. P.D.S. acknowledges support from NSF grant no. AST-2001830. D.H. is supported
by Centre for Informatics and Computation in Astronomy and grant no. 110J0353I9 from the Competing interests The authors declare no competing interests.
Ministry of Education of Taiwan. D.H. acknowledges support from the Ministry of Science of
Technology of Taiwan through grant no. 111B3005191. L.C. acknowledges support from Additional information
FONDECYT grant no. 1211656 and the Millennium Nucleus YEMS, NCN2021-080, from ANID, Correspondence and requests for materials should be addressed to John J. Tobin.
Chile. L.I.C. gratefully acknowledges support from the David and Lucille Packard Foundation Peer review information Nature thanks the anonymous reviewers for their contribution to the
and NASA ATP 80NSSC20K0529. K.F. acknowledges support from JSPS KAKENHI grant nos. peer review of this work.
20H05847 and 21K13967. Reprints and permissions information is available at http://www.nature.com/reprints.
Extended Data Fig. 1 | Channel maps of HDO 225 and 241 GHz emission. The 241 GHz. The continuum peak/protostar position is marked by the white cross.
data are shown by the colour scale, the Keplerian mask is drawn as a heavy white The channels nearest the velocity of V883 Ori (4.25 km s−1) are marked with a
line, and the mask corresponding to the blueshifted CH3OCHO line (Extended star in the upper right corner. The synthesized beam is also drawn in the lower
Data Fig. 4) is drawn as a heavy blue line for HDO 225 GHz and CH3CHO for HDO left corner of each panel.
Article
Extended Data Fig. 2 | Channel maps of H2 18O 203 GHz emission. The data are are marked with a star in the upper right corner. Despite the faintness of the
shown by the colour scale, the Keplerian mask for H2 18 O is drawn as a heavy H2 18 O line and its location between nearby COM lines, the detection of H2 18 O
white line, and the masks corresponding to the two blueshifted and one is unambiguous given that its emission is detected in the expected channels
redshifted CH3OCH3 lines (Extended Data Fig. 4) are drawn as heavy blue and for the given protostar mass. The channels with >3σ detections within the
red lines, respectively. The continuum peak/protostar position is marked by Keplerian masks are marked with asterisks in the lower right corner. The
the white cross and the channels nearest the velocity of V883 Ori (4.25 km s−1) synthesized beam is drawn in the lower left corner of each panel.
Extended Data Fig. 3 | Integrated intensity images of HDO and H2 18O. The demonstrates the significance of the H2 18 O detection. The extent of the
HDO 241 GHz integrated intensity map created using a Keplerian mask identical continuum emission from the disk is denoted by the white contour and the
to the HDO 225 GHz and H2 18 O lines is shown in a, the HDO 241 GHz integrated position of the protostar is marked with the white cross. The HDO 241 GHz line
intensity image between 5.05 and 7.05 km s−1 is shown in b, the HDO 225 GHz shows very similar structure to the HDO 225 GHz line that is shown in Fig. 2 in
integrated intensity image using the same velocity range is shown in c, and the the main text, and the dotted line in a shows the region over which the
H2 18 O integrated intensity image from the same velocity range is shown in d. integrated intensity image was computed using the Keplerian mask. The
The contours shown in b–d are from the H2 18 O image and show the intensity depression in the centre of the line emission in a is the result of optically thick
levels 3 and 5 times the noise (s.d.), where 1 s.d. is 0.00158 Jy beam−1 km s−1, and continuum absorbing the line emission in the inner ~ 0.1″ (40 au). The extent of
the integrated intensity images in these panels were computed without the use this optically thick region is denoted with the thick grey line in the centre of
of masks or any other clipping. The 5.05 to 7.05 km s−1 velocity range had each image. The ellipses in the lower right corner denote the resolution of the
minimal contamination from other lines for HDO and H2 18 O and effectively line observation (orange, ~ 0.1″) and the continuum data (white, ~ 0.08″).
Article
Extended Data Fig. 4 | Integrated spectra of V883 Ori centered on the HDO contaminating lines to measure their line fluxes using an optically-thin
225 GHz, HDO 241 GHz, and H2 18O 203 GHz lines. Panels a, c, e show the synthetic spectral model for a disk (Extended Data Fig. 5). In a, c, e, the
spectra as observed (disk rotation causes all spectral lines to have a observed spectrum is drawn as the black line, the model of the contaminating
double-peaked line profile), while panels b, d, f show the stacked spectra40,41 lines is drawn as an orange line, the model HDO and H2 18 O lines are drawn as
with the Keplerian rotation profile removed. The root mean squared (RMS) blue lines, and the total model of contaminating lines with HDO and H2 18 O is
noise of the HDO 225 GHz, HDO 241 GHz, and H2 18 O are 0.016, 0.017, and 0.011 drawn as a green line. The rise seen toward higher frequencies on the H2 18 O
Jy, respectively. The HDO lines are the brightest features around their centre spectrum (e) is another CH3OCH3 line that peaks outside the shown region. The
frequencies, but both have contaminating emission from COM species nearby. spectra are plotted at their observed frequencies and are not corrected for the
The H2 18 O line is faint relative to its surrounding features but is still clearly system local standard of rest (LSR) velocity of ~ 4.25 km s−1.
detected. We are able to model the spectral profiles for HDO, H2 18 O , and the
Extended Data Fig. 5 | Plot of template spectra derived from the LIME
radiative transfer model and from the observed isolated methanol lines.
The main difference between the templates is at the centre of the line profile
where the methanol line has a much more shallow dip owing to line optical
depth, while the optically thin LIME model has a much deeper dip at the centre
and sharper peaks.
Article
Extended Data Table 1 | Spectral setup
Note: while spectral windows are identified as targeting a particular line or continuum, they also generally contain spectral features from other molecules.
a
Several features of this molecule are contained within the spectral window.
b
Methanol lines that were isolated enough to use for creation of a template spectrum.
Extended Data Table 2 | Keplerian mask parameters
Note: All masks assumed a stellar mass of 1.285 M⊙, an inclination of 38.3°, a position angle of 32°, a distance of 400 pc, and an inner radius of 0.1″.
H2CO and C17O both used an inner radius of 0.05″.
a
RMS noise of a line-free region of the spectrum.
b
Offset velocity from the rest frequency of the cube, adopted source velocity was 4.25 km s−1.
Article
Extended Data Table 3 | Spectral lines blended with HDO and H218 O
a
Calculated value of the partition function at the listed temperature.
b
The optically thin model is used for the HDO and H 218O lines while the methanol model is used for the COM lines.
c
Line fluxes measured straight from Keplerian masks, without fine-tuned masks to avoid contamination for H 218O or HDO 241 GHz. As such, the HDO 241 GHz and H 218O line fluxes are
overestimated and the excitation temperature is underestimated.
d
Measurements are based line flux measurements only within 5.05 to 7.05 km s−1.
e
HDO(241) has its flux reduced by 0.007 Jy km s−1 to account for minor contamination from CH3CHO in its Keplerian mask.
f
The ratio of HDO (225) line flux from 5.05 to 7.05 km s−1 to its total line flux (0.37 ± 0.008) is used to scale the HDO(241) and H218O line fluxes to their expected values for the full velocity range.
g
Line fluxes are summed in a 0.4″ radius aperture.
h
Line fluxes are summed in a 0.4″ radius aperture, and scaled using the ratio of HDO (225) line flux from 5.05 to 7.05 km s−1 to its total line flux (0.37 ± 0.008) from the Keplerian Mask
measurement.
Article
Extended Data Table 5 | D/H measurements
Note: not all measurements use the same method, but when the method is not HDO/H2O, their values are translated into the equivalent HDO/H2O by multiplying by a factor of 2 because
HDO/H2O = 2 × D/H. See refs. 21,22,24,26,60–73.
Article
https://doi.org/10.1038/s41586-023-05695-4 Zengming Meng1,5, Liangwei Wang1,5, Wei Han1, Fangde Liu1, Kai Wen1, Chao Gao2,
Pengjun Wang1, Cheng Chin3 & Jing Zhang1,4 ✉
Received: 11 October 2021
New band structures in lattice systems often lead to new material lattices. Two overlapping lattices V1 and V2 are formed by interfering
functions and discoveries. Twistronics, originating from the twisted- laser beams at the specific ‘tune-out’ wavelengths33–35 λ1 and λ2 with
bilayer-graphene as a tuneable experimental platform1–8, has attracted proper polarizations such that atoms in spin state ∣1 ≡ ∣F = 1, mF = 1
broad attention in recent years and launched intensive theoretical and state ∣2 ≡ ∣F = 2, mF = 0 only experience the lattice potential V1
research. Here, overlaying two graphene layers with a small relative and V2, respectively (Fig. 1). Here F and mF are the angular momentum
angle show the rich phase diagram, such as the coexistence of uncon- and projection quantum numbers in the 87Rb ground state manifold.
ventional superconductivity and correlated insulating phases2–4. In Each set of the laser beams forms a two-dimensional (2D) square
recent years, many examples of twisted-bilayer are discovered with lattice on the horizontal xy plane and the twist of the two lattices is
remarkable physical properties not present in their untwisted counter- realized by orienting the beams of different wavelengths with a small
parts. Recently, photonic moiré lattices are explored for their capabili- relative angle θ = 5.21°. The sample is tightly confined in the vertical
ties in localizing and delocalizing light13–15 and engineering the photonic z direction such that the sample is in the quasi-2D regime (see Methods
dispersion of phonon polaritons16. for details).
Ultracold atoms in optical lattices constitute an ideal platform The two spin states of 87Rb atoms constitute the synthetic dimension
to simulate emerging many-body phenomena in condensed matter that accommodates the two twisted layers of lattices V1 and V2. To pre-
physics17–19. Different optical lattice geometries can be realized by cisely determine the tune-out wavelengths λ1 and λ2 of the optical lat-
interfering different sets of laser beams20–25. In particular, a scheme of tices V1 and V2, we measure the diffraction of atoms by the optical
simulating twisted-bilayer lattice has recently been proposed using two lattices. The experimental sequence starts with an almost pure BEC in
overlapping optical lattices26,27. Other schemes for simulating bilayer a crossed-beam dipole trap. The atoms are prepared in one of the two
heterostructures have also been put forward28,29. These schemes are spin states and a short pulse of the lattice beams is applied. The lattice
based on coherent coupling between spin states of atoms, which simu- potential induces Bragg diffraction of atoms to high momentum states.
lates interlayer tunnelling along an artificial, synthetic dimension30–32. After turning off the lattice beams, we image the diffracted atoms. The
In this article, we demonstrate Bose–Einstein condensates (BEC) of wavelengths of the lattice beams are finely adjusted to the tune-out
Rubidium-87 (87Rb) atoms loaded into a pair of twisted-bilayer optical wavelengths such that atoms in state ∣1⟩ are only diffracted by the lat-
State Key Laboratory of Quantum Optics and Quantum Optics Devices, Institute of Opto-Electronics, Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan, P. R. China.
1
Department of Physics, Zhejiang Normal University, Jinhua, P. R. China. 3James Franck Institute, Enrico Fermi Institute, Department of Physics, University of Chicago, Chicago, IL, USA. 4Hefei
2
National Laboratory, Hefei, P. R. China. 5These authors contributed equally: Zengming Meng, Liangwei Wang. ✉e-mail: jzhang74@sxu.edu.cn
1°
5.2
T=
V2
V1
V2 V1
V2 Microwave
V1 | 2〉
|1〉
y1 y2
b
| 2〉 O/2
V2
Omo
|1〉
V1
V1
x1
T
x2
V2 T = 5.21°
Fig. 1 | Simulation of twisted-bilayer systems based on atoms in spin- opposite circular polarization to generate the vector shift with the opposite
dependent optical lattices. a, Atoms are loaded into a single layer, 2D sign. b, The left panel shows a sketch of the bilayer lattices in the synthetic
pancake-like potential formed by a vertical optical lattice (green) in the dimension. The interlayer tunnelling is controlled by a microwave field. The
z direction. Two sets of square optical lattices V1 (purple) and V2 (blue) on the right panel shows a superimposed lattice structure with the lattice constant
horizontal plane with a small relative angle θ = 5.21° form a spin-dependent λ/2 and much larger moiré length λmo. c, Energy diagram of the two ground
lattice potential and confine Rb atoms in spin state ∣1⟩ (up arrows) and ∣2⟩ Zeeman states ∣1⟩ and ∣2⟩ and the associated lattice beams at the tune-out
(down arrows) independently. A magnetic field is applied in the xy plane along wavelengths λ 1 = 790.02 and λ 2 = 788.28 nm.
the 45° diagonal of the V2 lattice. The lattice beams for V1 and V2 are set with
tice potential V1 and not by the potential V2 as shown in Fig. 2. Similarly, is because MW transitions between different Bloch bands are negli-
atoms in state ∣2⟩ only experience the potential V2, but not V1. By elim- gible in spin-independent lattices. In the twisted optical lattice, the
inating the cross-talks, we determined the tune-out wavelengths to be transitions from the s band of state ∣1⟩ to other bands of state ∣2⟩ are
λ1 = 790.02 and λ2 = 788.28 nm. The lattice beams are circularly polar- allowed. In the presence of the twisted-bilayer lattices, the transitions
ized to produce spatial intensity modulation such that the lattice are broadened as the two spin states experience different trap poten-
potentials are attractive to atoms in both spin states (see Methods for tials, which induce fast dephasing. Moreover, the on-site interactions
details). increase in deeper lattice potential, resulting in faster decay from
Experimentally intralayer hoppings t1 and t2 between lattice sites high bands to lower bands and thus broader spectral lines. Our obser-
are controlled by the depth of the optical lattices V1 and V2; interlayer vation supports MW as a versatile and powerful tool to induce inter-
hopping ΩR, on the other hand, is independently induced by micro- layer hopping between the two twisted layers in the synthetic (spin)
waves (MW) that couple the two spin states. Starting with atoms in dimension.
state ∣1⟩ in the dipole trap, for example, the MW spectrum shows a To quantify the interlayer hopping energy, we measure the time
single narrow peak when atoms are driven to state ∣2⟩ . By loading the evolution of the population in state ∣2⟩ . We observe a coherent oscil-
atoms into the twisted-bilayer optical lattices, the spectrum shows lation at detuning Δ = −0.9 kHz, which corresponds to the transition
several peaks. The peaks correspond to transitions from atoms in the from ∣1, S⟩ to ∣2, S⟩ (Fig. 3c). The interlayer coupling strength can be
ground band of lattice V1, which we label ∣1, S⟩, to different Bloch bands determined from the oscillation frequencies. In our experiment, the
of lattice V2, which we label ∣2, S⟩ , ∣2, P ⟩ , ∣2, D⟩ and so on (Fig. 3a,b). coupling strength is tuneable up to 1Er, which exceeds that in typical
The peak locations agree with the calculated energies of the s, p and twisted-bilayer graphene systems. On the other hand, coupling to the
d bands in lattice V2. The multi-peak structure supports that atoms in p band ∣2, P ⟩ leads to faster decay probably due to collisional relaxation
different spin states are confined in different lattices. If atoms are to the lower s band (Fig. 3d). In the following, we will focus on atoms in
loaded into a spin-independent lattice, only a single narrow peak shows the twisted-bilayer optical lattices with MW-induced coupling between
up in the spectrum, which belongs to the ∣1, S⟩ to ∣2, S⟩ transition. This the s bands of the two layers.
Δ
state |1>
4 Er |2, P〉
x1
0
0.5
|2, S〉
×½ 0
0
3 0 Er |1, S〉
y1 y2 0
−30 0 30 60 90 Γ X M Γ
Microwave detuning, Δ (kHz) Momentum, q (ƫk)
c d
Atoms in 1.0
Δ = –0.9 kHz Δ = 15.08 kHz
|2, P〉
x2
0.5 |1, S〉
T = 5.21° 0
4.35 μm 4.35 μm
i
1.0 1.0
Fig. 4 | Moiré pattern and superfluid ground state in twisted-bilayer optical real space and the contrast of diffraction pattern for different hold times. Here,
lattices. a,c, Moiré pattern of atoms in one-dimensional bilayer optical lattices the lattice depths are V1x = V2x = V 1y = V2y = 4Er (U/t = 1.67, ΩR /t = 2.07, U is the
in the x (a) and y directions (c). b,d, Plot of the corresponding optical lattice on-site interaction). The real-space and momentum-space distributions of
potential in the x (b) and y directions (d). Note that the primary optical lattice f and h are theoretically calculated by solving the mean-field ground states
λ/2 is indiscernible in the in situ images. In all experiments, an MW field is according to the Gross–Pitaevskii equations (see Methods for details). The
applied to couple the s band of state ∣1⟩ and s band of state ∣2⟩ . The atoms in contrast in the real space is defined as (Smax − Smin)/(Smax + Smin), where Smax and
state ∣2⟩ are measured. The elliptical shape of the atomic cloud is induced by a Smin are the maximum and minimum atomic density of the moiré fringes. The
little asymmetric harmonic trap potential in xy plane. e,f, Experimental (e) and contrast in the momentum space is defined as (P av av
max − Pmin )/(P max + Pmin ), where,
theoretical (f) moiré pattern of atoms in the presence of optical lattices in both P av
max = ( P 0
max + P 1
max)/2 and P min are the average maximum and minimum density
directions. g,h, TOF images with 18 ms from the experiment (g) and calculation of the diffraction pattern. Here P 0max is zero-momentum component and
(h) show diffraction peaks associated with the primary lattice constant λ/2 and P 1max is the moiré component near the zero momentum. Error bars show the
moiré length λmo. The enlarged picture of the centre part of g is obtained by the standard deviation of the mean. Scale bars a,c,e,f, 10 μm, g,h, 100 μm and inset
imaging system with higher magnification. i, The contrast of moiré pattern in of g, 20 μm.
enhances the localization of the atoms. In the large interlayer coupling couplings in our system offer the added advantages of seeking new
limit, the system can be regarded as a single layer (single-component) quantum phases and phase transitions with cold atoms.
experiencing a twisted optical lattice (see Methods for details). By varying the depth of optical lattices and interlayer coupling, we
The single-layer system with a twisted optical lattice admits a flat-band find several distinct quantum phases, including superfluid (SF), super-
structure in the ground band, which has also been studied experimen- fluid with only short-range coherence (SF-II), Mott insulator (MI) and
tally in photonic systems13–15. The easily tuned intra- and interlayer insulator (I) (Fig. 5a and Methods). These phases can be distinguished
Moiré lattice
0.9 SF-II I momentum
II III 8 Er
Visibility
Visibility
0.5 0.5 II
0.6 SF
SF SF-II MI
14 Er
0.3 MI
I III
I
0 0
0
4 8 12 16 20 24 0 8 16 24 32 0.2 0.4 0.6 0.8 1.0
Lattice depth, V (Er ) V (Er ) Ω R (Er )
Fig. 5 | Phase transition for the twisted-bilayer optical lattice. a, Phase experimental uncertainties in determining the phase transition. b, Visibility
diagram (see Methods for details), in which SF, SF-II, MI and I refer to superfluid, curves for the moiré and primary lattice momentum components as a function
superfluid only with short-range coherence, Mott insulator and insulator. of lattice depth (path I in a). A sequential loss of phase coherence appears at
The solid curves denote the calculated phase boundaries with mean-field at the moiré momentum and the primary lattice momentum. The intermediate
zero temperature. The dots are experimental measurements of the phase regime indicates SF-II phase. The interlayer coupling frequency is ΩR = 0.24Er.
boundaries. The pink circles and blue squares denote the loss of the coherence c, Visibility curves for the moiré momentum component as a function of
at the moiré length scale and the length scale of the primary lattice, respectively. interlayer coupling with the lattice depth 8Er (path II in a) and 14Er (path III in a),
The red diamonds denote the appearance of the moiré pattern in the real-space respectively. The solid lines in b and c are fitted from the experimental data and
in situ images that increases the interlayer coupling. The error bars indicate the only guide the eye.
where the subindex ix and iy label the position of the ith site in the
two-dimensional space. The tight-binding Hamiltonian for one layer Data availability
then is given by All data generated or analysed during this study are included in this
published article. Further data are also available from the correspond-
† U ing authors upon reasonable request.
H = −t ∑ bi bj +
2
∑ nˆi(nˆi − 1) + ∑ (Mi − μ)nˆi , (12)
i, j i i 43. Xiong, D., Wang, P., Fu, Z., Chai, S. & Zhang, J. Evaporative cooling of 87Rb atoms into
Bose-Einstein condensate in an optical dipole trap. Chin. Opt. Lett. 8, 627–629 (2010).
44. Greiner, M., Mandel, O., Esslinger, T., Hänsch, T. W. & Bloch, I. Quantum phase transition
from a superfluid to a Mott insulator in a gas of ultracold atoms. Nature 415, 39 (2002).
where the first term describes the nearest-neighbour tunnelling with
45. Steck, D. A. Quantum and Atom Optics https://atomoptics.uoregon.edu/~dsteck/teaching/
b† and b being the creation and annihilation operators, and the second quantum-optics/ (2007).
term represents the on-site interaction. The hopping amplitude t is 46. Zwerger, W. Mott Hubbard transition of cold atoms in optical lattices. J. Opt. B: Quantum
Semiclass. Opt. 5, S9–S16 (2003).
considered to be site-independent for weak interlayer coupling and
4 1/2 47. Krauth, W., Caffarel, M. & Bouchaud, J. P. Gutzwiller wave function for a model of strongly
can be estimated by t = π Er (V0 /Er)3/4 e−2 (V0/Er ) . The local repulsion interacting bosons. Phys. Rev. B 45, 3137–3140 (1992).
Article
48. Sheshadri, K., Krishnamurthy, H. R., Pandit, R. & Ramakrishnan, T. V. Superfluid and Author contributions J.Z. conceived the idea and performed the experimental designs. L.W.,
insulating phases in an interacting-Boson model: mean-field theory and the RPA. Z.M., F.L., K.W., P.W. and J.Z. performed the experiments. C.C., Z.M., L.W., F.L., W.H. and J.Z.
Europhys. Lett. 22, 257–263 (1993). analysed the data and all authors discussed the results. W.H., C.G. and J.Z. performed the
49. Jaksch, D., Bruder, C., Cirac, J. I., Gardiner, C. W. & Zoller, P. Cold Bosonic atoms in optical simulation. Z.M. plotted the figures. J.Z. and C.C. wrote the manuscript. All authors interpreted
lattices. Phys. Rev. Lett. 81, 3108–3111 (1998). the results and reviewed the manuscript. J.Z. designed and supervised the project.
Acknowledgements This research is supported by Innovation Program for Quantum Science Competing interests The authors declare no competing interests.
and Technology (grant no. 2021ZD0302003), National Key Research and Development
Program of China (grant nos. 2016YFA0301602, 2018YFA0307601 and 2022YFA1404101), Additional information
NSFC (grant nos. 12034011, 12022406, 12074342 and 11804203), the Fund for Shanxi ‘1331 Correspondence and requests for materials should be addressed to Jing Zhang.
Project’ Key Subjects Construction and Tencent (Xplorer Prize). C.C. acknowledges support by Peer review information Nature thanks Richard Schmidt and the other, anonymous,
the National Science Foundation (grant no. PHY-2103542) and the Army Research Office STIR reviewer(s) for their contribution to the peer review of this work.
(grant no. W911NF2110108). Reprints and permissions information is available at http://www.nature.com/reprints.
Extended Data Fig. 1 | Coherence in the SF-MI transition. a, The initial BEC c, Absorption image when the lattice is ramped up to the lattice depth 24E r and
in 2D pancake-like potential. b, Absorption image after atoms are released then ramp down to zero. The images are obtained after 18 ms free space
abruptly from an optical lattice potential V1 (or V2) with a potential depth 24E r. expansion.
Article
Extended Data Fig. 2 | Determination of tune-out wavelengths. a–b, The states ∣F = 1, m F = 1⟩ and ∣F = 2, m F = 0⟩ . e, Theoretical light shift of V1x, V 1y for ∣1, 1⟩
lattice depth V 1x (blue) and V1y (red) as a function of wavelength λ for the two and ∣2, 0⟩ . f, Theoretical lattice depth of V2x, V2y for ∣1, 1⟩ and ∣2, 0⟩ . The bias
different hyperfine states ∣F = 1, m F = 1⟩ and ∣F = 2, m F = 0⟩ . The angles between magnetic field of 10 Gauss is applied along the 45° diagonal line of the square
V 1x, V 1y and B0 are 39.79° and 50.21° respectively. c–d, The potential depth V2x lattice V2.
(blue) and V2y (red) as a function of wavelength λ for the two different hyperfine
Extended Data Fig. 3 | Band structure of the twisted-bilayer optical lattices. without the interlayer coupling in the form of the superlattice minibands
The twist angle of the commensurate optical lattice is θ = 2arctan(1/22), whose within the same reduced Brillouin zone. d,e and f are the enlargement of the
band structure is regarded as an approximation of the experimental case lowest bands of a,b, and c, respectively. g,h and i are the further enlargement of
θ = 5.21°. a, b and c show the band structures for the interlayer coupling the lowest bands of d,e and f, respectively. Here, the MW detuning is Δ = 0,
strength ΩR = 0E r, 0.1E r and 1E r respectively. a also gives the band structure V0= 4Er and E0 corresponds to the energy of the lowest band.
Article
Extended Data Fig. 4 | Characteristics of the different phases. a, Phase filling of the atoms on the site n for the different phases. Parameters (V/E r,
diagram, where SF, SF-II, MI, and I refer to superfluid, superfluid only with ΩR /E r) are (10,0.6), (15,0.6), (23,0.3) and (23,1.1) for the plots from left to right
short-range coherence, Mott insulator, and insulator. b, Table shows the respectively. The chemical potential μ/U = 1 is considered.
features of the different phases. c, Plots of the order parameter ⟨bˆi ⟩ and the
Article
https://doi.org/10.1038/s41586-022-05681-2 Woo Jin Kim1,2 ✉, Michelle A. Smeaton3, Chunjing Jia1,4, Berit H. Goodge5,6,
Byeong-Gwan Cho7, Kyuho Lee1,8, Motoki Osada1,9, Daniel Jost1, Anton V. Ievlev10,
Received: 5 April 2022
Brian Moritz1, Lena F. Kourkoutis5,6, Thomas P. Devereaux1,9 & Harold Y. Hwang1,2 ✉
Accepted: 22 December 2022
The cooperative Jahn–Teller effect ( JTE) often induces strong coupling cations having d1 or d9 configurations5. The JTE in a square-planar anion
between charge, orbital and magnetic ordering, which has been related configuration has been theoretically discussed from the foundations of
to many correlated phenomena such as colossal magnetoresistance14,15 the concept: that a Q2 vibrational mode will distort the high-symmetry
and superconductivity16. For the magnetoresistance associated with square coordination to a low-symmetry rhombus1. The FeO4 chromophore
the metal–insulator transition in perovskite-based manganites, it molecule exhibits nearly square-planar coordination, which is thought
has been established that the double-exchange model for magnet- to be JT driven from the expected tetrahedral structure22. However, a pure
ism cannot solely account for the large resistivity drop below the cooperative Q2 JT distortion has not been experimentally observed in
paramagnetic-to-ferromagnetic phase transition, and rather that a crystalline materials hosting square-planar-coordinated cations.
strong electron–phonon interaction arising from the JTE plays a crucial The infinite-layer structure provides a unique platform to explore
role17–20. Moreover, single-layered perovskite (La,A)2CuO4 (where A is this possibility and the potential cooperative response in a lattice
Sr or Ba) shows unconventional superconductivity within Jahn–Teller of JT ions. This structure forms a four-coordinated transition metal
( JT)-distorted CuO6 octahedra, indicating the important role of the oxide with a two-dimensional (2D) square lattice, which can often
JTE in many correlated ground states21. be derived from precursor higher oxides by de-intercalating the
Despite its generality, the study of the cooperative JTE in oxides has apical oxygen using topotactic reduction (Fig. 2a). These 2D oxides
been largely confined to octahedral and tetrahedral coordination. In were first synthesized in powder nickelates with an extremely low nickel
perovskites, octahedral-site cations having outer-electron configurations valence state (Ni+1) (ref. 8). The same four-coordinated system has also
of d4, d7 or d9 (ref. 4) are often JT-active systems, splitting the partially filled been found in copper oxide superconductors6,7. Subsequently, the
eg orbitals (Fig. 1a). In LaMnO3 with high-spin state d4, the partially filled iron oxide infinite-layer structure was discovered with antiferromag-
eg orbitals of Mn3+ induces both MnO6 octahedral distortion (that is, the netic ground states10,11. In addition, recently, hole-doped infinite-layer
Q3 JT distortion)1 and d z 2 -orbital ordering to reduce its total energy nickelates with Ni 3d9−δ have been found to be superconducting23,24.
(Fig. 1b), resulting in an orthorhombic crystal structure (Fig. 1c). The coop- Within this quasi-2D structure, how the orbital degeneracy affects
erative JTE has also been observed in spinel structures with tetrahedral-site the crystal and electronic structure is an open experimental question.
Stanford Institute for Materials and Energy Sciences, SLAC National Accelerator Laboratory, Menlo Park, CA, USA. 2Department of Applied Physics, Stanford University, Stanford, CA, USA.
1
3
Department of Materials Science and Engineering, Cornell University, Ithaca, NY, USA. 4Department of Physics, University of Florida, Gainesville, FL, USA. 5School of Applied and Engineering
Physics, Cornell University, Ithaca, NY, USA. 6Kavli Institute at Cornell for Nanoscale Science, Cornell University, Ithaca, NY, USA. 7Pohang Accelerator Laboratory, POSTECH, Pohang, Republic
of Korea. 8Department of Physics, Stanford University, Stanford, CA, USA. 9Department of Materials Science and Engineering, Stanford University, Stanford, CA, USA. 10Center for Nanophase
Materials Sciences Oak Ridge National Laboratory, Oak Ridge, TN, USA. ✉e-mail: wjk316@stanford.edu; hyhwang@stanford.edu
O
y
x2–y2 z2
x2–y2, z2 z2 x2–y2
xy xz, yz b
xy, xz, yz a
xz, yz xy
d4 (high spin) Q3 JT distortion
c
d e f CaCoO2 Ca
y
Co
O
?
x
xy xy xy
xz, yz xz yz
yz xz
z2 b
z2 z2
d7 (high spin) Q2 JT distortion c a
Fig. 1 | JT distortion in 3D and 2D oxide lattices. a, Schematic MO6 (where M is square-planar MO 4 plaquette and crystal field structure for a high-spin d 7
a transition metal) octahedron and crystal field structure for a high-spin d4 electron configuration. e, Square-planar distortion and associated orbital
electron configuration. b, Octahedral distortions and associated orbital levels levels for a Q2 JT distortion. f, Displacements in the Ca layer in CaCoO2, arising
for a Q3 JT distortion. c, Strong Q3 JT-distorted LaMnO3 crystal structure with from strong interlayer coupling in the absence of apical oxygen, geometrically
high-spin d4 Mn3+ as an example of a cooperative JT distortion. d, Schematic frustrate a simple cooperative JT distortion analogous to LaMnO3.
The crystal field structure for the square-planar coordination is quite (STEM) image of CaCoO2.5 (Extended Data Fig. 1a) confirms the excellent
different from that of octahedral or tetrahedral coordination, with lower crystallinity with abrupt interfaces with the substrate and subsequent
overall degeneracy. As shown in Fig. 1d, only the dxz and dyz orbitals are SrTiO3 capping layer, which is used to stabilize the reduced phase. The
degenerate. Therefore, to be JT active, the system should have a par- CaCoO2.5 heterostructure was then reduced using calcium hydride
tially filled dxz (or dyz) orbital state. The high-spin d7 configuration meets (CaH2), after which the XRD symmetric scan shows only peaks corre-
these conditions, making the infinite-layer cobaltates (stabilized here in sponding to the infinite-layer structure (00l) (Fig. 2c), with a substantial
CaCoO2) with Co2+ oxidation state an ideal candidate. Considering only contraction of the out-of-plane lattice parameter (ct) from about 3.72 Å
the CoO2 plane, one might expect a cooperative JTE to induce an orbitally to about 3.27 Å. From reciprocal space mapping, we extract the in-plane
ordered lattice of dxz or dyz orbital states in analogy to LaMnO3 (Fig. 1e). lattice constant (at) of CaCoO2 to be about 3.86 Å (Extended Data Fig. 1b),
However, the absence of apical oxygen gives rise to strong electrostatic indicating that the reduced film is relaxed from the substrate.
coupling between the CoO2 and Ca layers—an interaction that is largely The large c-axis difference between CaCoO2 and CaCoO3 (ref. 26)
screened for octahedral coordination. As we will show, this interlayer closely follows trends of known infinite-layer oxides (Extended Data
coupling gives rise to a geometric frustration of the induced Ca dis- Fig. 1c). Furthermore, electron energy loss spectroscopy (EELS) of the
placements (Fig. 1f), which is in competition with the cooperative JTE. CaCoO2.5 and CaCoO2 films (Extended Data Fig. 2) is consistent with a
transition from Co3+ to Co2+ (ref. 27). It is noted that SrCoO2 has been
previously synthesized by reduction from SrCoO2.5 (ref. 28). However,
Ångström-scale cation displacements in CaCoO2 SrCoO2 has a much larger ct (about 3.76 Å) with tetrahedrally coor-
Here we stabilized a infinite-layer compound CaCoO2 with dramatic dinated Co2+—that is, a fundamentally different structure28. Moreo-
in-plane lattice distortions. The starting point is the synthesis of epi- ver, chemical characterization by time-of-flight secondary-ion mass
taxial single-crystal thin films of brownmillerite CaCoO2.5 on strontium spectrometry (TOF-SIMS) shows no sign of hydrogen intercalation in
titanium oxide (SrTiO3) (001) substrates (Methods; θ– diffraction angle CaCoO2 (Extended Data Fig. 3a), unlike structures such as SrCoOxHy
(2θ) symmetric X-ray diffraction (XRD) scan in Fig. 2b)25. The high-angle (refs. 29,30). To our knowledge, the infinite-layer structure we observe
annular dark-field (HAADF) scanning transmission electron microscopy has not previously been reported for cobalt oxides.
Intensity (a.u.)
Square-planar
layer
Octahedral CaH2 (002) (004) (008)
layer reduction * * (006) *
*
Tetrahedral
layer Ca 10 20 30 40 50 60
2θ (º)
Co c
c CaCoO2
STO (002)
Sr
Intensity (a.u.)
STO (001)
b a Ti
O
(001) (002)
SrTiO3 (001) SrTiO3 (001) * *
10 20 30 40 50 60
d [100]t zone axis f CaCoO2 [100]t zone axis 2θ (º)
h Ca
[001]t
Co
[010]t
CaCoO2 O
2
[100]t
[010]t [001]t
5 nm 5Å
e CaCoO2 [001]t zone axis g CaCoO2 [110]t zone axis
[001]t
[001]t
–
[110]t [010]t [100]t
1.08 Å
[001]t
0.86 Å –
[110]t [110]t
5Å 5Å
Fig. 2 | Synthesis and large-scale cation displacements in thin-film CaCoO2 . the image (yellow dashed rectangles). f,g, High-magnification HAADF-STEM
a, Schematic of the topotactic reduction of brownmillerite CaCoO2.5 (left) to images of CaCoO2 along the [100]t (f) and [110]t (g) zone axes. Dark (bright)
infinite-layer CaCoO2 (right). b,c, XRD θ–2θ symmetric scans of 18-nm-thick blue balls indicate Co (Ca) cations and grey balls indicate oxygen. The atomic
CaCoO2.5 (b) and CaCoO2 (c) films capped with 2-nm-thick SrTiO3 (STO) layers positions of oxygen here are shown for the ideal square-planar sites. h, Cation
grown on SrTiO3 (001) substrates. Asterisks indicate the diffraction peaks of unit-cell structure of CaCoO2 based on HAADF-STEM. The red solid balls
the thin films. d, HAADF-STEM image of the [100]t zone axis of CaCoO2. e, Plan- indicate the oxygen positions after GIXRD refinement.
view HAADF-STEM image of CaCoO2. The distorted Ca layer is clearly seen in
The HAADF-STEM image along the SrTiO3 [100] zone axis (Fig. 2d) P4212 symmetry group as shown in Fig. 2h (see Extended Data Table 1
shows that CaCoO2 has a very strong in-plane superlattice modulation, for atomic coordinates). The projections of this crystal structure are
unlike all known infinite-layer systems6,9,10,31. A closer look at the CaCoO2 shown in Fig. 2e–g, in close correspondence with the STEM images.
layer along the [100]t zone axis in Fig. 2f shows that this is due to in-plane
cation displacements from the simple tetragonal infinite-layer struc-
ture. These are more clearly visible along the [110]t zone axis (Fig. 2g), Structural refinement of the oxygen positions in
which reveals that both Co and Ca ions have alternating sites with very CaCoO2
large splitting of 1.08 Å and 0.86 Å, respectively. Beyond these sub- Given the extremely small sample volume and low relative X-ray and elec-
stantial in-plane distortions, there are no observable accompanying tron scattering cross-sections for oxygen, determining their positions
out-of-plane atomic distortions (Extended Data Fig. 3b–d). The θ–2θ is quite challenging. Nevertheless, we can refine the oxygen positions
asymmetric XRD scan also rules out a possible c-lattice doubling from high-resolution synchrotron grazing incidence XRD (GIXRD) of the
(Extended Data Fig. 4). The plan-view HAADF-STEM image in Fig. 3e in-plane superlattice diffraction peaks (Fig. 3a). Using the cation coor-
also shows strong in-plane superlattice modulation. In aggregate, these dinates from STEM, we first simulated the XRD pattern to find the seven
results show that the cation lattice is described by a tetragonal super- strongest in-plane superlattice peaks (Extended Data Table 2) assuming
cell 2 2 at × 2 2 at × ct (a = b = 2 2 at = 10.78 Å and c = ct = 3.27 Å) in the undistorted oxygen positions. These were then used to experimentally
Intensity (a.u.)
Detector ×4
CaCoO2 (100)t
θ ×4
αf
θ
CaCoO2 (001)t 22 24 26 26 28 28 30 48 50 46 48 50 48 50 48 50 52 54
2θ (º)
c d e
(2.5, 1.5, 0) Experiment
(2.75, 1.25, 0) Without oxygen displacements
(–2.25, 1.75, 0) GIXRD refinement
(–2.75, 0.75, 0)
Intensity (a.u.)
(100)
Ca
(1.25, 0.75, 0)
Co
(1.5, 0.5, 0)
(1.75, 0.25, 0) O
(HK0)t
Fig. 3 | GIXRD and refinement of the oxygen positions. a, Schematic of the averaged plan-view ABF-STEM image of CaCoO2 with the final refined structure
GIXRD experimental geometry. αi and αf are the incident and reflected angle, model overlayed. Dark contrast indicates the atomic columns. e, Relative
respectively, which are maintained to be 0.2° for all measurements. ϕ is the integrated intensity for all CaCoO2 (HK0)t GIXRD peaks. The blue (orange) filled
angle between CaCoO2 (100)t and (HK0)t and θ is the diffraction angle for diamonds (circles) are experimental (GIXRD refinement) results. The green
CaCoO2 (HK0)t planes. b, GIXRD θ–2θ scans for various CaCoO2 (HK0)t planes. crossed squares are calculated GIXRD intensity for CaCoO2 in the absence of
The red dashed lines indicate Voigt fitting results. c, Fast Fourier transform of a oxygen displacements (oxygen positions for an ideal square plane).
plan-view HAADF-STEM image. All seven GIXRD peaks are observed. d, Unit-cell-
search for the actual scattering peaks, all of which were found very close between Co(1) and O(2) (dCo(1)–O(2)) is 2.09 ± 0.01 Å whereas that between Co(1)
to the simulated positions (Fig. 3b and Extended Data Table 2), confirm- and O(3) (dCo(1)–O(3)) is 1.19 ± 0.01 Å. It is noted that the anisotropic bonding
ing the overall structural symmetry deduced from the STEM results. The ratio dCo(1)–O(2)/dCo(1)–O(3) (1.76 ± 0.02) is extraordinarily large, for example,
fast Fourier transform of the plan-view HAADF-STEM image in Fig. 2e compared with the value for the JT-distorted octahedra in LaMnO3 (about
also confirms the existence of the seven in-plane peaks observed from 1.15)2. The green Co(2)O4 plaquette is trapezoidal with three different Co–O
the GIXRD measurements (Fig. 3c). The approximate oxygen positions bonding lengths, whereas that for Co(3) (orange) maintains four-fold
can also be extracted via plan-view annular bright-field (ABF)-STEM symmetry (with rotation). Surprisingly, only 25% of the Co is strongly JT
imaging (Fig. 3d). These were taken as the starting positions for Riet- distorted, in contrast to the cooperative JTE in LaMnO3 that provides an
veld refinement of the relative intensities of the GIXRD peaks (blue equivalent JT octahedral distortion for every Mn site (Fig. 1c).
diamonds in Fig. 3e; see Methods and Extended Data Tables 1 and 3). This intriguing situation can be understood to originate from the
The refinement was dominated by oxygen displacements, such that the competition between the JT distortion and an induced geometrical
initial R factor of about 0.46 with undistorted oxygen (green squares in frustration in the Ca layer. As shown by the dashed rectangles in Fig. 4a,
Fig. 3e) reduced to about 0.08 (orange circles in Fig. 3e), indicative of a the strong JTE distorts not only the Co(1)O4 but also the Ca layer. This
high-quality fit. The overlay of the final refined structure of CaCoO2 in unusual coupling of Ca to the Q2 JT distortion arises from the lack of
Fig. 3d shows a good qualitative match with the experimental results apical oxygen, which gives rise to strong electrostatic coupling between
within the precision of the ABF-STEM measurement. the CoO2 and Ca layers. The anisotropic distortions of the Ca layer are
however highly geometrically frustrated between neighbouring sites
(Fig. 1f). Consequently, a complex arrangement of displacements is
Origin of the ordered distortions in CaCoO2 observed.
Figure 4a highlights the three distinct CoO4 plaquettes (for Co(1), Co(2) Interestingly, the geometrical frustration of the cooperative JTE
and Co(3), coordinated by three distinct oxygen sites) in blue, green and results in a two-in–two-out type of distortion pattern, following ‘ice
orange, respectively, for the refined structure of CaCoO2. The blue Co(1)O4 rules’13 for the ångström-scale displacements of Co(2) around the maxi-
plaquette shows strong JT distortion as predicted1: the bonding length mally JT-distorted Co(1)O4 (Fig. 4a). The Co(2)O4 plaquette notably breaks
2.09 Å O(2) -
+
-
Co(2) O(3) + + - - + +
+
Co(2) - -
Co(2)
-
Co(2) + +
- - + + - -
O(3) O(2) +
-
+
O(1) - -
Co(3)
+
Co(2) + + - - + +
+
- -
O(1)
c d
Co(1)
1.85 Å DFT + U 1 dxz 1.85 Å
dyz y
(U = 5 eV) 1.96 Å
1.96 Å 0
e Co(1) f
1.19 Å Non-JT Small JT Large JT
y
2.09 Å S S = 3/2 S = 3/2 S = 1/2
x (Degeneracy) (8) (4) (2)
z
Fig. 4 | Extended structure of CaCoO2 , ice rules, quadrupolar ordering and CoO4 sites, which show the same structural symmetry as experiment, but with
electronic structure. a, Plan view of the experimentally refined crystal much smaller distortions. The visualized isosurface in yellow colour represents
structure of CaCoO2, consisting of three different CoO4 sites corresponding to the electron density for the lowest unoccupied d x 2 − y 2 band for Co(1) at the
the three different colours (blue, green and orange). The blue-coloured CoO4 gamma point. d, The spin-dependent PDOS of Co(1) d orbitals from DFT + U and
plaquettes are strongly JT distorted. In the full unit cell, a pair of Co(2) ions distort the corresponding atomic energy level diagram for the relaxed structure.
towards (purple arrows) the central Co(1), whereas the other pair of Co(2) ions e, An atomic energy level diagram appropriate for the experimentally refined
distort outwards (red arrows) from the central Co(1). The visualized isosurface structure from a ligand–multiplet calculation. The light blue arrows represent
in yellow represents the computed electron density for the lowest unoccupied the occupation of half an electron. f, A table showing the number of holes from
d x 2 − y 2 band for Co(1) at the gamma point. b, The dipole arrangements associated ligand–multiplet calculations. The three columns give results in the absence
with Co(2) displacements form an ordered array of electric quadrupoles (purple of distortions (non-JT), for parameters appropriate for the DFT + U relaxed
diamonds). c, Plan view of the computationally relaxed crystal structure of structure (small JT) and for parameters appropriate for the experimentally
CaCoO2 from DFT + U (U = 5 eV) calculations. This consists of three different refined structure (large JT).
inversion symmetry, and thus the long-range-ordered structure can be However, the magnitude of the distortions is substantially smaller—for
viewed as an ordering of electric dipoles. From an electrostatic point example, the calculated anisotropic bonding ratio of about 1.06 is
of view, this is equivalent to a ‘herringbone’ arrangement of electric much less than the experimentally observed ratio of 1.76 ± 0.02. The
quadrupoles (Fig. 4b), which minimizes the electrostatic interaction electronic band structure of CaCoO2 shows an insulating ground state
between quadrupole moments32. with a bandgap energy of Eg ≈ 0.670 eV (Extended Data Fig. 5b). Experi-
To further understand CaCoO2, we performed density functional mentally, the resistivity exhibits insulating temperature dependence
theory (DFT) + on-site Coulomb interaction (U) calculations. The overall (Extended Data Fig. 5c).
symmetry for the relaxed structure directly matches the experimental The spin-dependent partial density of states (PDOS) for Co(1) shows
observations, and it is robust to variations in U (Extended Data Fig. 5a). that the d z 2 and dxz orbitals are doubly occupied (Fig. 4d) as expected
Cluster multiplet calculations Acknowledgements We thank W.-S. Lee for discussions. The work at SLAC and Stanford was
The calculations were performed by exact diagonalization of the CoO2 supported by the US Department of Energy (DOE), Office of Basic Energy Sciences, Division of
Materials Sciences and Engineering (contract number DE-AC02-76SF00515) and the Gordon
11-orbital cluster involving 5 Co 3d orbitals and 6 O 2p orbitals forming and Betty Moore Foundation’s Emergent Phenomena in Quantum Systems Initiative (grant
90° bond angles. The Hubbard–Kanamori interaction for O and Co orbit- number GBMF9072, synthesis equipment and initial development). Electron microscopy at
als captures multiplet energy levels parameterized by Slater–Condon Cornell was support by the Department of Defense Air Force Office of Scientific Research
(number FA 9550-16-1-0305) and the Packard Foundation, and made use of the Cornell
integrals F. Hybridization is included through tight-binding hopping; Center for Materials Research Shared Facilities which are supported through the NSF MRSEC
charge transfer energy Δ and crystal field levels ε are chosen to give a programme (DMR-1719875), with the Thermo Fisher Helios G4 UX focused ion beam also
high-spin Co 3d7 ground state (total spin 3/2, 8-fold ground-state degen- supported by NSF (DMR-1539918). The Thermo Fisher Spectra 300 X-CFEG was acquired
with support from PARADIM, an NSF MIP (DMR-2039380), and Cornell University. M.A.S.
eracy) for the undistorted plaquette. A JT perturbation that lifts the acknowledges additional support from the NSF GRFP under award number DGE-1650441.
ground-state degeneracy is applied by changing relative orbital ener- The 3A beamline at PLS-II is supported in part by MSIT. B.-G.C. is currently affiliated to Korea
gies for 3dxz and 3dyz, which maintains the high-spin ground state, while Research Institute of Standards and Science (KRISS). D.J. acknowledges funding by the
Alexander-von-Humboldt foundation via a Feodor Lynen postdoctoral fellowship. Raman
reducing the degeneracy to 4. Increasing the hybridization (hopping) spectroscopy measurement was performed at the Stanford Nano Shared Facilities (SNSF),
along the x bond directions reduces the degeneracy to 2 and creates supported by the National Science Foundation under award ECCS-2026822. TOF-SIMS
a low-spin ground state characterized by 3d8L with a ligand hole occu- characterization was conducted at the Center for Nanophase Materials Sciences, which is
a DOE Office of Science User Facility, and using instrumentation within ORNL’s Materials
pancy in the 2px orbital. Parameters are given in Extended Data Table 4. Characterization Core provided by UT-Battelle, LLC under contract number DE-AC05-
00OR22725. The computational work for this project was performed on the Sherlock cluster in
the Stanford Research Computing Center.
Data availability
Author contributions W.J.K. and H.Y.H. conceived and designed the experiments. M.A.S.,
The data presented in the figures and other findings of this study are B.H.G. and L.F.K. performed the STEM and EELS measurements and analysis. C.J. performed
available from the corresponding authors upon reasonable request. the DFT calculations. C.J., B.M. and T.P.D. performed the cluster calculations. D.J. performed
Raman spectroscopy measurements. W.J.K. grew the samples, which were characterized by
W.J.K., K.L., D.J. and M.O. W.J.K. and B.-G.C. performed and analysed the synchrotron GIXRD
41. Savitzky, B. H. et al. Image registration of low signal-to-noise cryo-STEM data.
measurements. A.V.I. performed TOF-SIMS measurements. W.J.K., T.P.D. and H.Y.H. wrote the
Ultramicroscopy 191, 56–65 (2018).
manuscript, with input from all authors.
42. Campbell, B. J., Stokes, H. T., Tanner, D. E. & Hatch, D. M. ISODISPLACE: a web-based tool
for exploring structural distortions. J. Appl. Crystallogr. 39, 607–614 (2006).
43. Stokes, H. T., Hatch, D. M. & Wells, J. D. Group-theoretical methods for obtaining distortions Competing interests The authors declare no competing interests.
in crystals: applications to vibrational modes and phase transitions. Phys. Rev. B 43,
11010–11018 (1991). Additional information
44. Perdew, J. P., Burke, K. & Ernzerhof, M. Generalized gradient approximation made simple. Supplementary information The online version contains supplementary material available at
Phys. Rev. Lett. 77, 3865–3868 (1996). https://doi.org/10.1038/s41586-022-05681-2.
45. Dudarev, S. L., Botton, G. A., Savrasov, S. Y., Humphreys, C. J. & Sutton, A. P. Electron-energy- Correspondence and requests for materials should be addressed to Woo Jin Kim or Harold Y.
loss spectra and the structural stability of nickel oxide: an LSDA+U study. Phys. Rev. B 57, Hwang.
1505–1509 (1998). Peer review information Nature thanks Eric Hoglund and the other, anonymous, reviewer(s) for
46. Kresse, G. & Hafner, J. Ab initio molecular dynamics for liquid metals. Phys. Rev. B 47, their contribution to the peer review of this work. Peer reviewer reports are available.
558–561 (1993). Reprints and permissions information is available at http://www.nature.com/reprints.
Article
Extended Data Fig. 1 | Structural characterizations for CaCoO2.5 and lattice parameters. c-axis lattice parameters for various transition metal oxide
CaCoO2 . a, Atomic-resolution HAADF-STEM image along the [100]t zone- compounds are plotted for the perovskite phase and the infinite-layer phase
axis projection of CaCoO2.5 showing alternate stacking of tetrahedral and after topotactic reduction. The dashed line is a linear fit for all the data points
octahedral layers. b, X-ray diffraction reciprocal space map of CaCoO2 around in the plot. Note that the CaFeO2 has relatively large cinfinite layer/cperovskite associate
the (−103) SrTiO3 diffraction peak, indicating that the film is relaxed from the with out-of-plane displacement of both FeO4 and Ca layers48.
substrate. c, Empirical relationship between perovskite and infinite-layer
Extended Data Fig. 2 | EELS measurements of CaCoO2 . a, Co-L 3,2 edge; the the Gaussian filtered spectra. Upon reduction of the CaCoO2.5 films to CaCoO2,
blue (red) solid line indicates EEL spectra for CaCoO2.5 (CaCoO2). b, Ca-L 3,2 we observe a suppression of the distinct pre-peak at ~ 529 eV in the region of the
edge EELS shows that there are no substantial changes in the spectra before O K-edge associated with hybridization between O 2p and transition metal d
(CaCoO2.5, blue) and after reduction (CaCoO2, red). c, A plot of the intensity orbitals consistent with a nominal electronic transition from 3d6 to 3d7. This is
ratio I(L 3)/I(L 2) of the Co-L 3,2 edge for different Co compounds with different similar to the pre-peak suppression observed upon reduction from perovskite
oxidation states. Note that the dashed line indicates a polynomial fit curve to infinite-layer phase in the related nickelates49. We further see the emergence
for four different compounds from ref. 27 (CoCO3, CoSO 4, Co3O 4, and CoSi4). of a shoulder in the CaCoO2 spectrum at ~ 530 eV, which is similar to a feature
I(L 3)/I(L 2) of the CaCoO2.5 and CaCoO2 films are depicted with blue and red attributed to ligand hole states in doped infinite-layer nickelates49. This feature
circles, respectively. d, O K-edges EELS data. Spatially averaged O K-edge is also consistent with published spectra acquired from SrCoO3-δ, which has
spectra of CaCoO2 (CaCoO2.5) in red (blue). The partially transparent, solid lines negative charge transferred state37. An O K-edge spectrum of the SrTiO3
indicate the raw, background-subtracted data, and the dashed lines indicate substrate is included in black for comparison.
Article
Extended Data Fig. 3 | Time-of-flight secondary-ion mass spectrometry for the blue and the orange dashed lines in b. The intensities of the line profiles
(TOF-SIMS) and ABF-STEM measurements of CaCoO2 . a, Depth profiles of H+ are from inverted image b. The blue (orange) solid line indicates the line profile
and other ions from both CaCoO2.5 and CaCoO2 thin film on SrTiO3 substrate for the Co column (Ca and O column). The peak positions are the relative
(with ~ 2 nm SrTiO3 capping layer) were measured with secondary-ion mass distances noted at the bottom of the image b. d, Atomic distances between Ca
spectrometry. The Co ion signals from both CaCoO2.5 and CaCoO2 thin films and Ca (black triangles), Co and Co (green diamonds), Ca and O (red squares),
were employed as a marker for the interface position. TOF-SIMS measurements and Ca and Co (blue circles) layers are plotted. Note that the atomic layer
show that the H+ concentration for CaCoO2 is similar to the background level numbers in d correspond to those in b. Error bars are taken as the full-width at
of the as-synthesized CaCoO2.5 thin film. b, ABF-STEM image along the [100]t half-maximum of the intensity peaks in c.
zone-axis projection with overlaid Co, Ca, and O atoms. c, Intensity line profiles
Extended Data Fig. 4 | Powder XRD simulation and c-lattice parameter distinct half-order peak along the c-lattice direction. We first found e, the
determination. Lattice structure models for a, 2 2 at × 2 2 at × c t and b, 2 2 at × CaCoO2 (103)t XRD peak as a reference peak. Based on this reference peak
2 2 at × 2c t. The second structure model is lattice doubled from the first model position, we perform θ–2θ scans along the expected CaCoO2 (0.75, 0.25, 0.5)
by stacking a half-unit-cell shifted layer along the in-plane direction. Powder position. f, No XRD peak was observed at the expected CaCoO2 (0.75, 0.25, 0.5)
XRD simulation results for both c, 2 2 at × 2 2 at × c t and d, 2 2 at × 2 2 at × 2c t peak position, indicating that CaCoO2 does not have a c-axis doubling of the
models. Note that the XRD simulation for the 2 2 at × 2 2 at × 2c t model has a simple tetragonal unit cell.
Article
Extended Data Fig. 5 | DFT calculations for CaCoO2 . a, Plan-view of the temperature of CaCoO2 thin film. The inset shows that the resistivity is well
relaxed crystal structure for CaCoO2 from DFT + U calculations with U = 2 eV, fitted with an Arrhenius plot with an estimated (transport) gap of 0.337 + 0.001 eV.
U = 3 eV, U = 4 eV, U = 5 eV, and U = 6 eV. b, Calculated band dispersion of CaCoO2 The spin-dependent partial density of states (PDOS) of d, Co(2) and e, Co(3) d
(DFT + U for U = 5 eV). Green highlights dxz (and dyz) projections. The inset shows orbitals from DFT + U (U = 5 eV). The spin-dependent PDOS of Co(2) shows the
high-symmetry points in the tetragonal Brillouin zone. c, Resistivity versus degeneracy lifting of the d xz/yx -orbitals.
Extended Data Fig. 6 | Total energy calculation for CaCoO2 with 2 × 2 × 1 is approaches the experimentally refined structure. c, Normalized total energy
and 2 2 × 2 2 × 1 supercell. a, DFT+U (U = 5 eV) calculations for the total for the structures depicted in b. Three different first-principle calculations are
energy under purely Q2-JT-distortions in the 2 × 2 × 1 supercell. b, 2 2 × 2 2 × 1 used for c (Methods).
supercell with different distortion amplitudes. Approaching #10, the structure
Article
Extended Data Table 1 | Atomic coordinates for the initial (before GIXRD refinement) and refined structure of CaCoO2
Initial atomic coordinates were taken from the values from the STEM measurements.
Extended Data Table 2 | Simulated and experimental CaCoO2 (HK0)t GIXRD peak positions and intensities
VESTA software50 was used for the simulated GIXRD peak positions and intensities.
Article
Extended Data Table 3 | Structure symmetry and atomic coordinates for the refined structure of CaCoO2
Extended Data Table 4 | Parameters used for multiplet
calculations (in eV)
These parameters were used to generate the ground-state (3d7) configuration for the cluster.
The high-spin Jahn–Teller split ground state was obtained by lifting the degeneracy of the dxz/yz
site energies, while the low-spin ground state was obtained by increasing all hybridizations
along the x-direction of the cluster.
Article
Dense elemental hydrogen has long been predicted to be a hydride compounds. One direction is a third, light element acting as
very-high-temperature superconductor22,23, yet the extremely high a dopant in the metal hydrides, which is predicted to have two main
pressures required have presented challenges in confirming those super- beneficial effects29. First, there is a predicted increase in Tc as seen in
conducting phases24,25. The superhydride materials offer the promise proposed examples such as critical temperatures approaching 500 K in
of retaining the superconducting properties of dense elemental hydro- the Li–Mg–H system, although still in the megabar regime17, and virtual
gen but at much lower pressures. The prediction of a 220–235-K super- crystal approximation simulations and recent experimental evidence
conducting transition temperature (Tc) in CaH6 at 150 GPa (ref. 26) and indicating an increase of the transition temperature by at least 25 K from
the watershed discovery of a 203-K Tc for H3S at 155 GPa (ref. 27) have doping the LaH10 framework18,19,30. Second, the addition of a third ele-
instigated a materials discovery boon in which, at present, almost all ment can greatly enhance the stability of a hydrogen-rich lattice, thereby
possible binary systems of high-pressure hydride systems have been lowering the pressure range over which it is stable. LaBH8 is predicted to
modelled28. The recent observation of an anomalously high Tc in YH6 be stable down to 20–40 GPa while maintaining its high-temperature
showed that high-temperature superconductivity can be achieved superconductivity20,21, and a metal–boron–carbon clathrate is predicted
with lower hydrogen content and more modest pressures than previ- to retain its superconducting properties at ambient pressures31. The
ously understood13. As the main discoveries have all been at greater presence of stability combined with increasing Tc by introducing the
than megabar pressures, the goal has shifted to further lowering the third element opens the possibility of pushing the hydride supercon-
pressure required, with a focus on the vast sample space of ternary ductors to higher values of Tc at sub-megabar pressures.
Department of Physics and Astronomy, University of Rochester, Rochester, NY, USA. 2Department of Mechanical Engineering, School of Engineering and Applied Sciences, University of
1
Rochester, Rochester, NY, USA. 3Unearthly Materials Inc., Rochester, NY, USA. 4These authors contributed equally: Nathan Dasenbrock-Gammon, Elliot Snider, Raymond McBride, Hiranya
Pasan, Dylan Durkee. ✉e-mail: rdias@rochester.edu
Tc (K)
200
cation offers a simple chemical rationale for this behaviour. However, SC
the Sc hydrides with an even smaller ionic radius are predicted to have 150
completely different structures and lower Tc (ref. 32). Owing to the lan-
thanoid contraction, the lanthanoids heavier than Dy offer comparable I II III
100
or smaller trivalent ionic radii than Y but with the complication of f
electrons33–35. Although the 4f electrons in lanthanoid compounds
0 5 10 15 20 25 30 35 40
are often atom-localized and semivalent at ambient conditions, the P (kbar)
inherent magnetism of partially occupied 4f states36–38 or migration
b
towards the Fermi level under pressure could be detrimental to the Before After 3 kbar 32 kbar
superconducting properties9,39. Although synthesis efforts for the
high-pressure YbHx system have produced structures distinct from its
La and Y counterparts, probably owing to the transfer of d electrons
to unoccupied f states40, predictions indicate that hydrides of the two (i) (ii) (iii) (iv)
heaviest lanthanoids should be able to achieve Tc ≥ 145 K by a megabar Blue (ambient) Pink Red
owing to the strong electron correlation of the 4f electrons near the
Fig. 1 | Superconductivity in lutetium–nitrogen–hydrogen at near-ambient
Fermi level41. Causes of the high Tc achieved in the sub-megabar regime
pressures. a, Evolution of the superconducting transition temperature (Tc) of
are believed to be twofold. First, the over half-filled valence 4f states
recompressed nitrogen-doped lutetium hydride as a function of pressure (P),
suppress the phonon softening and second they provide some enhance-
illustrating a clear dome-shaped peak around 10 kbar with a Tc of 294 K.
ment to the electron–phonon coupling relative to the transition metal Superconductivity (SC) is only observed in phase II between about 3 kbar and
(Y and La) rare earths. Combining the benefits of light atom doping and about 30 kbar of pressure. ρ, electrical resistance; χ′ (a.c.), dynamic magnetic
the presence of 4f electrons in the valance states should increase the susceptibility; χ′ (d.c), static magnetic susceptibility; c, heat capacity.
stability of a hydrogen-rich rare-earth hydride to lower pressures while b, Microphotographs of a sample using only reflected light recovered from a
potentially enhancing its superconducting properties. metallic sample from high-pressure high-temperature synthesis before being
In this paper, we present experimental evidence of superconduc- loaded into the diamond anvil cell (i) and after loading at ambient pressure,
tivity at 294 K and 10 kbar pressure in a ternary lutetium–nitrogen– showing a remarkable blue colour (ii). Scale bar, 10 μm. The sample is completely
hydrogen compound in which the combination of a full 4f shell along opaque to transmitted light. Under pressure, the sample transformed from
with the electron donation and chemical pressure of the nitrogen drive blue to pink at about 3 kbar (iii) and to red at about 30 kbar (iv).
the Tc and pressure stability of nitrogen-doped lutetium hydride into the
near-ambient regime. The measured superconducting properties are
the observation of zero resistance, a.c. magnetic susceptibility and d.c.
magnetic susceptibility with zero field and field cooling, magnetization Temperature-dependent electrical resistance
M–H curve, heat capacity, voltage–current (V–I) curves and the reduction The superconducting transitions of phase II are evidenced by a sharp
of Tc under an external magnetic field with an upper critical magnetic drop in resistance within a temperature change of a few degrees kelvin
field of about 88 tesla based on the Ginzburg–Landau (GL) model at zero (Fig. 2a). The temperature-dependent resistance data were acquired
temperature (see Extended Data Fig. 15). The composition and structure during the natural warming cycle (about 0.25 K min−1) with a current
are explored with elemental analysis, EDX measurements, XRD, Raman of 100 μA to 2 mA. The accuracy of the temperature probe is ±0.1 K and
spectroscopy and density functional theory (DFT) simulations. the transition temperature was determined from the onset of supercon-
ductivity. In all experiments, the reported pressure was measured using
ruby fluorescence. The transition width in zero applied magnetic field,
Temperature–pressure relations and visual change as observed in other high-Tc hydride systems, has a ΔT/Tc value ranging
The near-ambient superconducting stability regime of the ternary from 0.005 to 0.036, and such features are readily explained within
lutetium–nitrogen–hydrogen system extends from about 3 kbar to the dirty limit as described by GL theory42. The V–I relations are simul-
about 30 kbar (Fig. 1a) and is accompanied by a marked visual trans- taneously measured along with the four-probe electrical-resistance
formation over just a few kbar of pressure (Fig. 1b). The recovered measurements. Figure 2b shows the V–I characteristics with steadily
sample is initially in a non-superconducting metallic phase with a lus- increasing current measured in zero applied magnetic field. At a tem-
trous bluish colour, denoted here as phase I. Compression to about perature above the superconducting transition (T = 297 K > Tc = 294 K),
3 kbar drives the progression of the system into phase II, leading to a linear V–I response following Ohm’s law was observed for the metallic
the onset of the superconducting regime, and this transformation state of nitrogen-doped lutetium hydride at 10 kbar. As the temperature
is associated with a sudden change in colour from blue to pink. Tc as is reduced below Tc (T = 30 K) at the same pressure, the voltage drop is
determined by electrical-resistance, magnetic-susceptibility and heat immeasurably low (essentially zero) and shows a nonlinear, V ∝ I3(2.84)
capacity-measurements increases with pressure from 171 K at around response. The V–I data were obtained from the V, I pair, shown in Fig. 2b.
5 kbar until it peaks at 294 K at around 10 kbar. The 10-kbar turning
point in the superconducting dome is followed by a reduction in Tc to
approximately 200 K before about 30 kbar. Compression above the Magnetic susceptibility
highest pressure Tc shown in Fig. 1a drives the sample through another Another key criterion for a superconducting material is the demonstra-
phase transition into phase III. Phase III is a non-superconducting metal- tion of the Meissner effect. In a type I superconductor, this should—in
lic state that is once again distinct in colour, being bright red in appear- principle—equate to perfect diamagnetism below the critical field,
ance. The colour changes are for reflected light only and the sample is whereas in a type II superconductor, there exists perfect diamagnet-
completely opaque for transmitted light. ism below the lower critical field and a vortex state between the upper
Resistance (mΩ)
Resistance (mΩ)
40 Pt electrodes
Voltage V (μV)
3 0.2
30 K
0.5 V = 0.75 × I2.84
Voltage V (μV)
2 0.1
20
Fig. 2 | Temperature-dependent and field-dependent electrical resistance warming cycle to minimize the electronic and cooling noise. The inset
and V–I behaviour of the lutetium–nitrogen–hydrogen system. illustrates the experimental setup for the electrical resistance at around
a, Temperature-dependent electrical resistance of nitrogen-doped lutetium 10 kbar using platinum (Pt) metal probes in a four-probe configuration.
hydride at high pressures, showing the superconducting transitions as high as b, V–I characteristics measured at temperatures of 297 K and 30 K at 10 kbar.
294 K at 10 ± 0.1 kbar, the highest transition temperature measured in all The transition temperature (Tc) is 294 K and above that temperature, the
experimental runs. The colours represent the transition at different pressures. sample exhibits typical linear behaviour. Below Tc (T = 294 K), well within the
The right y axis represents the 10-kbar resistance versus temperature in blue superconducting regime, at the same pressure, a nonlinear, V ∝ I3(2.84) response
colour for a different pair of V and I contacts. The data were obtained during the is shown. The inset highlights the power law V–I dependence.
and lower critical fields. The temperature dependence of the magnetic as observed in other high-Tc hydride systems, has a value of approximately
moments and M–H curves at different temperatures were measured on 0.8 K, 2 K and 5 K at Tc of 294 K (at 10 kbar), 269 K (16 kbar) and 238 K
a Quantum Design Physical Property Measurement System (PPMS) by (22 kbar), respectively, indicating the pressure broadening. Extended
using the Vibrating Sample Magnetometer (VSM) method. Figure 3a Data Fig. 12 shows the a.c. susceptibility, with the electrical resistance
shows the d.c. magnetic susceptibility (χ = M/H, in which M is mag- showing similar critical temperatures and very similar transition widths.
netization and H is magnetic field) as a function of temperature, under
conditions of zero field cooling (ZFC) and field cooling (FC) at 60 Oe.
The existence of the superconducting phase was then confirmed by a.c. calorimetry of lutetium–nitrogen–hydrogen
measuring the Meissner effect on cooling in a magnetic field. The onset The specific heat (C) is an important thermodynamic quantity and is
of a well-defined Meissner effect was observed at about 277 K at around extensively used at ambient pressures to confirm bulk superconductiv-
8 kbar. The M–H data were recorded using a PPMS with VSM option ity. The BCS model superconductors have an energy gap associated with
(see Fig. 3b). We used an HMD high-pressure cell and Daphne oil as the formation of Cooper pairs, resulting in a spike in the specific heat
the medium for applying pressure. Compared with a diamond anvil of a superconductor at Tc. However, detecting such heat anomalies at
cell (DAC), the maximum pressure achievable is considerably lower high pressure is difficult because of the highly thermally conductive
in a HMD high-pressure cell. The HMD high-pressure cell is rated to environment of the diamonds. In this study, we have used a new setup
reach a maximum pressure of 13 kbar, although we have not been able of the a.c. calorimetric technique for measuring the specific heat43.
to achieve such a pressure. Because the filling factor of the sample is The sample is thermally excited by an a.c. applied at frequency ω/2 to a
small (limited by the synthesis procedure), achieving the rated 10 kbar resistance heater, leading to an a.c. heat power at frequency ω to deter-
will require substantially greater pressure-cell compression. The maxi- mine the specific heat capacity (C) of the sample (see Methods for more
mum pressure we were able to generate was about 8 kbar. The pressure information). Using the well-known superconducting transition in MgB2
dependence of Tc is approximately 30 K kbar−1 from about 3 kbar to as a test case (Extended Data Fig. 4), we find that the higher-frequency
about 10 kbar. The broad transition is most probably because of the value on the falling edge of the plateau provides the cleanest response
pressure gradient caused by the high-pressure cell and/or by chemical for measurements. A frequency sweep above Tc easily identifies the
inhomogeneities in the main sample. The temperatures observed for falling edge of the plateau, and the resultant heat capacity of MgB2 at
the onset of diamagnetism with ZFC are commensurate with those 15 kbar shows the distinctive discontinuity of the specific heat capac-
from the electrical-resistance measurements. ity at 32 K. Replicating this procedure in the superconducting stability
The diamagnetic response of nitrogen-doped lutetium hydride is also regime of phase II yields specific-heat-capacity curves exhibiting the
seen by a 30–50-nV drop in the real part of temperature-dependent a.c. distinctive discontinuity (Fig. 4a–c). The Tc values identified in this man-
susceptibility, χ′(T), for different pressures across the superconducting ner are very similar to those found through both electrical resistance
stability range of phase II (Fig. 3c). The techniques for measuring a.c. and a.c. susceptibility, identifying a bulk nature for the transition and
susceptibility were similar to those of Snider et al.14,15 and with respect the shape of the superconducting dome shown in Fig. 1a. The highest
to background subtraction; here we have used a cubic polynomial (see Tc we have observed using this method is 292 K at about 10 kbar. These
Extended Data Fig. 5). Given that the trivalent rare-earth elements are measurements are also subject to a sample-size dependency, and the
extremely reactive, the synthesis can be tricky and, consequently, the typical samples here are about 60–100 µm in diameter.
amount of superconducting sample can vary and thus the strength of
the signal is dependent on volume. On average, sample sizes are on the
order of 70–100 μm in diameter and 10–20 μm thick. For larger samples, Composition and structure
the strength of the diamagnetic response increases by nearly five times The composition of the superconducting ternary lutetium–nitrogen–
in magnitude (see Extended Data Fig. 6). The transition width (ΔTc), hydrogen compound was identified by using a combination of
M (×10–5 e.m.u.)
M (×10–6 e.m.u.)
Response (μV)
Response (μV)
Response (μV)
300
400
200 223 Hz 223 Hz 211 Hz
10
100 200
296 K 298 K 298 K
1 10 100 1,000 1 10 100 1,000 1 10 100 1,000
fexc (Hz) fexc (Hz) fexc (Hz)
250 260 270 280 290 300 260 270 280 290 300 175 200 225 250 275 300
Temperature (K) Temperature (K) Temperature (K)
Fig. 4 | Specific-heat-capacity measurement on the superconducting depicted in the insets. The strength of the heat-capacity anomaly associated
lutetium–nitrogen–hydrogen system. a–c, Specific heat capacity of with superconductivity varied owing to volume fraction as shown in c. The
nitrogen-doped lutetium hydride at 10 kbar (a), 10.5 kbar (b) and 20 kbar dashed line is a guide to the eye to distinguish the trend of the heat-capacity
(c), showing the superconducting transition as high as 292 K at 10.5 kbar in b. anomaly before and after the transition.
The drive frequency ( fexc) and frequency sweeps of each measurement are
electron–phonon properties without a treatment for anharmonicity, (see Extended Data Fig. 11), which—in turn—leads to disordering of
but—because of the similarity between its and LuH2’s phonon band the Lu atoms and an approximately 0.12-Å expansion of the lattice
structure—we do not believe it to be a strong candidate for compound distortions, well beyond what is measured by XRD. A lower N content
A. The larger harmonic dynamic instability at Γ in LuH3 is a T1u optical suppresses the magnitude of the distortions seen for the tetrahedral
phonon mode that splits, with one branch becoming more unstable substitution, and likewise its deviation away from metallicity, but not
in other parts of the Brillouin zone. As this lattice could potentially to the extent to provide a better match with experimental results as
be metastably recovered to ambient conditions52,54, the stabilization compared with octahedral substitution.
of the material could also be attributed to anharmonic effects. Simu- Preliminary investigations into adding H-vacancy defects into the
lated compression to 15 GPa, at which LuH3 has been observed experi- cubic cell of the trihydride structure show that, as with the introduc-
mentally, quenches the harmonic instabilities at the zone centre but tion of N, there is a varied response to the lattice, with the removal of
not away from it, further indicating that anharmonicity plays a role in an octahedral H giving a = 5.007 Å and the removal of a tetrahedral
stabilizing cubic LuH3 against the harmonic instabilities of the optical H giving a = 5.065 Å. These models both reduce in magnitude but do
modes. An optical phonon mode of RS LuH also exhibits large harmonic not remove the optical harmonic dynamic instability at Γ. As with N
dynamic instabilities, indicating that unstable optical modes arise substitution, these structures split the phonon modes of the parent
from hydrogens in the octahedral fcc interstices. This observation is lattice at Γ, making many of them Raman active, such as what is observed
in line with neutron-diffraction results for cubic NdD2.61, in which the D experimentally. Considering that the ground-state structure of sev-
in the octahedral site shifts away from the 4b Wyckoff site to a partially eral of the ambient rare-earth trihydrides are hexagonal lattices, yet
occupied, lower-symmetry 32f site55. surface defects can metastably trap the high-pressure cubic phase
Single N substitution in the cubic cell of LuH3 at both types of inter- down to ambient conditions as with YH3 (ref. 54), the anharmonicity
stitial site increases the (harmonic) dynamic instability at Γ; however, of the hydrogenic phonons59 along with a combination of N substitu-
they both split the highly degenerate zone-centred phonon modes of tions and H-vacancy defects are probably promoting the formation
LuH3, making more of them Raman active, in line with what is observed of a superconducting nitrogen-doped lutetium hydride with higher
experimentally. Substitution at the tetrahedral site was found to be H content than the dihydride.
more enthalpically favourable than at the octahedral site (not vibration-
ally corrected), whereas Rietveld refinements provided similar patterns
for N substitution at either site (see Extended Data Fig. 9). The LuH2 to Discussion
LuH3 transformation is a metal to semimetal transition, wherein the Lu Clearly, state-of-the-art experiments are needed to determine the exact
d electron driving the metallicity in LuH2 donates to/interacts with the crystal structure and stoichiometry of nitrogen-doped lutetium hydride
octahedral hydrogens in LuH3, leading to a van Hove singularity56 just and similar materials showing such high-temperature superconduct-
below the Fermi level (see Extended Data Fig. 10). N incorporation at an ing states. The use of techniques such as neutron diffraction and X-ray
octahedral interstice sees an increase in metallic character versus LuH3, spectroscopy, as supported by simulations, are the most likely to pro-
with the N p states being metallic, as well as an increased density of H vide a route to directly investigating the light elemental content of
states at the Fermi level. Conversely, N incorporation at a tetrahedral doped-metal hydrides and to build reliable atomistic descriptions of
interstice drives the system into a semiconducting state. Although their chemical environments. A better detailed structural descriptor
N is more electronegative than H, it does not go to N3− in either case will enable theoretical modelling of these non-stoichiometric metal
as N p states are in the conduction band, implying M–N covalencies. hydrides and improved theoretical understanding. An important dis-
Also, N being more electronegative will prevent the formation of only tinction to make is that XRD was not satisfactorily authoritative for
H− anions in the lattice, and H− anions are known to be unfavourable these hydrides even at ambient conditions, a shortcoming of such a
for superconductivity. The primary reason for the difference in the technique that we have already highlighted in our work on carbona-
electronic behaviours of the two types of substitution is that octahedral ceous sulfur hydride14–16. The fact that, in this study, we experience a
substitution has a minimal impact on the parent lattice, whereas tetra- lack of accuracy at ambient conditions confirms our concerns of using
hedral substitution pushes the octahedral hydrogens into the opposite XRD techniques for determining hydrogen stoichiometry at more
octant of the cube, similar to the packing seen in LaBH8 (refs. 21,57,58) extreme conditions. The inability to accurately measure defect
Intensity (a.u.)
Cu Kα Immm
20 40 60 80
2T (º)
b c 32.0
K0 = 886(14) kbar
31.5 K0′ = 4
V0 = 31.739(7) Å3
31.0
30.5
Vfu (Å3)
30.0
28.5
b 0 10 20 30 40 50 60 70 80 90 100
a P (kbar)
Fig. 5 | XRD studies of the superconducting lutetium–nitrogen–hydrogen shown in white and those in tetrahedral interstitial sites are in pink. The lutetium
system. a, Rietveld refinement of the X-ray powder diffraction data collected atoms are in green and the coordination polyhedron is shown about the central
at 295 K with Cu Kα radiation. The black points, red line and blue line represent Lu atom. The cell is shifted by (0.5, 0.5, 0.5) fractional coordinates from the
the observed data, calculated intensity and the difference between observed standard setting to better represent the coordination polyhedron. c, The
and calculated intensities, respectively. Green tick marks represent the lattice constant as a function of pressure for the Fm3m main phase. The Le Bail
expected Bragg peak positions for the main phase, which is probably LuH3−δNε method was used for the refinement of the high-pressure XRD data. The equation
(92.25%); minor phases, which are probably LuN1−δHε (7.29%) and Lu2O3 (0.46%), of state was fitted using the Birch–Murnaghan method, as shown by the dashed
are shown as red and purple tick marks, respectively. The colour map is a cake lines for two pressure ranges, 0 kbar < P < 40 kbar (black) and P > 42.7 kbar (red),
representation of the X-ray powder diffraction data at ambient pressure. and the corresponding K0 (bulk modulus at P = 0), V0 (reference volume at
Insets show Le Bail fitting of high-pressure powder diffraction data at 61 kbar P = 0) and K0′ (derivative of the bulk modulus with respect to pressure at P = 0)
with the Fm3m and Immm space groups. b, The crystal structure of the are shown.
proposed LuH3−δNε phase. The hydrogens in octahedral interstitial sites are
densities and fractional occupancies of the lightest elements is mostly high-temperature superconducting metal hydrides have been observed
a consequence of extremely complex synthesis techniques and which at multi-megabar pressure conditions, our discovery of a 21 °C super-
in turn limits the accurate boundary conditions to aid theoretical meth- conducting material at 10 kbar will certainly lead to the emergence of
ods for modelling and predicting the quantum properties of such a new field of materials science, as such conditions are substantially
materials. In summary, the most remarkable result of this study is the more accessible to a multitude of new researchers outside the field of
evidence for the near-ambient superconducting state observed in high-pressure physics.
N-doped lutetium hydride with Tc of 294 K at 10 kbar. On the basis of
the measured XRD and Raman spectra, the observed superconducting
properties can most probably be attributed to Fm3m LuH3−δNε, for Online content
which different non-stoichiometric values are used to indicate the Any methods, additional references, Nature Portfolio reporting summa-
possibility of both N-substitution and H-vacancy defects. The physical ries, source data, extended data, supplementary information, acknowl-
properties of the superconducting N-doped lutetium hydride will edgements, peer review information; details of author contributions
be better constrained by magnetic-field-dependence resistance, and competing interests; and statements of data and code availability
susceptibility and heat-capacity measurements. Whilst all other are available at https://doi.org/10.1038/s41586-023-05742-0.
fcc system, using a triclinic representation with x along a and z along Author contributions N.D.-G., E.S., R.M. and H.P. contributed equally to this work as co-first
c* (which uses a D3 electronic point group as opposed to Oh) has a neg- authors. E.S., D.D., N.D.-G., R.M., H.P. and R.P.D. contributed to performing the electrical-
conductivity measurements. N.D.-G., N.K.-S., S.M., S.E.D. and R.P.D. contributed to performing
ligible effect on the optimized lattice but alleviates the very negative a.c. magnetic-susceptibility measurements and analysed the data. N.D.-G., R.M. and R.P.D.
uncorrected frequency at Γ. However, this creates weak dynamic insta- contributed to performing heat-capacity measurements and the analysis. E.S., N.D.-G., R.M.,
bilities of the acoustic phonons just off of Γ (see Extended Data Fig. 8), D.D., H.P. and S.E.D. contributed to performing elemental analysis, EDX studies and XRD
measurements. H.P., R.M., S.E.D. and R.P.D. contributed to performing Raman studies and H.P.
implying that anharmonic contributions may play a role in stabilizing and R.P.D. analysed the data. S.E.D. and A.S. performed structure analysis. H.P., S.E.D. and
the lattice, similar to how they were found to stabilize Im3m H3S below R.P.D. performed the magnetization measurements using a PPMS and R.P.D. analysed the data.
175 GPa (ref. 77). Changing between the triclinic or more symmetric K.V.L. and A.S. performed the simulations and analysed the data and chemistry protocol.
N.D.-G., K.V.L., A.S., S.E.D. and R.P.D. wrote the paper. All authors discussed the results and
representation of the primitive unit cell’s lattice vectors does not alle- commented on the manuscript. R.P.D. conceived the project and oversaw the entire project.
viate the optical dynamic instabilities of LuH3. In addition, the phonon
Competing interests The University of Rochester (U of R) has patents pending related to the
band dispersions for LuH2 and ZB LuH in the highly symmetric lattice
discoveries of R.P.D. in the field of superconductivity. R.P.D. is a cofounder and chairman of the
vectors were evaluated as a function of pressure up to 50 kbar. However, board of Unearthly Materials Inc. (UM), a Delaware corporation. UM has licensing agreements
no notable change to their phonon band structures was observed, with U of R related to the patents, proprietary interests and commercialization rights related
to the scientific discoveries of R.P.D. UM, U of R and R.P.D. are subject to non-disclosure and
including the instability at X for ZB LuH (Extended Data Fig. 16).
confidentiality agreements. A.S. is a cofounder, president, chief executive officer and board
member of UM.
Additional information
Data availability Supplementary information The online version contains supplementary material available at
The authors declare that the data supporting the findings of this study https://doi.org/10.1038/s41586-023-05742-0.
are available in the article and its supplementary information files and Correspondence and requests for materials should be addressed to Ranga P. Dias.
Peer review information Nature thanks the anonymous reviewers for their contribution to the
from the public link https://doi.org/10.5281/zenodo.7374510. Source peer review of this work.
data are provided with this paper. Reprints and permissions information is available at http://www.nature.com/reprints.
Article
Extended Data Fig. 1 | Raman spectra. a, The spectral deconvolution of Raman spectra of compound A on compression. b, The Raman shift versus pressure of
compound A at high pressures, indicating the three distinct phases. c, The spectral deconvolution of Raman spectra of compound B on compression.
Extended Data Fig. 2 | The heat-capacity setup. Top, schematic rendering of sample. The thermocouple consists of a shorted alumel/chromel pair. The
the new a.c calorimetry technique (not to scale). The sample is surrounded by a heater pair consists of a shorted metal, nichrome, Ti or Pt. When driven at
NaCl insert with a heater and thermocouple making contact with the sample. frequency f, the sample temperature modulates at frequency 2 × ƒ, which
a, View of the preparation as seen from the side showing the thermocouple manifests as a voltage on the thermocouple pair that can be measured by a lock-
making contact with the sample inside the DAC. b, View of the preparation as in amplifier. Bottom right, after the sample is loaded, in contact with both the
seen from the top of the sample area showing the configuration of heater, heater and the thermocouple, a small piece of NaCl is placed on top to thermally
thermocouple and Pt leads. Bottom left, heat-capacity setup before loading insulate it from the diamond.
Article
Extended Data Fig. 3 | Frequency response. Frequency and current sweeps measured on a heat-capacity setup before running the experiment. The frequency
sweep shows the characteristic plateau and the current sweep demonstrates quadratic dependence, as expected from ohmic heating.
Extended Data Fig. 4 | Heat capacity. Specific heat capacity of MgB2 as a function of temperature at 15 kbar and 127 Hz. The superconducting signature is clearly
observed at 32 K. Inset, recorded lock-in voltages during the frequency sweeps at 60 K.
Article
Extended Data Fig. 5 | a.c. susceptibility data before background fittings with cubic or quadratic polynomials indicated by the red lines. For a.c.
subtraction. Voltage in volts versus temperature plots at different pressures susceptibility data, the background subtraction was done mainly for visualization
before the background subtraction. Cubic or quadratic polynomial background purposes.
was used for background subtraction for susceptibility data. This figure shows
Extended Data Fig. 6 | Further a.c. susceptibility measurements. a, The a.c. broader temperature ranges for N-doped Lu hydride at 4 kbar (b), 6 kbar
susceptibility in nanovolts versus temperature for a larger sample of the (c) and 8 kbar (d). The red line in b–d is the quadratic fit for the background
N-doped Lu hydride system at select pressures from run 2, showing large and the insets show the signals with the background subtracted. e, a.c.
diamagnetic signal of the superconducting transition owing to the large susceptibility measurements of MgB2 as a function of temperature using exact
volume of the sample. The superconducting transition shifts rapidly under same coil set up as the test sample.
pressure to lower temperatures. a.c. susceptibility measurements taken over
Article
Extended Data Fig. 7 | EDX measurements. For EDX measurements, samples microscope with a driving energy of 15 kV and collected and analysed using an
were prepared by mounting on an aluminium pin mount with double-sided EDAX detector with the EDAX APEX software. Carbon and aluminium peaks
carbon tape. The samples were then imaged using a Zeiss Auriga scanning seen in the EDX spectra originating from the carbon tape and aluminium mount
electron microscope. Regions of interest were chosen by comparing the required to place the samples into the scanning electron microscope vacuum
scanning electron microscopy image to a white-light image taken beforehand. chamber. EDX measurements provide further evidence for the presence of
EDX measurements were performed in the Zeiss Auriga scanning electron nitrogen in our samples.
Extended Data Fig. 8 | Phonon bands of stoichiometric Lu hydrides. The parallel to c*, as opposed to the more highly symmetric lattice vectors for a
calculated phonon band structures of 0 kbar LuH2 in the fluorite structure primitive cell of a fcc cell; in this representation, the structure is represented
(a), Fm3m LuH3 (b), LuH in the RS structure (c) and LuH in the ZB structure (d). with D3d point-group symmetry as opposed to Oh point-group symmetry as in a.
e, The calculated phonon band structures of 0 kbar LuH2 in the fluorite structure f, The calculated phonon band structures of 0 kbar LuH3 using the same triclinic
using a triclinic representation of the lattice vectors with x parallel to a and z representation of the lattice vectors and point-group symmetry as in e.
Article
Extended Data Fig. 9 | Rietveld refinement of site occupancies. a, Rietveld octahedral site (blue) and a tetrahedral site (green). Rietveld refinement of the
refinement of the X-ray powder diffraction data collected at 295 K with Cu Kα X-ray powder diffraction data of ground powder sample was performed with an
radiation with refining the occupancy of the tetrahedral interstitial site with attempt to investigate the possible N substitution in nitrogen-doped lutetium
N for nitrogen-doped lutetium hydride. b, Simulation of the XRD pattern with hydride. We note here that XRD is mostly dominated by heavy Lu atoms.
Cu Kα wavelength for LuH3 (red), LuH3 with a N replacing a single H in an
Extended Data Fig. 10 | Projected density of states. The atom and angular octahedral (e) and tetrahedral (f) interstice. In the legends, Oct- means
momentum projected partial density of states of LuH2 in the fluorite structure hydrogens in the octahedral interstices and Tet- means hydrogens in the
(a); Fm3m LuH3 (b); the cubic cell of Fm3m LuH3 with a N substituted for a H in an tetrahedral interstices. Each channel is summed over all similar atoms in the
octahedral (c) and tetrahedral (d) interstice; and a 2 × 2 × 2 supercell of the unit cell and the plots are scaled to represent a maximum value of 2.5 states eV−1
rhombohedral primitive cell of Fm3m LuH3 with a N substituted for a H in an per formula unit.
Article
Extended Data Fig. 11 | Distorted structures predicted by DFT. a, The rhombohedral primitive of LuH3. d, The lattice distortions from substituting a
distortions to the octahedral hydrogens observed by substituting a N atom for N into an octahedral interstice in a 2 × 2 × 2 supercell of the rhombohedral
a tetrahedral atom in a single unit cell of Fm3m LuH3. b, The Pmnm LuH3 primitive of LuH3. The lutetium atoms are green, the nitrogen atoms are
structure found by perturbing the cubic Fm3m unit cell of LuH3, which suggests lavender and the hydrogen atoms in octahedral interstitial sites are white and
possible light-atom positions in phase III. c, The lattice distortions from those in tetrahedral interstitial sites are pink. In b, there is no distinction made
substituting a N into a tetrahedral interstice in a 2 × 2 × 2 supercell of the between the hydrogen atom sites, so they are all white.
Extended Data Fig. 12 | Superconducting transition widths. For comparison, and blue, respectively. The transition width of the resistance drop is 1.3 K and
the superconducting transition obtained from electrical measurements and 1.6 K for the a.c. magnetic susceptibility measurement.
a.c. susceptibility measurement at a similar pressure (16 kbar) is shown by red
Article
Extended Data Fig. 13 | Low-temperature electrical-resistance behaviour phases I and III, showing the non-superconducting state. c, Four-probe
of N-doped Lu–H systems. a, The resistance measured on both warming and electrical-resistance measurements of different Lu–H–N samples, which
cooling at about 10 kbar. b, Temperature-dependent electrical resistance of consistently shows highly metallic behaviour with decreasing temperature.
Extended Data Fig. 14 | Magnetic-susceptibility background and subtraction. d, The ZFC and FC curves with the linear backgrounds shown in
smoothing. a–c, The ZFC and FC magnetization versus temperature at 8 kbar b and c subtracted out, as well as with a ten-point adjacent-average smoothing
used to construct Fig. 3a, along with a linear fit to the data at temperatures applied. e, The measured cell background at 60 Oe for the HMD cell used for the
above the transition temperature, which was used for the background d.c. measurements.
Article
Extended Data Fig. 16 | Phonon bands of pressurized stoichiometric smearing width is 0.005 Ry and the lattice vectors are the highly symmetric
Lu hydrides. The calculated phonon band structures of LuH2 in the fluorite ones for a fcc cell. Negligible change in the computed electron–phonon
structure (left) and LuH in the ZB structure (right) at 0 kbar (top row), 10 kbar couplings or logarithmic frequency is seen for LuH2 on pressurization.
(second row), 30 kbar (third row) and 50 kbar (bottom row). The electronic
Article
https://doi.org/10.1038/s41586-022-05675-0 Zhiyuan Ruan1, Shuni Li2, Alexandra Grigoropoulos1, Hossein Amiri3, Shayna L. Hilburg4,
Haotian Chen1, Ivan Jayapurna1, Tao Jiang1,11, Zhaoyi Gu1,12, Alfredo Alexander-Katz4,
Received: 13 June 2022
Carlos Bustamante3,5,6,7,8, Haiyan Huang2,9 & Ting Xu1,6,10 ✉
Accepted: 21 December 2022
Whereas molecular precision can be readily achieved inside test tubes, been proven effective in designing random heteropolymers (RHPs) to
biological fluids are diverse, complex and full of uncertainty7. Evolution- stabilize proteins in non-aqueous media as well as to mimic channel
arily, the selection of the fittest proteins depends on their surround- proteins to transport protons13–15. In both cases, the RHP chains have
ings. As a result, natural proteins harmoniously coexist with each other substantially reduced conformational freedom, being either anchored
and collectively execute complex tasks with exceptional fidelity amid at polar or non-polar interfaces or spanning a lipid bilayer; and the
random fluctuations and external perturbations (Fig. 1a)8–10. Informa- observed function readouts are from a subpopulation within each
tion embedded in the sequence space of natural proteins provides the designed RHP ensemble. Nevertheless, these results have validated
blueprint to design synthetic heteropolymers11,12 to achieve predict- the importance and value of extracting protein sequence information
able interplay with biological components as protein substitutes, to beyond the monomeric level.
holistically recapitulate collective behaviours in protein mixtures and In biological fluids, components often interact through random
to further gain functions of special proteins while maintaining system encounters and the whole population needs to be considered. However,
compatibility. when the block-length-based analysis was extended beyond soluble
We propose that the chemical and sequence characteristics of pro- proteins, the block-length distribution broadened (Extended Data Fig. 1
teins at the segmental level, as opposed to the monomeric level, is the and Supplementary Figs. 1 and 2). Furthermore, the results regarding
key factor governing how they transiently interact with neighbouring the block-length distribution contain no information regarding their
molecules and the collective behaviours of biological fluids. Experi- sequential arrangement within each protein chain. Yet, the effective
mentally, mimicking the length distribution of blocks containing con- hydrophobicity of a given block depends on the chemical character-
secutive residues of the same characteristics in soluble proteins has istics of neighbouring ones14, which affects the probability of it being
1
Department of Materials Science and Engineering, University of California Berkeley, Berkeley, CA, USA. 2Department of Statistics, University of California Berkeley, Berkeley, CA, USA. 3Institute
for Quantitative Biosciences-QB3, University of California, Berkeley, CA, USA. 4Department of Materials Science and Engineering, Massachusetts Institute of Technology, Cambridge, MA, USA.
5
Department of Molecular and Cell Biology, University of California Berkeley, Berkeley, CA, USA. 6Department of Chemistry, University of California Berkeley, Berkeley, CA, USA. 7Department of
Physics, University of California Berkeley, Berkeley, CA, USA. 8Howard Hughes Medical Institute, University of California Berkeley, Berkeley, CA, USA. 9Center for Computational Biology,
University of California, Berkeley, CA, USA. 10Materials Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA, USA. 11Present address: Department of Chemistry, Xiamen
University and The MOE Key Laboratory of Spectrochemical Analysis and Instrumentation, Xiamen, China. 12Present address: Departments of Chemistry and Biomedical Engineering,
Northwestern University, Evanston, IL, USA. ✉e-mail: tingxu@berkeley.edu
Protein RHP
12 13
PC2
14
15
15 Sequence 17 16
18
analysis 20 19
21
20 23 22
24
24 PC1
SRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGS
NCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGN
Sequence similarity analysis
RHP1 RHP5
RHP2 RHP6
RHP3 RHP7
RHP4
PC2
Membrane protein
Globular protein
PC1
7
6
40 5
60 1,718
Extension (nm)
RHP
Number
4
I
Force (pN)
30 3
2
40 1,716
II 1
20 0
0 20 40 60 80
III Unfolding energy (kcal mol–1) 1,714
20
10
IV
0 0 1,712
1,400 1,500 1,600 1,700 1,800 1,900 I II III IV 0 500 1,000 1,500 2,000
Extension (nm) FEC type Time (s)
Fig. 1 | Population-based design to mimic the native environments of using kernel density estimation. d, Single-chain study of RHP4 using optical
proteins. a, Heteropolymer ensembles are designed to mimic protein mixtures tweezers. The left panel shows four representative types of FEC during pulling
in biological fluids through transient interactions with neighbouring proteins. (blue) and relaxing (orange): no unfolding signature (type I), discrete rips
b, The left shows the permutated sequences in descending order of PC2 (type II), smooth shoulders (type III) and a mixture of rips and shoulders
value from top to bottom. The right shows the projection of 24 permutated (type IV). The red solid curve represents the extensible worm-like chain model
sequences with RHP4 composition ratio and RHP4 ensemble onto the PCA for 6 kb DNA. The plots are shifted along the y axis for clarity by a step of +10 pN.
space. c, 2D sequence analysis of proteins and heteropolymers can be used The number of RHP4 chains that show each type of FEC and the distribution of
to compare similarities in their chemical characteristics at the segmental unfolding energies for type II–IV chains (inset) are shown in the middle panel.
level. 100 membrane protein sequences (green dot) and 100 globular protein The right panel shows the passive-mode trace reflecting the unfolding and
sequences (orange cross) (both randomly selected) are shown for clarity. Each refolding transitions of an RHP4 chain with type IV behaviour.
shaded area is a univariate distribution of an ensemble of 2,000 RHP chains
surface exposed as well as its spatial location within a globular RHP library of RHPs as synthetic cytosols capable of modulating RHP–pro-
chain. At the whole chain level, the sequential arrangement of blocks tein and RHP–DNA interactions, and their spatial compartmentalization
will affect the overall chain conformation, intra- and interchain interac- on microscopic liquid–liquid phase separation (LLPS).
tions. Here, we developed a two-dimensional (2D) informative sequence
analysis to parameterize and visualize both chemical characteristics
and sequential arrangement at the segmental level using an autoen- 2D informative sequence analysis
coder model (Fig. 1b) and established design rules to modulate RHPs’ The model was trained on a library of protein sequences includ-
similarity to proteins as an ensemble. As a test case, we developed a new ing membrane proteins and globular proteins collected from the
MMA OEGMA (500) EHMA SPMA OEGMA (300) DMAEMA Mna Mnb Ðc
RHP1 70 25 - 5 - - 18.4 20.7 1.4
RHP2 65 25 5 5 - - 17.9 18.3 1.5
RHP3 60 25 10 5 - - 18.5 18.6 1.5
RHP4 50 25 20 5 - - 36.3 27.3 1.3
RHP5 40 25 30 5 - - 26.5 22 1.3
RHP6 20 25 50 5 - - 25.6 20.8 1.3
RHP7 - 25 70 5 - - 31.0 24.2 1.3
DHP1 50 25 20 5 - - 17.3 17.9 1.1
DHP2 50 25 20 5 - - 30.5 25.8 1.4
RHP8 60 - 10 - 15 15 15.5 10.8 1.2
RHP9 50 - 20 - 15 15 15.5 11.8 1.2
RHP10 20 - 50 - 15 15 16.4 14.6 1.1
RHP11 - - - - 10 90 28.7 30.1 1.3
RHP12 50 25 20 - - 5 22.3 27.5 1.7
RHP13 50 - 20 - 25 5 17.3 11.0 1.2
RHP14 70 - - - 25 5 16.0 11.1 1.2
a
Estimated by H-NMR and reported in kDa.
1
b
Estimated by gel permeation chromatography using DMF as the mobile phase and reported in kDa.
c
Dispersity.
of folding success without RHPs during cell-free synthesis (Fig. 2a). 0.5 mg ml−1 of RHP4 ensemble was added into FBS before heating, the
Experimentally, the RHP solution concentration was set to 0.2 wt%, cell viability was retained at 93.0 ± 12.2% of control FBS without thermal
well below the RHP’s critical overlap concentration (>10 wt% for treatment. The cell viability increased to 95.9 ± 10.8 and 104.8 ± 7.8% at
RHPs studied) to minimize crowding effects. The RHP–protein colli- RHP4 concentrations of 1 and 2.5 mg ml−1, respectively. FBS is a biologi-
sion rate is roughly 105 s−1 so that the transient RHP–protein interac- cal fluid commonly used in cell culture, so these studies indicate that
tions are not diffusion-limited on the basis of the translation rate of RHP ensembles with matching PCA spaces can interact with proteins as
10–20 amino acids per second in Escherichia coli27,28 and estimated if they were proteins themselves. In both studies, we minimized specific
RHP diffusion rate of roughly 50 μm2 s−1. In the presence of RHP1–7, a factors such as molecular chaperones, osmolytes and crowding effects
nearly twofold increase in the AqpZ-eGFP protein yield was observed for protein stabilization29–31. These results further confirmed the ability
(Fig. 2b) using 35S-methionine labelling, and there were improve- of RHP ensembles to navigate through compositional uncertainties
ments in the AqpZ-eGFP’s folding status (Fig. 2c,d and Supplemen- during random encounters.
tary Fig. 12). Both results are positive indications of RHPs’ protein-like
behaviour. RHP4 has the highest level of overlapping PCA space with
proteins and was the best performer. Similar trends were observed RHP segment availability depends on local RHP–protein
for PepTso with RHP5-6 being the best two performers. OmpT has a interactions
fairly good folding status without RHPs (Supplementary Fig. 13); this Each RHP ensemble includes several segments that span a range of
was attributed to its lower apparent hydrophobicity compared to the segmental hydrophobicity and sequential arrangements within an RHP
other membrane proteins, as seen by its higher PC1 value. RHP1–3 chain. Ultimately, the availability of these segments during random
with higher PC1 values were the most effective in mediating OmpT encounters governs the apparent protein–RHP interactions. Thus, we
folding, whereas RHP6–7 with lower PC1 values have deleterious probe whether the spatial arrangement of segments can be influenced
effects. by their immediate environment and the segmental sequence. Solution
We further probed the interplay between RHP ensembles and bio- small-angle X-ray scattering (SAXS) studies showed that RHP4 in water
logical fluids on thermal denaturation as an accelerated case of how formed a single-chain nanoparticle, 8.8 nm in average diameter, to bury
proteins under stress sample different conformations and interact hydrophobic monomers (Fig. 3a). Proton nuclear magnetic resonance
with surrounding molecules. Studies were carried out using FBS, a (1H-NMR) studies of RHP4 in D2O showed that the surface-exposed
complex mixture of more than 1,000 proteins and other components25. segments are more hydrophilic and mobile; the buried segments are
Without RHPs, precipitates formed in the FBS solution within several more hydrophobic and have a low tendency to snorkel to the surface of
days when stored at room temperature. When RHPs were added, visual globular RHP chains (Extended Data Fig. 3a), consistent with previous
inspection showed a substantial reduction in the formation of pre- atomistic molecular dynamic simulations32. However, from 1H-NMR,
cipitates over 1 month without refrigeration. The precipitation was the full-width at half-maximum (FWHM) accounting for the end-methyl
more obvious when the FBS was heated without RHPs for 2.5 h at 52 °C protons of the EHMA side-chain and backbone methyl protons tran-
(Fig. 2e), indicative of increased protein denaturation. When different sitioned from being fairly broad to sharp on heating from 25 to 70 °C
RHP ensembles were compared, RHP4 performed better than RHP7 and (Fig. 3b and Extended Data Fig. 3b). In the same temperature range,
RHP2 in stabilizing FBS and was used for subsequent studies (Extended the FWHM of protons from the end methyl group in the OEGMA side
Data Fig. 2). When the thermally treated FBS was used as a growth sup- chains remained sharp consistently (Extended Data Fig. 3c). This result
plement for in vitro cell culture of NIH3T3 fibroblast cells, there was indicates buried hydrophobic residues or segments become more flex-
a 19.1 ± 8.5% (mean ± s.d., n = 8) reduction in the cell viability. When ible and solvated on heating33. Adding dimethyl sulfoxide (DMSO) into
Ribosome Inactive
Active
Misfolded
PC2
mRNA
Polypeptide
PepTso Aquaporin Z OmpT
Matched RHP Folded
PC1
1.5 1.5
40 40
AqpZ-eGFP yield (μg)
I(RHP)/I(control)
I(RHP)/I(control)
I(RHP)/I(control)
30 30
1.0 1.0
20 20
0.5 0.5
10 10
0 0 0 0
l
P1
P2
P3
P4
P5
P6
P1
RH 2
RH 3
RH 4
RH 5
P6
RH 1
RH 3
RH 4
RH 5
RH 6
P7
RH 1
RH 2
RHP3
RH 4
RH 5
RH 6
P7
tro
P
P
P
P
P
P
P
P
P
P
P
P
P
P
RH
RH
RH
RH
RH
RH
RH
RH
RH
RH
on
C
e
1.2 No FBS Native FBS Heated FBS
0.8
Cell viability
0.6
0.4
52 ºC 0.2
With RHP4
0
0 0.25 0.50 1.00 2.50
RHP4 (mg ml–1)
Fig. 2 | RHP/protein PCA space overlap determines their interplay. a, Scheme of RHP, respectively. Error bar is 1 s.d. e, The left shows the presence of RHP4
showing RHPs facilitate a top-down conformational sampling process of prevents FBS precipitation on heating. The right shows the cell viability of NIH3T3
membrane proteins during protein folding. b, Protein yield of AqpZ-eGFP in as a function of RHP4 concentrations (n = 8; the final RHP concentrations in the
8 μl of cell-free reaction in the presence of 0.2 wt% RHPs (n = 2). Error bar is 1 s.d. cell culture media were diluted fivefold from labelled concentrations in the
c, PCA map showing the segment distributions for both RHP libraries and x axis). Error bar is 1 s.d. The cell viability was indirectly measured by metabolic
tested proteins (OmpT (β-barrel), AqpZ (α-helical) and PepTso (α-helical)). viability-based assays using tetrazolium salts, MTT. At any given concentration
d, Folding status of AqpZ-eGFP, PepTso-eGFP and OmpT-eGFP in the presence of RHP4, RHP4 alone (no FBS), fresh FBS–RHP4 mixture (native FBS) or heated
of 0.2 wt% RHPs based on the eGFP fluorescence (n = 3). I(RHP) and I(control) FBS–RHP4 mixture (heated FBS) was fed into the cell culture media.
are the fluorescence intensity of tested proteins in the presence and absence
the D2O has a similar effect to heating and also causes the proton peak chain can effectively modulate its side-chain distribution on the basis
of the EHMA side chains to sharpen (Extended Data Fig. 4). of the proteins it contacts, and can thus provide matching segments
During random encounters, the molecules in contact with an RHP can on-demand to assist proteins as they traverse back to their native states.
locally solvate and lower the energy barrier to surface-expose amphiph- An RHP chain can be viewed as an equivalent freely jointed chain with
ilic or hydrophobic RHP segments34. No method exists to directly image segments spanning a range of segmental hydrophobicity (Fig. 3d). The
the RHPs’ conformations when they transiently interact with proteins, exchange dynamics of each segment depend on its hydrophobicity and
so an atomistic molecular dynamics simulation was performed. In the length, analogous to the single-chain desorption or exchange kinetics
simulation, a non-polar hexane nanodroplet was placed near an RHP4 in of amphiphilic block copolymers35. To understand how the segment
water. Our simulations showed that an RHP4 globule can be fused and length affects RHPs’ conformational plasticity, we synthesized two
subsequently unravelled at the interface very quickly (roughly 100 ns) DHPs, p(MMA-co-EHMA)-b-p(OEGMA-co-SPMA), with the same compo-
(Fig. 3c). This is by stark contrast to frozen RHP4 backbones observed sition as RHP4, but different molecular weights (Mn (DHP1) of 17.3 kDa
in pure water32. There is a substantial conformational rearrangement and Mn (DHP2) of 30.5 kDa). DHPs have multimodal distributions in the
of RHP at the hexane nanodroplet/water interface, shielding non-polar PCA space that account for 50-mers from the p(MMA-co-EHMA) block,
groups from exposure to water (Supplementary Figs. 14–16). When all in-between block or p(OEGMA-co-SPMA) block, respectively (Extended
studies are considered together, it is reasonable to conclude that an RHP Data Fig. 5). The occupied PCA space shifts along both PC1 and PC2
a b O * O c
S
O
O - K+
* O
Inwards Outwards
T/ºC
*** n
100 O RHP
RHP4 70
10 Fitted spheroid 65
60
55
1
I(Q)
50
45
0.1 40
37 Hexane droplet
0.01 30 Time
2 3 4 5 6 7 89 2 3 2.4 2.2 2.0 1.8 1.6 1.4 1.2 1.0 0.8 0.6
0.1 δ (ppm)
Q (A–1)
d e
Hydrophilic
18 50
RHP4
AqpZ-eGFP fluorescence
16 DHP2 40
14 DHP1
30
12
HLB
10 20
Hydrophobic
8 10
6
0
0 20 40 60 80 100 120 140 160 Control DHP1 DHP2 RHP4
Position
Fig. 3 | RHPs provide diverse segments with a defined range of segmental orange with MMA, OEGMA, EHMA and SPMA in grey, blue, red and yellow,
hydrophobicity to modulate transient intermolecular interactions. a, The respectively. d, Sliding window analysis showing the segmental hydrophobicity
solution SAXS profile of RHP4 in water at 5 mg ml−1 fitted using a spherical model along a chain of RHP4, DHP1 and DHP2, respectively. The hydrophobicity of
with a diameter of 8.8 nm. b, Part of 1H-NMR spectra of RHP4 as a function of each monomer along a polymer chain was evaluated by the average HLB value
temperature (30–70 °C). c, RHP4 adjusts local segmental conformation when of a sliding window. Differences in the diversity of segments are seen between
exposed to a droplet of hexane, suggesting RHP segments could be available RHPs and diblock copolymers. The block length in copolymers also defines the
based on the surface of protein in contact. The RHP side-chain configurations range of segmental hydrophobicity. e, The folding status of eGFP-fused AqpZ
at the interface towards the hexane phase (‘inwards’) and towards the water in the presence of 0.2 wt% DHP1, DHP2 and RHP4, respectively (n = 3). The
phase (‘outwards’) are shown. The system was equilibrated over 100 ns and corresponding fluorescence intensity is normalized to that measured from
explicit solvent and counterions are omitted for clarity. Hexane is shown in the control experiment (no RHP). Error bar is 1 s.d.
axes, leading to a substantial deviation from the protein PCA space. In more relevant because they access key characteristics such as chemical
an assay of AqpZ folding status, DHP1 could increase the eGFP fluores- diversity, compositional complexity and uncertainty10,36–38. As a test
cence intensity during translation, but did not perform as well as its RHP case, a new RHP library was synthesized to mimic cytosols with common
counterparts (Fig. 3e). Negligible enhancement of eGFP fluorescence functions including: (1) tunable microscopic LLPS under biologically
was detected when DHP2 was used. Dynamic light scattering (DLS) relevant conditions; (2) the ability to interface and modulate protein
measurements showed that both DHPs have bimodal size distributions folding and stability and (3) compartmentalization of biomolecules
with a mean diameter of 56.2 nm for DHP1 (Supplementary Fig. 17) and such as DNAs to modulate their bioavailability. Designing RHPs to
145.5 nm for DHP2 (Supplementary Fig. 18), much larger than the 9.1 nm fulfil many functions, each with a high level of biological importance,
diameter of their RHP counterpart (Supplementary Fig. 19). Thus, the will test RHPs’ similarities to natural proteins and the robustness of
PC2 value is important for predicting the RHPs’ tendency to form large population-based design.
assemblies that will compromise the PC1 similarity between RHPs and RHP8–14 (Table 1) were synthesized using 2–4 of the available mon-
proteins. The prevalence of short hydrophobic/amphiphilic blocks in omers: MMA, EHMA, OEGMA (Mn = 300 Da), OEGMA (Mn = 500 Da)
RHPs is critical to provide its conformational flexibility, thus ensuring and DMAEMA. Two OEGMA monomers with different side-chain
segments’ availability. lengths and DMAEMA were chosen to implement and modulate
temperature-dependent intermolecular interactions39 to access LLPS
under biologically relevant conditions. The RHP monomer ratios were
Designing new RHP ensembles as cytosol mimics selected to have different levels of overlap in the 2D PCA space with
Biomacromolecules need to function coherently regardless of their known proteins undergoing LLPS behaviours (from the LLPSDB data-
own specialties. We propose that the sequence space of proteins base40). Sequence analysis showed that RHP8–10 overlap with the 2D
encodes how protein mixtures behave beyond individual interactions. PCA space of proteins undergoing LLPS, and RHP11 lies outside the
Therefore, a population-based design approach for synthetic pro- protein space (Fig. 4a).
tein analogues is more meaningful than pursuing molecularly precise RHP8–10 formed spherical droplets suspended in the buffer at
formulations. In comparison to the model blends used at present to 47 °C for less than 1 min (Fig. 4a,b and Extended Data Fig. 6). The
replicate biological multi-scale phase behaviours, RHP solutions are cloud point temperatures of RHP8, 9 and 10 solutions at 1 mg ml−1
LLPS protein
PC2
0s 240 s 1,000 s
PC1
e FRAP
b 1.5
RHP8
Absorbance (600 nm)
RHP9
RHP10
1.0
RHP11
0.5
0s 750 s 2,050 s
0
25 30 35 40 45
Temperature (ºC) f
24-mer ssDNA
c
+RHP +RHP Cy3 Cy5
250
Proteinase K activity (%)
RT
200 61 ºC
Mixed Fused
62 ºC +
150
100
50
0
Proteinase K/RHP14
Control RHP1 RHP14
Fig. 4 | Designing RHP ensembles as synthetic mimics of cytosol. a, The PCA Error bar is 1 s.d. The original activity of ProK before heat treatment was set to
map of segment distributions for both RHP8–11 ensembles and proteins. b, The 100%. The right shows the confocal image that the fluorescein-labelled ProK
left shows the temperature-dependent turbidity for RHP8–11 ensembles was excluded from RHP14 droplets. RT, room temperature. d, Spherical RHP10
(1 mg ml−1 in sodium phosphate buffer (50 mM, pH 7.0)). The right shows a droplets fuse into a larger sphere. e, FRAP showing the dynamic reorganization
differential interference contrast image that RHP10 ensemble forms liquid of Cy3 dye within an RHP10 droplet. f, The confocal images of RHP10 coacervates
droplets at 47 °C. c, The left shows the normalized hydrolytic activity of ProK incubated with 3′-Cy3 ssDNA1 (24 nt; (CAGT)6), 5′-Cy5 ssDNA2 (24 nt; (ACTG)6)
before and after heat treatment in the absence or presence of RHPs (n = 3). or ssDNA1–ssDNA2 duplex. Scale bars, 5 μm.
(sodium phosphate buffer, 50 mM, pH 7.0) were determined to be was excluded from RHP14 liquid droplets (Fig. 4c). In comparison,
43, 40 and <25 °C, respectively. Under the same buffer condition, only 25% of ProK activity was retained with RHP1, which showed no
RHP11 showed no phase separation even up to 70 °C. Thus, match- LLPS. Together, these results indicated that once the LLPS occurred,
ing the PCA space between proteins and RHP ensembles is an effec- the hydrophobic RHP segments and some amphiphilic RHP segments
tive approach to replicate the collective behaviours of proteins, such became inaccessible to proteins outside the droplets. These segments
as LLPS. are the key to mediating membrane protein–water interactions and
We studied RHP–protein interactions with and without LLPS using assisting membrane protein folding. Their absence reduced the prob-
RHP12 and RHP13. Both have the same monomer ratio as RHP4, except ability of ProK misfolding during thermal denaturation. These results
that SPMA was replaced by DMAEMA and the side-chain length in also indicated these hydrophobic or amphiphilic segments provided
OEGMA was varied. RHP12 has a cloud point temperature of roughly the driving forces to form the liquid droplets. NMR studies showed no
67 °C and the cell-free AqpZ-eGFP folding assay at 37 °C confirmed that difference in the monomer compositions between the RHPs inside of
RHP12 (0.2 wt%) can facilitate AqpZ folding. In comparison, RHP13, the liquid droplets and the original RHP ensemble. Thus, it is reason-
which has a cloud point temperature lower than 25 °C, underwent LLPS able to speculate that the interchain interactions within the droplets
at 37 °C and showed no effect in the AqpZ-eGFP folding (Extended Data are dominated by the apparent segmental hydrophobicity within the
Fig. 7). A control experiment showed that RHP13 did not interfere with RHP chains instead of the whole chain.
eGFP expression or folding post translation. We also assessed how the RHP10 formed many small droplets that ranged from hundreds of
formation of liquid droplets might affect proteins on thermal denatura- nanometres to a few micrometres in size. They diffused, collided with
tion using a common enzyme, proteinase K (ProK). RHP1 has the most one another and fused together within a few minutes (Fig. 4d). Cyanine
PCA space overlap with ProK (Supplementary Fig. 20) and was the best 3 amine (Cy3) dye was concentrated in the droplets and used to probe
performer as ProK’s thermal protectant. RHP1’s monomer ratio was the local viscosity within droplets through fluorescence recovery after
adopted to synthesize RHP14 by replacing SPMA with DMAEMA to photobleaching (FRAP). Nearly complete fluorescence recovery was
induce LLPS. In the presence of RHP14, ProK retained 74 ± 5% enzyme observed with a characteristic recovery time of 385 ± 15 s (Fig. 4e and
activity after being heated at 62 °C for 10 min. In the control experi- Extended Data Fig. 9). This time scale is comparable to that of MEG-3
ments without RHPs, ProK lost roughly 97% of its enzymatic activity proteins (128–384 s) in P granules41,42. The RHP droplets have a fluidity
(Fig. 4c). RHP14 has a cloud point temperature of 33 °C (Extended Data similar to membraneless organelles, and offer a promising path towards
Fig. 8). Confocal studies showed that the fluorescein-labelled ProK their synthetic mimics.
Cell culture where c* is the critical overlap concentration, M is the average molecular
The NIH3T3 cell line was received frozen. The cells were thawed, diluted weight of the polymer, Rg is the radius of gyration of the polymer, and
in DMEM (Gibco, 4.5 g l−1 glucose, l-glutamine, sodium pyruvate, 10% NA is Avogadro’s number.
FBS) and incubated at 37 °C and 5% CO2. NIH3T3 cell line was divided
every 3 days. SAXS
SAXS was carried out at beamline 8-ID-E at the Advanced Photon Source,
MTT assay Argonne National Laboratory. Samples were dissolved in water at a
RHP was added to FBS at concentrations of 0.25, 0.5, 1 and 2.5 mg ml−1. range of concentrations from 0.2 to 2 wt%. Samples were measured in
The mixed solution was incubated at 52 °C for 2.5 h. The supernatant 2 mm boron-rich thin-walled capillary tubes and subject to several short
was collected after centrifugation (12,000g, 10 min) and diluted by exposures (5 s for each time). 2D scattering results were azimuthally
a factor of 5 in DMEM (Gibco, 4.5 g l−1 glucose, l-glutamine, sodium averaged to produce one-dimensional SAXS profiles. Superimposable
pyruvate, denoted SolA). NIH3T3 cells were seeded in 96-well plates profiles were averaged and then subtracted from the background data.
at 10,000 cells per well (culture volume 100 μl per well) and incubated The radius of gyration (Rg) of an RHP was obtained from the Guinier
at 37 °C and 5% CO2 for 16 h. The cells were then fed with SolA and incu- plot by fitting the scattering to the following equation, where q is the
bated at 37 °C and 5% CO2 for 24 h. The cell culture media was removed scattering vector, I(q) is the scattering intensity at q, and I(0) is the
and 50 μl of MTT reagent solution (0.5 mM in DMEM, Gibco, phenol intensity of incident beam:
red free, 4.5 g l−1 glucose, l-glutamine, sodium pyruvate) was added
per well. The plate was incubated at 37 °C and 5% CO2 for 30 min. Next, ln(I (q)) = ln(I0) − (R g2/3)q 2
150 μl of DMSO was added per well and the plate was shaken to dissolve
formazan completely. The absorbance at 570 nm was recorded using
Infinite M200 microplate reader (Tecan). Molecular dynamics simulation
The final frame from an equilibrated sequence (sequence 6) used in
Differential scanning calorimetry (DSC) previous work32 was extracted and solvated in a system containing
DSC measurements were implemented using the MicroCal VP-DSC a pre-equilibrated hexane droplet, four potassium counterions and
system (Malvern Panalytical). All samples were prepared in 50 mM 44,996 water molecules. The droplet is composed of 1,503 hexane
Sodium Phosphate buffer (pH 7.0) with 0.28 mg ml−1 ProK and as molecules and was formed with 63,898 water molecules through 2 ns
required, 1.5 mg ml−1 RHP. The samples were degassed for 8 min of equilibration and 40 ns of production simulation. The combined
using the MicroCal ThermoVac (Malvern Panalytical) before inser- system was equilibrated for 2 ns and then run at production setpoints
tion into the sample cell. When the pressure in the sample holder had for 100 ns. All simulations followed the methods and parameters used
stabilized at roughly 28 psi, the cells were cooled to 10 °C, followed in previous work, adopting the monomer parameterization methods
by a 15 min wait time. The thermograms were produced by meas- for hexane molecules. VMD was used for visualization of the result-
uring the difference in heat capacity between the sample solution ing trajectories43. Solvent accessible surface area (SASA) calculations
and the reference buffer solution as the temperature was increased were performed with Amber19’s LCPO default parameters44. SASA for
from 10 to 90 °C at a rate of 1 °C min−1. Following the retrieval of the hexane phase is taken as the SASA for the trajectory stripped of
the thermograms, the buffer–buffer reference thermograms were all non-polymer atoms (total RHP SASA) minus the SASA for the as-is
subtracted using OriginLab software, as was any linear baseline trajectory (water accessible RHP SASA).
observed.
Synthesis of oligonucleotide-RHP conjugate
DLS Buffer A (storage buffer): 20 mM sodium phosphate, pH 7.83
DLS measurements were conducted on a Brookhaven BI-200SM Light Buffer B: 200 mM sodium phosphate, 300 mM NaCl, pH 7.24
Scattering System at a 90° scattering angle. The concentration for each Buffer C: 100 mM sodium phosphate, 1,500 mM NaCl, pH 7.24
measurement was 5 mg ml−1 of RHP or 0.5 mg ml−1 of DHP. DNA1: GTCGCTCTCTCATGCAGAATCCCA, 1 mM in buffer A
DNA2: CTGCTGGGGCAAACCAGCGTGGAC, 1 mM in buffer A
Diffusion-limited collision rate estimation (dn/dt)
Synthesis of RHP with dual end-functional groups of –SH and –N3. An
dn /dt = j(r )4πr 2 = 4π Drc ∞ = konc∞ azido-modified chain-transfer agent (2-(dodecylthiocarbonothioylthio)-
2-methylpropionic acid 3-azido-1-propanol ester) was used to synthesize
where n is the number of molecules, t is time, j is the flux, r is the radius, RHP (RHP-N3). Before conjugation, 1 µl of hydrazine was added into
D is the diffusion coefficient, r is the radius of the protein of interest, 200 µl of RHP solution (20.30 mg, in THF). The mixture was placed on
Kon is the polymer-protein association rate, and c∞ is the bulk concen- a shaker for 0.5 h. RHP was purified by an Amicon-3K ultrafilter (3,000
tration of polymers. MWCO) using de-ionized water six times.
was first one-hot encoded and then passed through the encoder. The
Synthesis of DNA1-RHP conjugate through thiol-maleimide addition. encoder embedded each sequence into a 16-dimensional latent vector,
Here, 1.5 mg of sulfo-SMCC45 was dissolved in 100 µl of H2O (heated up z, which was then fed into two parallel branches: the decoder and the
to 50 °C for clear solution), followed by the addition of 100 µl of buffer regressor. The decoder intended to reconstruct the input sequence
B. Then 10 µl of 3′-amine-modified DNA1 was added. The solution was from z, whereas the regressor predicted the HLB values of an input
placed on a shaker for 2 h at room temperature. The excess sulfo-SMCC sequence from z. The loss function was designed to be a weighted sum
was removed by an Amicon-3K ultrafilter (3,000 MWCO) using buffer of the departure (for example, cross entropy) of the original and recon-
B six times. Then, 5 nmol of purified sulfo-SMCC-DNA1 (90 µl in buffer structed sequence and the mean squared error of predicted and true
C) was mixed with roughly 2 mg of RHP (10 µl in DMF). The reaction was HLB values. A meaningful low-dimensional latent space that captures
placed on a shaker overnight at room temperature. After the reaction, both sequential features and HLB distributions was obtained by opti-
the excess oligonucleotide was removed by Amicon-3K by washing with mizing the reconstruction and regression loss together.
de-ionized water six times (Supplementary Fig. 21). Both the encoder and the decoder were implemented with simple
multilayer perceptrons. Each had three fully connected layers with 256,
Synthesis of DNA1-RHP-DNA2 conjugate through azide-alkyne cy- 128 and 64 hidden units. The regression module had two fully connected
cloaddition. Here, 10 µl of 5′-hexynyl-modified DNA2 (1 mM in buffer A) layers with 16 hidden units. Rectified linear unit non-linear functions
was mixed with 4 µl of DNA1-RHP conjugate (roughly 1 nmol), followed were used throughout the network, except that Sigmoid activation
by the addition of 17 µl of DMF. Then 10 µl of fresh click-reaction solu- was used in the output layer of the decoder. The model was trained
tion (10 mM CuSO4, 50 mM TBTA, DMF/H2O = 1:1) and 3 µl of sodium using the ADAM optimizer with a learning rate of 0.001. A learning rate
ascorbate (100 mM in water) were added. The mixture was placed on scheduler was used to reduce the learning rate when the validation loss
a shaker overnight at room temperature. The excess oligonucleotide stopped improving. All model hyperparameters were optimized with
was removed by an Amicon-3K ultrafilter (3,000 MWCO) using water Weights and Biases47. We also implemented a LSTM-based autoencoder,
six times. which demonstrated similar performance as the simpler autoencoder
variant model.
Single-molecular force spectroscopy
Single-molecule force-extension measurements were carried out in a Coacervation
dual-trap optical tweezers instrument equipped with a 1,064 nm trap- The lyophilized RHP was dissolved in Mill-Q water (30 mg ml−1). Then
ping laser46 at a trap stiffness of 0.1 to 0.2 pN nm−1. First, biotinylated 1 μl of RHP solution was mixed with 29 μl of sodium phosphate buffer
double-stranded (3 kilobases (kb)) DNA handles with 24 nucleotide 5′ (50 mM, pH 7.0). The coacervation was triggered by incubating the
or 3′ terminal single-stranded overhangs complementary to DNA1 or solution at 47 °C. The milky colour appeared in less than 1 min and
DNA2, respectively, were deposited on streptavidin-coated polystyrene coacervation was confirmed by bright-field microscopy. For ssDNA
beads (1 µm). Individual RHP chains were captured between trapped partitioning, 1 mg ml−1 RHP and 1 μM ssDNA (50 mM sodium phos-
beads by hybridization of their conjugated DNA to the overhangs in phate buffer, pH 7.0) were incubated at 37 °C for 10 min before imag-
buffer containing 20 mM Tris∙HCl (pH 7.2), 100 mM KCl, 10 mM MgCl2 ing. Before the dsDNA partitioning, two complementary ssDNA (5 μM
and 5 mM beta-mercaptoethanol. Pulling and relaxing force ramps for each) were mixed and heated at 95 °C for 2 min, then immediately
were performed at a rate of 100 nm s−1 from less than 1 pN to up to cooled at 4 °C for 5 min. The resulting dsDNA solution were diluted to
25 pN and repeated several times for each molecule. Force-extension 1 μM and mixed with 1 mg ml−1 of RHP. The solution was incubated at
data were collected at 667 Hz. For molecules that showed a rip in their 37 °C for 10 min before imaging.
FEC, passive-mode (constant trap position) measurement was also The sequence of ssDNA is shown below:
performed. Unfolding work was calculated by integrating each FEC /5Cy5/ACTGACTGACTGACTGACTGACTG;
and subtracting the contribution of the worm-like-chain behaviour CAGTCAGTCAGTCAGTCAGTCAGT/3Cy3Sp/.
of bare 6 kb handle DNA and unfolded RHP.
Microscopy
RHP sequence generation The differential interference contrast microscopy was performed using
An in-house sequence simulator called Compositional Drift20 was used a Zeiss AxioImager M2 microscope equipped with a Zeiss Plan-Neofluar
to generate 15,000 chains for each RHP ensemble (DP = 50). Ph3 ×100/1.30 oil-immersion objective and QImaging Retiga 1350EX
1.4MP Monochrome CCD Microscope Camera. The DNA partitioning,
Training dataset RHP droplet fusion and FRAP was imaged using a Zeiss LSM 880 FCS
To train the sequence autoencoder, 30,000 membrane protein confocal microscope with X-Cite 120LED illumination system and GaAsP
sequences and 30,000 globular protein sequences with 50% identity photon counting detector. For ssDNA partitioning, illumination was
threshold were collected from the UniProt database16. Sequences with provided by a laser with the wavelength of 514 nm (for Cy3 or Cy3-Cy5
uncommon amino acids were discarded. Each protein was reduced into FRET pair) or 633 nm (for Cy5). Images were averaged from eight con-
four monomer codes. The assignment of each residue to its monomer secutive images and were of the format 1,024 × 1,024 pixels at an 8-bit
equivalent is listed in Extended Data Table 1 and Supplementary Tables 1 depth. RHP droplet fusion was imaged every 2 s under transmitted
and 2. For each protein sequence, a set of consecutive protein motifs light in a format of 512 × 512 pixels at an 8-bit depth.
were collected by moving a 50-residue long window over each sequence
with 15-residue long step size, resulting in a total of 1,046,845 training FRAP
sequence motifs. Here, 50 μM of Cy3 amine (Lumiprobe, 410C0) was used to probe FRAP
within the RHP droplets. The pinhole size was set to 1.5 μm section. FRAP
Latent variable model measurement was performed by selecting a thin square region of inter-
An in-house latent variable model was developed to perform sequence est in the centre of a droplet, bleaching with the 488 nm laser line at 4%
dimensionality reduction and to learn protein/RHP sequence rep- for 20 s. The photobleached droplet was imaged every 5 s in a format of
resentations. The model was implemented on the basis of a typical 512 × 512 pixels at a 12-bit depth (four repetitions). The FRAP analysis was
autoencoder architecture with an extra regression module to force the carried out using Fiji software. Before photobleaching, the fluorescence
latent space to learn sequence hydrophilic-lipophilic balance (HLB) intensity from assigned bleached area and unbleached area was denoted
distributions. Each protein sequence motif (in its RHP equivalent form) as Ibbefore(t) and Iubefore(t), respectively. Ibafter(t) and Iuafter(t) represented
Article
the fluorescence intensity from bleach and unbleached area at time t 45. Xiao, L., Zhou, Z. J., Feng, M. L., Tong, A. J. & Xiang, Y. Cationic peptide conjugation
enhances the activity of peroxidase-mimicking DNAzymes. Bioconjugate Chem. 27,
after photobleaching. All fluorescence intensities were normalized by 621–627 (2016).
the area. The centre-to-ratio was denoted as rbefore = Ibbefore(t)/Iubefore(t), 46. Comstock, M. J., Ha, T. & Chemla, Y. R. Ultrahigh-resolution optical trap with single-
r after = Ibafter(t)/Iuafter(t). Thus, the recovery rate (R) was calculated by fluorophore sensitivity. Nat. Methods 8, 335–382 (2011).
47. Biewald, L. Machine learning experiment tracking. Weights & Biases https://www.wandb.com
(2020).
R = (r after(t)− r after(0))/(r before − r after(0)).
The recovery rate curve was fitted by an exponential function: Acknowledgements The work was supported by the US Department of Defense (DOD), Army
Research Office, under contract no. W911NF-13-1-0232, Defense Threat Reduction Agency
(DTRA) under contract no. HDTRA1-19-1-0011, the National Science Foundation under contract
R = A(1 − et /τ ) no. DMR-2104443, the US Department of Energy, Office of Science, Office of Basic Energy
Sciences, Materials Sciences and Engineering Division, under contract no. DE-AC02-05-CH11231
(KC3104) and the Alfred P. Sloan Foundation (grant no. G-2021-16757). Z.R. is supported by
where A and τ represent the maximal recovery rate and recovery half the Kavli Energy NanoScience Institute through the Kavli ENSI Philomathia Graduate Student
time, respectively. Fellowship Program. Scattering studies were done at Advanced Photon Source and use of the
Advanced Photon Source was supported by the US Department of Energy, Office of Science,
Office of Basic Energy Sciences, under contract no. DE-AC02-06CH1135.
Data availability Author contributions T.X. conceived the idea and guided the project. Z.R. and T.J. performed
All data needed to evaluate the conclusions in the paper are present cell-free synthesis of membrane proteins. Z.R. and A.G. performed thermal denaturation of
globular enzymes. S.L., I.J., Z.R. and H.H. performed sequence analysis. H.A. and C.B. performed
in the paper and/or the supplementary materials. For reproduction optical tweezers analysis. S.H. and A.A.-K. performed all-atom simulation studies. Z.R. and Z.G.
purposes, the raw data used to generate the figures are available from synthesized and characterized the RHPs and DHPs. H.C. performed the cell study. A.G. and H.C.
the Dryad Digital Repository (DOI:10.6078/D1KH8R ). performed the confocal study. All authors participated in writing the manuscript.
Competing interests T.X., H.H., Z.R. and S.L. have a pending PCT patent application. The rest
of the authors declare no competing interests.
Code availability
Source code and input scripts supporting this work are available at Additional information
Supplementary information The online version contains supplementary material available at
https://github.com/Shunili/AE-RHP. https://doi.org/10.1038/s41586-022-05675-0.
Correspondence and requests for materials should be addressed to Ting Xu.
43. Humphrey, W., Dalke, A. & Schulten, K. VMD: visual molecular dynamics. J. Mol. Graph Peer review information Nature thanks the anonymous reviewers for their contribution to the
Model 14, 33–38 (1996). peer review of this work. Peer reviewer reports are available.
44. AMBER 2019 (Univ. California, San Francisco, 2019). Reprints and permissions information is available at http://www.nature.com/reprints.
Extended Data Fig. 1 | Blocks and 50-mers along a polymer chain. (a) Each monomer was reassigned to one of two pseudo-monomers (hydrophobic vs.
hydrophilic) based on monomer’s hydrophobicity. A block comprises consecutive monomers of a single type. (b) A polymer chain was truncated into a set of 50-mers.
Article
Extended Data Fig. 2 | The FBS solution with different RHP ensembles after
incubating at 52 °C for 2.5 h. The FBS solution forms a thin film (like “milk skin”)
at the air-water interface after thermal treatment (red circle). RHP4 exhibits
the weakest tendency for formation of this thin film among three tested RHP
ensembles. The solution is stirred to tear the thin film into suspended flakes for
visualization.
Extended Data Fig. 3 | Temperature-dependent 1H-NMR spectrum of RHP4 (30–70 °C). (c) Part of 1H-NMR spectra of RHP4 as a function of temperature
in D2O. (a) 1H-NMR spectrum of RHP4 in D2O at 37 °C and its chemical structure. (30–70 °C) including proton peaks of the OEGMA side chain.
(b) The FWHM of proton peaks (a, p, and n) as a function of temperature
Article
Extended Data Fig. 6 | Differential interference contrast (DIC) images of (a) RHP8 (b) RHP9 phase-separated droplets. Each sample is 1 mg/ml in sodium
phosphate buffer (50 mM, pH 7.0).
Extended Data Fig. 7 | Folding status of AqpZ-eGFP in the presence of 0.2 wt%
RHPs based on the eGFP fluorescence. Error bar is 1 s.d and n = 3.
Article
Extended Data Fig. 8 | Temperature-dependent turbidimetry for RHP14 ensemble. The polymer solution is 1mg/ml in sodium phosphate buffer (50 mM, pH 7.0).
Extended Data Fig. 9 | FRAP analysis of liquid-like coacervates made from RHP10 ensemble. The recovery trace shows the normalized recovery of a bleached
region. Solid red curve fits to an exponential function (see FRAP method section).
Article
Extended Data Table 1 | The conversion from amino acids to RHP monomers (n = 4)
Article
https://doi.org/10.1038/s41586-022-05683-0 Susan Solomon1,7 ✉, Kane Stone1,7 ✉, Pengfei Yu2, D. M. Murphy3, Doug Kinnison4,
A. R. Ravishankara5,6 & Peidong Wang1
Received: 9 August 2022
Massive wildfires in Australia during the austral summer of 2019–2020 variety of complex organic compounds, including, for example, furans
(December–January) produced pyrocumulonimbus towers that and phenolic compounds, and large-molecular-weight species and
released about 0.9 Tg of wildfire smoke into the stratosphere12,14. Wild- humic-like substances can also be present20. Levoglucosan is a marker
fires are also sometimes denoted as bushfires, wildland fires and forest for biomass-burning aerosols derived from the burning of cellulose and
fires; here we refer to them as wildfires. Wildfire smoke can be expected hemicellulose and is found in high concentrations in fresh tropospheric
to be primarily composed of organic material, but its stratospheric plumes21. But levoglucosan is oxidized in particles by, for example,
chemistry is virtually unknown. reaction with OH, with a lifetime of about 1 day (ref. 22), and secondary
aerosol formation by other species is probably also important23,24.
Here fresh smoke need not be explicitly considered because we are
Wildfire aerosol composition and ageing interested in effects over timescales of weeks to months after the fires.
Airborne mass spectrometry data15–17 showed that carbonaceous com- The stratosphere is a highly oxidizing environment owing to high con-
pounds were frequently present in about 30–40% of individual particles centrations of ozone and free radicals.
in the background Northern Hemisphere tropopause and lowermost There is strong observational evidence for oxidation of many of
stratosphere region. The carbonaceous fraction was largely internally the complex organic species seen in fresh plumes in the troposphere.
mixed with sulfate (that is, both sulfate and carbon were contained Tropospheric observations show a variety of alcohols and acids in
within single particles, although whether the latter took the form of a aged smoke particles. A wide range of organic acids were identified in
coating was not determined). Although the airborne instrument was tropospheric smoke from Portuguese wildfires, including oleic acid
not flown through the Australian event, wildfire smoke of the Pacific (cis-9-octadecenoic acid), succinic acid, heptanedioic acid, malic acid
Northwest Event in 2017 showed about a doubling of the carbonaceous/ and oxo-acids, as well as several methoxyphenols and alcohols; n-alkanols
sulfate aerosol population17. from C10 to C30 and n-alkanoic acids from C6 to C30 were also reported6,24.
Aged stratospheric smoke particles can be characterized by thick Oxalic acid is frequently among the most abundant single species found
coatings18. Infrared satellite spectra of the stratospheric wildfire smoke in aged tropospheric wildfire smoke aerosols3–6,25,26. It has been shown
particles after the 2020 event showed signatures of oxidized organic that organic acid content increased with smoke particle ageing and that
matter, in particular the OH and C=O stretch features2,19. The smoke carbohydrates such as levoglucosan are converted to organic acids dur-
aerosols are referred to hereafter as organic. ing upward transport3. Aged aerosols from burning Australian vegetation
Although the detailed composition of stratospheric smoke aerosols have also been found to be hygroscopic and contain oxidized material7,
has not been determined, tropospheric studies provide insights at although whether eucalyptus burning might produce different specific
lower altitudes. Fresh tropospheric wildfire plumes contain a wide organics than other vegetation types merits further study.
1
Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA, USA. 2Institute for Environmental and Climate Research, Jinan University,
Guangzhou, China. 3NOAA Chemical Sciences Laboratory, Boulder, CO, USA. 4Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research,
Boulder, CO, USA. 5Department of Chemistry, Colorado State University, Fort Collins, CO, USA. 6Department of Atmospheric Science, Colorado State University, Fort Collins, CO, USA.
7
These authors contributed equally: Susan Solomon, Kane Stone. ✉e-mail: solos@mit.edu; stonek@mit.edu
ppm anomaly
0.2
0
The high solubility of HCl in oxidized organics (Fig. 1) indicates that
reaction (5) should occur readily at stratospheric temperatures. This –0.2
process competes with the first step of reaction (2):
–0.4
+ +
HClONO2 (l) + H2O(l) → HNO3 (l) + H2OCl (l) (6) –0.6
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
The high solubility of HCl in organic acids suggests that the avail- HCl
able HClONO2+(l) should be more likely to react with HCl(l) than with 0.2
H2O(l) in mixed organic/sulfate particles following this mechanism.
This is consistent with the known reactivities of reactions (1) and (2)
0
in liquid sulfate aerosols as HCl solubility and hence HCl(l) concen-
ppb anomaly
trations increase at cold temperatures below about 195 K, enhancing
reaction (1) while suppressing reaction (2); by contrast, reaction (2) is –0.2
faster than reaction (1) in sulfate particles at warmer temperatures41.
Reactions (3) and (4) would also be enhanced by high concentrations
–0.4
of HCl(l) and are included here.
To explore the influence of HCl solubility in wildfire particles,
we carried out several tests. In one test, we use the HCl solubility in –0.6
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
hexanoic acid data (hereafter referred to as solubility case) of Fig. 1 as
approximately representative for the oxidized organic/sulfate particles 0.6
ClONO2
(see Methods), which greatly increases the rates of reactions (1), (3)
and (4) at warmer temperatures >200 K. In a second test, we treat the
liquid organic portion of the particles like water at all temperatures, 0.4
that is, we simply impose a dilution factor (dilution case) proportional
ppb anomaly
Pressure (hPa)
10 MLS/ACE 2020 observations
organics. This yields subsequent rapid reactions of HCl with ClONO2,
20
HOCl, and HOBr in the particles at relatively warm mid-latitude tempera-
tures, with reaction (1) being the dominant process in the present model. 50
On the basis of the dilution case, it seems that the ClONO2 + H2O reaction 100
is suppressed relative to the ClONO2 + HCl reaction in these particles. 200
In contrast to HCl, satellite measurements indicate that stratospheric 500
nitric acid was not markedly perturbed by the Australian smoke44 and 1,000
–14 –12 –10 –8 –6 –4 –2 0 2 4
the model is consistent with those data (Extended Data Fig. 4). High val-
×1011
ues of ClONO2 are maintained in the sunlit atmosphere in the solubility HCl
case, limiting the potential for ozone loss despite a rapid heterogeneous 1
rate for reaction (1). This is owing to continuing HNO3 photolysis and 2
reaction with OH, leading to reduced but non-zero values of observed 5
NO2 (ref. 40) and hence reformation of ClONO2. Thus, a different balance
Pressure (hPa)
10
is obtained in mid-latitudes compared with the cold and dark polar 20
regions, in which essentially no NO2 is available to reform ClONO2 after 50
heterogeneous loss, allowing far greater ClO anomalies to build up and 100
form the ozone hole40. Nonetheless, ClONO2 itself photolyses rapidly 200
and is approximately in photochemical steady state with ClO under 500
sunlit mid-latitude conditions, so increased ClONO2 as seen in Fig. 2 1,000
implies that some increases in ClO and ozone loss must occur. The –12 –10 –8 –6 –4 –2 0 2 4
shifts in chlorine chemistry result in a threefold calculated increase in ×108
ClONO2
ClO, consistent with observations, and this leads to most of the peak 1
local ozone depletion of 10–20% during May to December as shown, 2
which is in accord with the record-low local ozone in this region in 5
June according to the data (Fig. 2). Extended Data Fig. 5 shows that
Pressure (hPa)
10
the observed ozone loss profiles on coincident days of observation are 20
similar between ACE and MLS for June–July as an example comparison.
50
Vertical anomaly profiles of HCl, ClO and ClONO2 averaged over
100
all available data and all model days for June–July 2020 at southern 200
mid-latitudes are also fairly well captured by the solubility case, albeit
500
with some overestimates at higher pressures (lower altitudes), further
1,000
supporting the proposed mechanism through its links to the profile –2 0 2 4 6 8 10 12
of wildfire aerosols (Fig. 3). As in Fig. 2, the data do not agree with the ×108
model dilution case. Corresponding absolute values are shown in ClO
1
Extended Data Fig. 6. 2
The model suggests that the wildfire aerosols chemically deplete
5
the mid-latitude total ozone column from 30–50° S by up to 18 Dobson
Pressure (hPa)
10
units (DU), roughly triple the amount obtained from N2O5 hydrolysis
20
alone, yielding about 3–5% total chemical column loss depending on
the month of 2020. Such changes are relatively small compared with 50
100
the effects of interannual dynamical variability at mid-latitudes and
200
there is evidence for some dynamically driven decreases in ozone in
2020 (refs. 1,45). Recent studies suggest that the radiative perturbations 500
linked to wildfire smoke affected 2020 Southern Hemisphere dynamical 1,000
–6 –4 –2 0 2 4 6 8
conditions and possibly ozone, which could represent feedbacks in Number density anomaly (cm–3) ×107
addition to the direct chemical effects evaluated here46,47. Nevertheless,
the chemical changes are substantial in comparison with the 1% per Fig. 3 | Observed and modelled vertical profile anomalies in chemical
decade increase expected owing to long-term decreases in halocarbons species from 30–50° S in June–July 2020. Grey shaded regions show the
ranges of 24-h averaged satellite data anomalies relative to the climatologies
that have occurred under the international Montreal Protocol and
of satellite observations before 2020 (daily O3 and ClO from MLS and HCl and
indicate that delays in ozone recovery could occur if wildfires become
ClONO2 from ACE, with coverage to low altitudes), whereas black lines show
more frequent or intense in the future.
observed anomalies for 2020. Other coloured lines denote calculated
Some studies have speculated that wildfires may deplete polar anomalies relative to the modelled no organics control for three model test
ozone48. The Antarctic ozone hole of 2020 was both large in area and cases: including only N2O5 hydrolysis on the aerosols (dashed brown line),
of record duration (lasting through late December)49. In sharp contrast considering the added organic material as a dilution factor (dashed green line)
with mid-latitudes, we find that the observed polar 2020 abundances and considering the adopted solubility of HCl in organic particles (red line).
of ozone, HCl, ClONO2 and ClO for 68 hPa from 70–80° S show few
marked departures from the ranges of previous years (Fig. 4). The
small influence of our wildfire chemistry mechanism on ozone losses below about 200 K (Fig. 1), that is, in polar winter and spring when the
in Antarctic spring can be expected because the adopted solubility ozone hole forms. Larger local ozone changes are obtained close to the
of HCl in organics becomes smaller than that of typical liquid PSCs tropopause (that is, 100–200 hPa; see Extended Data Fig. 7), at which
1.5 No organics this unusual behaviour. Temperatures at these latitudes and times
Solubility
are comparable with those in mid-latitudes, so this is to be expected
1.0 Dilution
N2O5 only through the added chemistry. The observed HCl inside the polar vortex
0.5 MLS/ACE 2020 observations is also effectively entirely removed by June–July in 2020, considerably
MLS/ACE 2005–2019 observations lower than the no organics control case or data in other years (Fig. 4
0 and maps in Extended Data Fig. 8).
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec A long-standing puzzle in stratospheric chemistry is that the
HCl observed timing of early winter HCl decline in the Antarctic and occa-
3.5
sionally in the Arctic typically occurs earlier than models predict (see
3.0 the comprehensive review in ref. 50), as illustrated in Fig. 4 and Extended
Data Fig. 8 for the no organics control case of this model (similar to
2.5
other models)50. Our simulations raise the question of whether early
2.0 polar winter HCl declines could be linked to background levels of
ppb
edu/models/cesm1.2/cesm/doc/usersguide/x290.html. The changes Author contributions S.S. and K.S. contributed equally and are co-first authors of this study.
described herein for the kinetics parameterization are available at S.S., K.S., P.Y. and D.M.M. designed the initial work. K.S. analysed the data and refined the study
https://doi.org/10.7910/DVN/GHNJQA. design and produced the figures. S.S. drafted the initial text. K.S., D.M.M., D.K., A.R.R. and P.W.
contributed substantially to the interpretation of findings and to the revisions of the
manuscript.
51. Bardeen, C. G., Toon, O. B., Jensen, E. J., Marsh, D. R. & Harvey, V. L. Numerical simulations
of the three-dimensional distribution of meteoric dust in the mesosphere and upper Competing interests The authors declare no competing interests.
stratosphere. J. Geophys. Res. 113, D17202 (2008).
52. Toon, O. B., Turco, R. P., Westphal, D., Malone, R. & Liu, M. A multidimensional model for Additional information
aerosols: description of computational analogs. J. Atmos. Sci. 45, 2123–2143 (1988). Correspondence and requests for materials should be addressed to Susan Solomon or
53. Rienecker, M. M. et al. Technical Report Series on Global Modeling and Data Assimilation: Kane Stone.
The GEOS-5 Data Assimilation System-Documentation of Versions 5.0.1, 5.1.0, and 5.2.0 Peer review information Nature thanks Clare Paton-Walsh and the other, anonymous,
Vol. 27 (National Aeronautics and Space Administration, Goddard Space Flight Center, reviewer(s) for their contribution to the peer review of this work.
2008). Reprints and permissions information is available at http://www.nature.com/reprints.
Aerosol extinction at 18.5 km
a OMPS-LP observations 745 nm ×10 -3
45
2
30
15
1.8
0
Latitude (ºN)
-15
1.6
-30
-45
1.4
-60
-75
1.2
Extinction (km - 1 )
-90
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
1
b Model 675 nm
45
30 0.8
15
0 0.6
Latitude (ºN)
-15
-30 0.4
-45
-60 0.2
-75
-90 0
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
Month
Extended Data Fig. 1 | Modelled and observed aerosol extinction at 18.5 km. The time evolution of aerosol extinction (km−1) is shown at 18.5 km for Ozone
Mapping and Profiler Suite (OMPS) observations (for 745 nm, a) and in the model (for 675 nm, b) in 2020.
Article
30–50ºS, 68 hPa
O3 HCl
2 1.4
a b
1.8 No organics
1.2
Solubility
1.6 Dilution
N 2 O5 only 1
1.4
0.8
ppm
ppb
1.2
0.6
1
0.1
0.4
ppb
ppb
0.3
0.05
0.2
0
0.1
0 -0.05
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
Month Month
Extended Data Fig. 2 | Observed and modelled 2020 absolute abundances show model-calculated abundances for the no organics control run (blue line)
for chemical species from 30–50° S at 68 hPa. Grey shaded regions show and for three model test cases: including only N2O5 hydrolysis on the aerosols
the ranges of 24-h averaged satellite data from the climatologies of satellite (dashed brown line), considering the added organic material as a dilution
observations (in mixing ratio units) before 2020 (daily O3, HCl and ClO from factor (green dashed line) and considering the adopted solubility of HCl in
MLS and monthly ClONO2 from ACE) and the grey line shows their averages, organic acid particles (red line). Corresponding anomalies are shown in Fig. 2.
whereas black lines show the observed values for 2020. Other coloured lines
HOCl, 30–50ºS, 68 hPa
0.08 0.08
a b No organics
0.07 Solubility
0.06 Dilution
0.06
N 2 O5 only
0.05 ACE 2020 observations
ppb anomaly
ppb
0.03
0.02
0.02
0.01 0
0
-0.01 -0.02
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
Month Month
Extended Data Fig. 3 | Observed and modelled monthly averaged anomalies control run (blue line) and for three model test cases: including only N2O5
(a) and mixing ratios (b) for HOCl (from ACE) for 30–50° S at 68 hPa. hydrolysis on the aerosols (dashed brown line), considering the added organic
Grey shaded regions show the ranges of 24-h averaged satellite data from the material as a dilution factor (green dashed line) and considering the adopted
climatology before 2020, whereas black lines show the observed values for solubility of HCl in organic acid particles (red line).
2020. Other coloured lines show calculated values for 2020 for the no organics
Article
HNO3, 30–50ºS, 68 hPa
1.5 5.5
a b No organics
5 Solubility
1 Dilution
4.5 N 2 O 5 only
ppb anomaly
0.5 4
ppb
3.5
0
3
2.5
-0.5
MLS 2020 observations
2
MLS 2005-2019 observations
-1 1.5
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
Month Month
Extended Data Fig. 4 | Observed and modelled anomalies (a) and mixing (blue line) and for three model test cases: including only N2O5 hydrolysis on the
ratios (b) for HNO3 (from MLS) for 30–50° S at 68 hPa. Grey shaded regions aerosols (brown dashed line), considering the added organic material as a
show the ranges of 24-h daily averaged satellite data from the climatology dilution factor (dashed green line) and considering the adopted solubility of
before 2020, whereas black lines show the observed values for 2020. Other HCl in organic acid particles (red line).
coloured lines show calculated values for 2020 for the no organics control run
Comparison of MLS and ACE O3 observed differences from climatology
1
ACE
MLS
2
10
20
Pressure (hPa)
50
100
200
500
1000
-15 -10 -5 0 5 10 15
2020 percent difference
Extended Data Fig. 5 | Percent ozone anomalies for 30–50° S on coincident there are differences in spatial and temporal sampling between the two
days of measurement for ACE and MLS during June–July 2020. Data for each instruments. Black line shows MLS data while grey line shows ACE data
satellite have been normalized by their respective climatologies. Note that interpolated onto the MLS pressure grid.
Article
Jun–Jul, 30–50ºS
O3 HCl
1 1
No organics a b
2 2
Solubility
5 Dilution 5
Pressure (hPa)
10 N 2 O5 only 10
20 20
50 50
100 100
200 200
MLS/ACE 2020 observations
500 MLS/ACE 2005-2019 observations 500
1000 1000
0 1 2 3 4 5 6 -0.5 0 0.5 1 1.5 2 2.5
×10 12 ×10 9
ClONO2 ClO
1 1
c d
2 2
5 5
Pressure (hPa)
10 10
20 20
50 50
100 100
200 200
500 500
1000 1000
0 2 4 6 8 10 12 14 16 -5 0 5 10
-3 -3
Number density (cm ) ×10 8 Number density (cm ) ×10 7
Extended Data Fig. 6 | Observed and modelled vertical profile absolute show calculated values for 2020 for the no organics control run (blue line)
abundances for chemical species from 30–50° S in June–July of 2020. and for three model test cases: including only N2O5 hydrolysis on the aerosols
Grey shaded regions show the ranges of 24-h averaged satellite anomalies (brown dashed line), considering the added organic material as a dilution
(in number density units) in years before 2020 (daily O3 and ClO from MLS and factor (green dashed line) and considering the adopted solubility of HCl in
HCl and ClONO2 from ACE) and the grey line shows their averages, whereas organic acid particles (red line). Corresponding anomalies are shown in Fig. 3.
black lines show observed abundances for 2020. Other coloured lines
September O3, Solubility - No organics
50
2
40
5 30
10 20
10
20
Pressure (hPa)
Percent
0
50
-10
100
-20
200
-30
500 -40
-50
1000
-90 -75 -60 -45 -30
Latitude (ºN)
Extended Data Fig. 7 | Distribution of calculated ozone loss in September 2020. Percentage change in model-calculated ozone as a function of latitude and
height for the oxidized organics solubility model case is shown, as compared with the no organics control run.
Article
HCl at 68 hPa
1.08
May
0.96
0.84
e f g h
0.72
June
ppb
0.6
0.48
0.36
i j k l
0.24
July
0.12
Extended Data Fig. 8 | Contour maps of monthly mean HCl abundances average from 2005–2019 (second from left), modelled oxidized organics
(ppbv) at 68 hPa for observations and models. The modelled no organics solubility case (second from right) and MLS measurements for 2020 (right).
control case is shown (left column), along with MLS-measured climatological
Article
https://doi.org/10.1038/s41586-022-05654-5 Jiuyuan Wang1 ✉, Lidya G. Tarhan1 ✉, Andrew D. Jacobson2, Amanda M. Oehlert3 &
Noah J. Planavsky1
Received: 17 May 2022
The modern marine carbonate factory (that is, the settings, mineralo- values are shaped foremost by the relatively large isotope fractionation
gies and pathways through which carbonates are precipitated from factor (Δ88/86Srcarb-sw) that accompanies carbonate mineral precipita-
ocean waters7,8) is dominated by the formation of biogenic carbon- tion14,15,17. Carbonate precipitation preferentially incorporates lighter
ates, including planktonic carbonate tests in the open ocean and skel- Sr isotopes, resulting in low δ88/86Sr values in carbonate minerals and
etal (algal and animal) carbonates in shallow-water environments6. high δ88/86Sr values in remaining fluids17. For both biogenic and inorganic
However, organismal regulation (for example, biologically controlled (non-skeletal) carbonate minerals, precipitation kinetics strongly regu-
precipitation) of carbonates has only been present for a small portion late Sr isotope fractionation, for which higher Ωcarb leads to higher pre-
of the history of the Earth9. Precambrian carbonates (around 3.5 to cipitation rates, a greater fractionation (larger-magnitude Δ88/86Srcarb-sw)
0.54 billion years old) are thought to have been buried largely as inor- and lower carbonate δ88/86Sr values17–19. This kinetic control similarly
ganic or microbially mediated seafloor precipitates in shallow marine characterizes different carbonate minerals (that is, aragonite versus cal-
environments10,11. Debates surround whether the rise of various path- cite), with no marked difference in fractionation during precipitation18.
ways of biomineralization caused substantial changes in ocean chemis- Although temperature may affect the physiology of calcifying organ-
try and how the locus of major marine carbonate burial sinks may have isms19,20 (for instance, growth rate), the dependence of the Sr isotope
shifted through the history of the Earth4. Although deep-sea carbonate fractionation on temperature is muted and not currently resolvable18.
burial is thought to have risen to dominance relatively recently, during Therefore carbonate δ88/86Sr values can be used to track rates of car-
the Mesozoic4, this too has been a subject of contention; previous stud- bonate mineral precipitation, providing an independent and novel
ies have postulated the existence of a deep-sea carbonate sink before proxy for the evolution of marine carbonate chemistry. Furthermore,
the emergence of planktonic calcifiers (for example, refs. 3,12). Some when subjected to careful petrographic and geochemical screening,
studies have suggested that carbonate mineral saturation state (Ωcarb), carbonate δ88/86Sr signatures can remain intact even through early and
the dominant factor controlling the sequestration of dissolved inor- mesodiagenesis (see Methods).
ganic carbon into mineral form, has substantially declined through the To investigate changes in the marine carbonate factory over a broad
history of the Earth1,13, whereas others have argued that the oceans— period of Earth’s early history, we analysed the stable and radiogenic
particularly the surface ocean—have not experienced notable secular Sr isotope compositions (δ88/86Sr and 87Sr/86Sr) of 115 samples from
changes in carbonate saturation state5. 29 Precambrian successions ranging from 2.8 billion years to 645 million
Here we present a new approach to tracking the long-term evolution years in age. These analyses used both double-spike thermal ionization
of the marine carbonate factory, based on the record of carbonate mass spectrometry (TIMS) and Zr-doping multicollector inductively
stable strontium isotope ratios (δ88/86Sr, for which δ88/86Sr = ((88Sr/86Sr) coupled plasma mass spectrometry (MC-ICP-MS). All samples were
88 86
sample/( Sr/ Sr)NIST-SRM987 − 1) × 1,000). Recent analytical advances in selected from carbonates reposited in the Yale Peabody Museum’s
measuring δ88/86Sr values present a unique opportunity to constrain Division of Mineralogy & Meteoritics and which have undergone pet-
the evolution of the marine carbonate factory14–16. Carbonate δ88/86Sr rographic and geochemical screening for this and previous studies21.
Department of Earth and Planetary Sciences, Yale University, New Haven, CT, USA. 2Department of Earth and Planetary Sciences, Northwestern University, Evanston, IL, USA. 3Rosenstiel School
1
of Marine, Atmospheric, and Earth Science, University of Miami, Miami, FL, USA. ✉e-mail: jiuyuan.wang@yale.edu; lidya.tarhan@yale.edu
0.3
87Sr/86Sr
0.2 0.709
0.707
0.1 0.705
0.703
0.7100
0.7075
87Sr/86Sr
0.7050
0.7025
Fig. 1 | Strontium isotope records in marine carbonates through the history Other symbols represent published data from other studies (n = 299; Methods).
of the Earth. a, Summary of δ 88/86Sr values measured in skeletal and non- b, Marine carbonate 87Sr/86Sr values. New data from this study are shown as red
skeletal calcites. New data from this study are shown by the circles (n = 83), with circles. Grey circles represent previously published Precambrian carbonate
the colour scale corresponding to radiogenic Sr isotope ratios (87Sr/86Sr). Error 87
Sr/86Sr records (n = 1,494)23. The dashed curve denotes the LOESS fit of the
bars represent the long-term external reproducibility of δ88/86Sr (2σSD = ±0.03‰, lowest 10% of Precambrian 87Sr/86Sr ratios23 and the solid curve denotes the
n = 273). The gold line illustrates the δ88/86Sr value of bulk silicate Earth (0.27‰)27. LOESS fit of the Phanerozoic 87Sr/86Sr record23. OAE, oceanic anoxic event.
Owing to subduction of most pre-Mesozoic deep-sea deposits, this recent datasets, we further compiled published radiogenic and stable
sample set (like much of the preserved Precambrian sedimentary Sr isotope data for both skeletal and non-skeletal Phanerozoic and
record) is dominated by carbonates formed in shallow marine (for Ediacaran calcites (n = 287). All datasets include microbially mediated
example, platform, ramp and reef) settings. During selection of these (for example, stromatolitic) as well as ‘abiotic’ non-skeletal carbonates.
Precambrian samples, we targeted only non-skeletal shallow marine The most notable first-order feature observed in our composite
carbonates and intentionally avoided intervals previously linked to δ88/86Sr record is the significant distinction between Precambrian
either short-term carbon-cycle perturbations (for example, associ- and Phanerozoic calcite δ88/86Sr values (Fig. 1; t-test P = 7.24 × 10−21).
ated with carbon isotope excursions) or petrographic or geochemi- The average δ88/86Sr value for the Precambrian (and pre-Ediacaran)
cal evidence of diagenetic alteration21 (see Methods). Exogenous Sr portion of our record (mean = 0.36‰; 2,800 to 645 million years
inputs from siliciclastic materials and late-stage fluids, such as brine, ago, or Ma) is 0.20‰ higher than Phanerozoic values (mean = 0.16‰;
groundwater and meteoric fluids, tend to increase marine carbonate 540 Ma to present), with a sharp decrease around the Ediacaran (635 to
radiogenic Sr ratios (87Sr/86Sr; for example, ref. 22). To ensure that our 540 Ma). The highest values in the Phanerozoic are associated with two
selected samples provide a reliable seawater Sr archive, the measured massive carbon-cycle perturbations (Fig. 2), namely the end-Permian
87
Sr/86Sr ratio of each sample was also compared with 87Sr/86Sr records mass extinction (mean = 0.35‰; 252 Ma)24 and the Early Cretaceous
widely considered to record contemporaneous seawater23. Among Oceanic Anoxic Event 1a (mean = 0.29‰; 120 Ma)15, and are not rep-
our petrographically and geochemically screened samples, we regard resentative of background Phanerozoic conditions. The aftermath of
calcites with 87Sr/86Sr ratios closely aligned with contemporaneous sea- another notable climatic perturbation, the Marinoan Snowball Earth
water 87Sr/86Sr ratios23 to be the best preserved and most representative. (which terminated at 635 Ma), is also characterized by elevated δ88/86Sr
To better facilitate comparison with recent marine sediments, we also values (mean = 0.35‰)25. These events have each been linked to changes
analysed 24 Palaeogene and modern carbonate samples spanning mar- in carbonate saturation state26, but they are also notable examples of
ginal marine to deep-sea settings. To supplement our Precambrian and non-steady-state perturbations.
Δ88/86Srcarb-sw
−0.4
5
−0.6
0 Δ88/86Srtotal δ88/86Srsw = 0.48‰
0.5
0.4
δ88/86Sr (NIST987, ‰)
0.3
87
Sr/86Sr
0.2
0.7100
0.7075
0.1
0.7050
b 0.75
Calcite (this study)
Dolomite (this study)
Altered calcite (this study)
0.74 Duplicate (this study)
Non-skeletal carbonate
Bulk skeletal calcite
Cap carbonate
0.73 Belemnite
Brachiopod
Sr/86Sr
0.72
87
0.71
Extended Data Fig. 1 | Marine carbonate strontium isotope records the δ88/86Sr value of modern marine carbonate63. Other symbols represent
through the history of the Earth. a, Summary of δ88/86Sr values measured in published data from other studies (n = 299; see Methods): pink squares,
marine calcites and dolomites. New data from this study (n = 139) are non-skeletal carbonate; grey gridded squares, cap carbonate; grey triangles,
colour-contoured to indicate corresponding radiogenic Sr isotope ratios bulk skeletal calcite; grey crosses, belemnite; grey inverted triangles,
(87Sr/86Sr) generated from the same samples: circles, calcite; diamonds, brachiopod. b, Marine carbonate 87Sr/86Sr ratios. New data from this study are
dolomite; ×, calcite with abnormally high 87Sr/86Sr ratios. Error bars represent denoted by coloured symbols: circles, calcite; diamonds, dolomite; ×, calcite
the long-term external reproducibility of δ88/86Sr (2σSD = ±0.03‰, n = 273). with abnormally high 87Sr/86Sr ratios. The grey circles represent Precambrian
Purple crosses denote duplicate measurements of the same sample carbonate 87Sr/86Sr records (n = 1,494)23. The dashed curve denotes the LOESS
(see Methods for description of duplicate strategy). The gold line illustrates the fit of the lowest 10% of Precambrian 87Sr/86Sr ratios23 and the solid curve
δ88/86Sr value of bulk silicate Earth (0.27‰)27. The dashed blue line represents denotes the LOESS fit of the Phanerozoic 87Sr/86Sr record64.
Article
a 15 b
15 Precambrian calcite Precambrian calcite
40
10
Frequency
Frequency
10
Density
Density
5 20
5
0 0 0
0
0 0.2 0.4 0.6 0 0.2 0.4 0.6
δ88/86Sr (NIST987, ‰) δ88/86Sr (NIST987, ‰)
Extended Data Fig. 2 | Histograms of measured and bootstrap-resampled Precambrian calcite and dolomite δ88/86Sr values are from this study.
Precambrian calcite and dolomite δ88/86Sr values. a, Measured Precambrian The purple and green curves represent density distributions of δ88/86Sr in
calcite (red) and dolomite (yellow) δ88/86Sr values. b, Bootstrap-resampled Precambrian calcites (purple, n = 72) and dolomites (green, n = 43).
(n = 10,000) Precambrian calcite (red) and dolomite (yellow) δ88/86Sr values. All
a b
0.5
0.5
0.4
0.4
δ88/86Sr (NIST987, ‰)
δ88/86Sr (NIST987, ‰)
0.3
0.3
0.2
0.2
0.1
0.1
0.0
0.0
0.70 0.71 0.72 0.73 0.74 0.75 0.702 0.704 0.706 0.708
87
Sr/86Sr 87
Sr/86Sr
Extended Data Fig. 3 | The relationship between δ88/86Sr and 87Sr/86Sr in P = 0.001. b, The stable and radiogenic Sr isotopic values of less-altered
analysed dolomites. a, The stable and radiogenic Sr isotope relationship for dolomite samples from this dataset, that is, samples characterized by 87Sr/86Sr
all analysed dolomites (n = 43). A SMA regression model yields R 2 = 0.223 and values less than 0.708, the inferred value of Ediacaran seawater64.
Article
a b
0.6
0.6
R² = 0, p−value = 0.995 R² = 0.001, p−value = 0.803
0.5
0.5
δ88/86Sr (NIST987, ‰)
δ88/86Sr (NIST987, ‰)
0.4
0.4
0.3
0.3
0.2
0.2
70 75 80 85 90 95 100 300 500 700
CaCO3 (%) Sr (ppm)
c d
0.6
0.6
R² = 0.018, p−value = 0.304 R² = 0.014, p−value = 0.376
δ88/86Sr (NIST987, ‰)
δ88/86Sr (NIST987, ‰)
0.5
0.5
0.4
0.4
0.3
0.3
0.2
0.2
0.0 0.5 1.0 1.5 0.0 0.2 0.4 0.6 0.8
Mn/Sr (ppm/ppm) Rb (ppm)
e f
0.6
0.6
δ88/86Sr (NIST987, ‰)
0.4
0.4
0.3
0.3
0.2
0.2
0.0 0.5 1.0 1.5 2.0 2.5 3.0 0.0 0.2 0.4 0.6 0.8 1.0
Ti (ppm) Pb (ppm)
Extended Data Fig. 4 | Cross-plots of δ88/86Sr versus different elemental values are given in ‰, normalized to NIST 987; all elemental concentrations are
contents and ratios. a, δ88/86Sr versus CaCO3 weight percentage (wt%). in ppm except when noted otherwise. An SMA regression model was used to
Carbonate wt% calculated using calcium content assuming stoichiometric evaluate the statistical significance of each correlation. R 2 and P-values are
CaCO3. b, δ88/86Sr versus Sr contents. c, δ88/86Sr versus Mn/Sr. d, δ88/86Sr versus listed at the top of each panel. No statistical correlations are observed at the
Rb contents. e, δ88/86Sr versus Ti contents. f, δ88/86Sr versus Pb contents. δ88/86Sr significance level of 0.01.
0.6 Non-microbial non-skeletal carbonate
Microbial carbonate
Skeletal carbonate
0.5
δ88/86Sr (NIST987, ‰)
0.4
0.3
0.2
0.1
Extended Data Fig. 5 | Box plot of δ88/86Sr values for skeletal (green),
microbial (red) and non-skeletal, non-microbial carbonate (blue) for
modern, Permian–Triassic and Precambrian deposits. In the box plot, the
centre line represents the median of the data (50th percentile), box limits
represent the upper and lower quartiles (75th and 25th percentiles), whiskers
represent 1.5 times the interquartile range, blank points represent outliers and
coloured points represent all data. These data indicate that the notably higher
δ 88/86Sr values characterizing Precambrian calcites cannot be attributed to
differences between microbial and non-microbial pathways of carbonate
precipitation and that, similarly, the shift between elevated Precambrian and
less-elevated Phanerozoic δ 88/86Sr values cannot be readily attributed to
differences between skeletal and non-skeletal pathways of carbonate
precipitation. The modern δ88/86Sr records are from Stevenson et al. 20 (skeletal
n = 10) and this study (microbial n = 5; non-skeletal, non-microbial n = 8); the
Permian–Triassic δ88/86Sr records (skeletal n = 6; microbial n = 8; non-skeletal,
non-microbial n = 20) are from Wang et al. 24; the Precambrian calcite (microbial
calcite n = 12; non-skeletal, non-microbial calcite n = 47) and dolomite (microbial
dolomite n = 6; non-skeletal, non-microbial dolomite n = 37) δ88/86Sr records are
from this study.
Article
Accepted: 15 December 2022 Tropical forests play a critical role in the hydrological cycle and can influence local
Published online: 1 March 2023 and regional precipitation1. Previous work has assessed the impacts of tropical
deforestation on precipitation, but these efforts have been largely limited to case
Open access
studies2. A wider analysis of interactions between deforestation and precipitation—
Check for updates and especially how any such interactions might vary across spatial scales—is lacking.
Here we show reduced precipitation over deforested regions across the tropics.
Our results arise from a pan-tropical assessment of the impacts of 2003–2017 forest
loss on precipitation using satellite, station-based and reanalysis datasets. The effect
of deforestation on precipitation increased at larger scales, with satellite datasets
showing that forest loss caused robust reductions in precipitation at scales greater
than 50 km. The greatest declines in precipitation occurred at 200 km, the largest
scale we explored, for which 1 percentage point of forest loss reduced precipitation
by 0.25 ± 0.1 mm per month. Reanalysis and station-based products disagree on the
direction of precipitation responses to forest loss, which we attribute to sparse in
situ tropical measurements. We estimate that future deforestation in the Congo will
reduce local precipitation by 8–10% in 2100. Our findings provide a compelling
argument for tropical forest conservation to support regional climate resilience.
Tropical forests play an important role in moderating local, regional forest loss, with a focus on evergreen broadleaf forests of the Amazon,
and global climate through their impact on energy, water and carbon Congo and Southeast Asia (SEA; Fig. 1). To provide a robust assessment
cycles3. Crucially, tropical forests control local-to-regional rainfall pat- of the impacts of deforestation on precipitation, we analysed 18 differ-
terns1,2. Evapotranspiration from tropical forests is a strong driver of ent precipitation datasets, including satellite (n = 10), station-based
regional precipitation4,5 contributing up to 41% of basin mean rainfall (n = 4) and reanalysis (n = 4) products (Extended Data Table 1). We
over the Amazon and up to 50% over the Congo6. Evergreen tropical compared the precipitation change over pixels experiencing forest
forests are dependent on high annual rainfall for their survival and loss with neighbouring pixels that had experienced less forest loss
productivity7, and forest–rainfall feedbacks have been highlighted as (Methods). This comparison against neighbouring pixels that will have
an important determinant of tropical forest stability4,5,8, amid concerns experienced similar climate change focuses our analysis on the changes
that the exacerbating impacts of droughts and deforestation could due to forest loss. To explore the impact of forest loss across scales,
threaten their viability9. we analysed the impacts of forest loss on coincident precipitation at
Rapid loss of forests is occurring across the tropics10. Tropical defor- a series of spatial resolutions ranging from roughly 5 km to 200 km
estation warms the climate at local-to-global scales by changing the (0.05°, 0.1°, 0.25°, 0.5°, 1.0° and 2.0°).
surface energy balance and through emissions of carbon dioxide3. The
impact of tropical deforestation on precipitation is less certain with a
range of processes operating at different scales. Small-scale deforesta- Precipitation response to forest loss
tion over the southern Amazon has been shown to increase precipitation Observed precipitation responses to tropical forest loss across
frequency11,12 owing to thermally13 and dynamically12 induced circula- multiple spatial scales and precipitation products are presented in
tions. At larger scales, deforestation reduces precipitation recycling Fig. 2. Satellite-based precipitation datasets suggest that tropical for-
leading to a reduction in precipitation1,14. Over Indonesia, deforestation est loss causes statistically significant (P < 0.05) declines in median
has been linked to declining precipitation15, and exacerbation of El Niño annual mean precipitation at all scales analysed. At larger scales (>0.5°),
impacts16. Global and regional climate models predict annual precipi- reductions exceed 0.03 mm per month for each percentage point loss
tation declines of 8.1 ± 1.4% for large-scale Amazonian deforestation of forest cover (Fig. 2d–f). The largest changes are observed at the 2.0°
by 2050 (ref. 17), but an observational study of the impacts of tropical scale (approximately 220 km at the Equator; Fig. 2f), for which each
deforestation on precipitation across spatial scales is lacking. percentage point reduction in forest cover causes 0.25 ± 0.1 mm per
Here we present a pan-tropical assessment of the impact of forest month reduction in annual precipitation.
loss on precipitation based on measurements. We use a satellite dataset Analysis of precipitation change as a function of forest loss confirms
of forest cover change over the period 2003–2017 to identify areas of larger reductions in precipitation for larger reductions in forest cover
School of Earth and Environment, University of Leeds, Leeds, UK. ✉e-mail: ee13c2s@leeds.ac.uk
1
c d
e f
Fig. 1 | Tropical evergreen broadleaf forest cover loss from 2003 to 2017. study are outlined in purple. Maps of the different regions generated using
a–f, Forest cover change at 0.05° (a), 0.1° (b), 0.25° (c), 0.5° (d), 1.0° (e) and 2.0° Cartopy and Natural Earth51. Forest loss data from ref. 10.
(f) resolution. The Amazon Basin, Congo Basin and SEA regions used in this
(Extended Data Fig. 1), although with considerable variability, as seen tropics (Extended Data Fig. 2). At the 2° scale, significant (P < 0.05)
in the modelled response18. Observed reductions in precipitation are reductions in annual mean precipitation with forest loss were observed
consistent across satellite datasets, with all ten satellite precipitation across all tropical regions (Fig. 2). Reductions in precipitation at 2°
products agreeing on the sign of the rainfall response at 2° over the based on satellite datasets ranged from 0.48 ± 0.36 mm per month in
a b c d e f
0.5
* ** * * ** * ** * NS ** * * * NS NS
Tropics
0
−0.5
g h i j k l
0.5
ΔP (mm per month per percentage point)
* * * * * * ** * * ** * NS * NS NS
Amazon
−0.5
m n o p q r
0.5 *
* ** * * * NS ** NS NS * * * * *
Congo
−0.5
s t u v w x
0.5
* ** * * * NS ** * * ** * * * NS NS
SEA
−0.5
Fig. 2 | Reductions in precipitation over regions of tropical forest loss. 0.5° (d,j,p,v), 1.0° (e,k,q,w) and 2.0° (f,l,r,x). Statistically significant (*P < 0.05;
a–r, Bars indicate the median absolute change in annual precipitation **P < 0.01) and nonsignificant (NS) differences in changes in mean precipitation
(millimetres per month) per percentage point of forest loss over 2003 to 2017 (calculated as a multi-annual mean over 2003–2007 compared with 2013–2017)
in each region (tropics (a–f), Amazon (g–l), Congo (m–r), SEA (s–x)) for each over deforested regions compared with control regions are indicated. Error
precipitation dataset category (satellite, station and reanalysis). Results are bars show ±1 standard error from the mean. Datasets used in this analysis are
shown for forest loss scales of 0.05° (a,g,m,s), 0.1° (b,h,n,t), 0.25° (c,i,o,u), detailed in Extended Data Table 1. ΔP, precipitation change.
NS
0.2 0.2
NS
NS
NS
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
**
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
0 0
−0.2 −0.2
−0.4 −0.4
−0.6 −0.6
−0.8 −0.8
c Congo d SEA
**
ΔP (mm per month per percentage point)
0.5 0.2
*
**
*S
NS
NS
NS
NS
**
**
**
**
N
**
**
**
**
**
**
**
**
**
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
0 0
−0.5
−0.2
−1.5
−0.4
−2.0
−0.6
−2.5
−0.8
−3.0
0.05 0.10 0.25 0.50 1.00 2.00 0.05 0.10 0.25 0.50 1.00 2.00
Resolution (º) Resolution (º)
Fig. 3 | Changes in seasonal precipitation due to forest loss. a–d, Bars nonsignificant (NS) differences in changes in mean precipitation over
indicate the median change in precipitation (millimetres per month) per deforested regions compared with controls are indicated. Results are shown
percentage point forest cover loss for satellite datasets during 2003–2017 for for the wettest 3 months (wet), the driest 3 months (dry) and the transition
tropics (a), Amazon (b), Congo (c) and SEA (d). Error bars indicate ±1 standard months (remaining 6 months). Datasets used in this analysis detailed in
error from the mean. Statistically significant (*P < 0.05; **P < 0.01) and Extended Data Table 1.
SEA to 0.23 ± 0.12 mm per month in the Amazon, and 0.21 ± 0.19 mm per be less reliable in regions where in situ data are limited21. Our results
month in the Congo for each percentage point loss in forest cover, with indicate that precipitation data based on satellite remote-sensing meas-
at least 8 out of 10 satellite datasets agreeing on the sign of the response urements may have an advantage over tropical forest regions where
within each region (Extended Data Fig. 2). In SEA, it has been suggested in situ measurements are sparse or unavailable. For these reasons,
that proximity to the ocean and the replacement of tropical forest with we focus our analysis on satellite-based datasets and identify where
plantations as opposed to pasture or cropland may cause reduced agreement between datasets exists.
sensitivity of precipitation to deforestation1. Our analysis suggests that Our results are robust (Extended Data Fig. 3) to a range of methodo-
forest loss in SEA causes reductions in precipitation consistent with logical assumptions including the length of analysis period, the choice of
or greater than reductions in precipitation in the Amazon and Congo. start and end period and the spatial extent of control pixels (Methods).
Station-based datasets and reanalysis products exhibit contrasting Our analysis period includes the 2015–2016 El Niño that resulted in
annual mean precipitation responses to deforestation at 2.0° (Fig. 2). negative precipitation anomalies over many tropical land regions (Sup-
Across the tropics, station-based and reanalysis datasets showed no plementary Fig. 1). We found that the precipitation response to forest
statistically significant changes in annual mean precipitation due to loss was robustly negative during both El Niño and non-El Niño years
forest loss (Fig. 2f), and there was little agreement with satellite datasets (Extended Data Fig. 3). Over the Amazon and SEA, we see a stronger
at the regional scale (Fig. 2l,r,x), with some non-satellite precipitation reduction in precipitation over regions of forest loss during El Niño
products showing small increases in annual mean precipitation due years. The relative impact of El Niño on precipitation is smaller in the
to forest loss. Sparse in situ measurements across the tropics, par- Congo22, and correspondingly we do not see a stronger reduction here.
ticularly over regions of forest loss, mean that station-based datasets A stronger precipitation response to forest loss in regions and peri-
provide a weak constraint on precipitation changes. A comparison of ods impacted by El Niño is probably due to higher transpiration rates
station-based precipitation datasets revealed higher levels of uncer- observed in tropical forests during El Niño years23 and because rainfall
tainty in the tropics, including the Amazon19. In regions of sparse data is more sensitive to reductions in moisture recycling during drought
such as tropical forests20, interpolation methods may mask precipi- years5,24. Climate change is expected to lead to increased droughts
tation changes driven by forest loss. Reanalysis products, which are over many tropical regions25, which may be further exacerbated by
numerical models constrained by empirical data, are also expected to ongoing deforestation.
−10
20 Tropics
Amazon
−15 Congo
SEA
0
2020 2030 2040 2050 2060 2070 2080 2090 2100 2020 2030 2040 2050 2060 2070 2080 2090 2100
Year Year
c 100
60
40
20
0
d 0
−20
−30
−40
Fig. 4 | Impact of projected future forest loss on annual mean precipitation. (P; ±1 standard error from the mean). c, Spatial pattern of forest cover loss.
a, Mean forest cover loss over 2015–2100 under Shared Socioeconomic d, Predicted P change (∆P) in 2100 due to forest cover loss. Results are shown
Pathway 3–Representative Concentration Pathway 4.5 for the tropics, Amazon, for 2.0° resolution. Maps of the different regions generated using Cartopy and
Congo and SEA. b, Impact of projected forest cover loss on precipitation Natural Earth51.
Extended Data Fig. 1 | Annual precipitation change as a function of forest forest cover change (%) with an equal number of pixels in each bin. Points show
loss. Results are shown at 2° spatial resolution for all satellite precipitation the median and error bars show ± 1 standard error from the mean. Details of
(P) datasets calculated as the change in P over time for deforested data pixels each data product are provided in Extended Data Table 1.
minus change over time for control data pixels. Data is binned according to
Extended Data Fig. 2 | Annual precipitation change due to forest loss for reanalysis (turquoise). The datasets are numbered; 1) CHIRPS, 2) CMORPH, 3)
individual datasets. Results are shown for 2003 – 2017 for 5 year averages CPC, 4) CRU, 5) ERA5, 6) GPCC, 7) GPCP, 8) GPM, 9) JRA, 10) MERRA-2, 11) NOAA
and 3x3 moving window. Bars show the median absolute change in annual 12) PERSIANN-CCS, 13) PERSIANN-CCSCDR, 14) PERSIANN-CDR, 15) PERSIANN-
P (mm month−1) per percentage point tree cover loss in each region (Tropics (a-f), NOW, 16) PERSIANN, 17) TRMM, 18) UDEL. Results are shown for forest loss
Amazon (g-l), Congo (m-r), SEA (s-x)). Each P dataset is shown separately and scales of 0.05° (a,g,m,s), 0.1° (b,h,n,t), 0.25° (c,i,o,u), 0.5° (d,j,p,v), 1.0° (e,k,q,w),
ordered and coloured by category: satellite (orange), station (yellow) and 2.0° (f,l,r,x). Details of each data product are provided in Extended Data Table 1.
Article
Extended Data Fig. 3 | Changes in precipitation due to forest loss for 2003-2017, 3-year averages and 3x3 nearest neighbour (Column 1, a,g,m,s);
different time periods and nearest neighbour comparisons. Changes in 2003-2017, 3-year, 5x5 (Column 2; b,g,n,t); 2003-2017, 5-year, 3x3 (Column 3;
annual mean precipitation at 2.0° resolution are shown for satellite (orange), c,i,o,u); 2003-2017, 5-year, 5x5 (Column 4; d,j,p,v); 2003-2020, 3-year, 3x3
station (yellow) and reanalysis (turquoise) datasets for the tropics (a-f), (Column 5; e,k,q,w); 2003-2020, 5-year, 3x3 (Column 6; f,l,r,x). Error bars
Amazon (g-l), Congo (m-r) and Southeast Asia (SEA, s-x). Columns show the show ± 1 standard error from the mean. Details of each data product are
sensitivity of our results to changes in the analysis period, number of years provided in Extended Data Table 1. Full results for all tested resolutions are
used to compute multi-annual means at start and end of the analysis period, available in an online repository [10.5281/zenodo.7373832].
and size of the moving window used for nearest neighbour comparisons:
Extended Data Fig. 4 | Change in precipitation over deforested, control and between deforested and control pixels (e, f) for 0.05° (a, c, e) and 2.0° (b, d, f)
difference between deforested and control pixels. Change in precipitation resolution. Details of each data product are provided in Extended Data Table 1.
over 2003 to 2017 is shown for deforested (a, b), control (c, d) and difference
Article
Extended Data Fig. 5 | Mean precipitation from satellite, station and values across tropical evergreen broadleaf forests are shown in units of mm/
reanalysis datasets. For each class of dataset, satellite (a, d, g), station (b, e, h) month at the top of each panel. Maps of the different regions generated using
and reanalysis (c, f, i), the median value for the 5-year multi-annual mean at the Cartopy and Natural Earth51. Details of each data product are provided in
start (2003-2007; a, b, c) and end (2013-2017; d, e, f) of the analysis period as Extended Data Table 1.
well as the change over the analysis period (end – start; g, h, i) is shown. Mean
Extended Data Table 1 | Precipitation datasets used in this study refs 58–73
Article
https://doi.org/10.1038/s41586-022-05662-5 Callum Munday1 ✉, Nicholas Savage2, Richard G. Jones2 & Richard Washington1
Accepted: 9 December 2022 East African aridification during the past 8 million years is frequently invoked as a
Published online: 1 March 2023 driver of large-scale shifts in vegetation1 and the evolution of new animal lineages,
including hominins2–4. However, evidence for increasing aridity is debated5 and,
Check for updates
crucially, the mechanisms leading to dry conditions are unclear6. Here, numerical
model experiments show that valleys punctuating the 6,000-km-long East African
Rift System (EARS) are central to the development of dry conditions in East Africa.
These valleys, including the Turkana Basin in Kenya, cause East Africa to dry by
channelling water vapour towards Central Africa, a process that simultaneously
enhances rainfall in the Congo Basin rainforest. Without the valleys, the uplift of the
rift system leads to a wetter climate in East Africa and a drier climate in the Congo
Basin. Results from climate model experiments demonstrate that the detailed
tectonic development of Africa has shaped the rainfall distribution, with profound
implications for the evolution of African plant and animal lineages.
East Africa is the driest equatorial landmass on the planet—an unex- in the later stages of EARS development (after 10 million years ago
plained quirk in the classic Hadley model of tropical circulation7. Owing (Ma) (ref. 18)). We hypothesize that they are central to the present-day
to the relatively low annual precipitation (mainly <800 mm year−1 in rainfall distribution.
recent decades)8 and propensity to drought9, much of East Africa is To test this hypothesis, we alter the valleys in a series of 20-year cli-
unable to support dense forest. This is in contrast to the widespread mate model experiments using a 25-km-resolution Pan-African regional
rainforests of central and western equatorial Africa, where annual rain- climate model from the UK Met Office (see details of the model setup,
fall is higher, by 150–300% (ref. 10). Over the past 8 million years, the evaluation and experiments in Methods). The model performs well
reduction in East African dense forest, and associated expansion of in its simulation of present-day rainfall and circulation (Extended
mixed and grassland habitats1, has been linked to the evolution of new Data Figs. 1 and 2). Our initial focus is on the Turkana Channel, which
animal lineages1, including hominins2–4. There is no convincing climatic is the largest of the fault-bounded valleys. The Turkana Jet—which
mechanism explaining this transition and which accounts for continued forms in this valley—is responsible for a large portion of the easterly
presence of dense forest in Central Africa. One hypothesis is that drier water vapour transport across the rift system17. Phases when the
conditions in East Africa evolved with the uplift of the 6,000-km-long Turkana Jet is strong are associated with drought across the bimodal
EARS11,12; however, mechanisms that relate uplift to rainfall deficits (two rainy seasons) region of East Africa15–17 and increased rainfall in
are problematic. In this paper, we demonstrate that the formation of downstream regions, including the Ethiopian Highlands and parts of
valleys, rather than the uplift alone, is crucial to the low rainfall totals Central Africa16,19. We progressively alter the Turkana Channel from
in East Africa. The valleys cause East Africa to dry by channelling water a blocked Turkana Channel (A), an incipient channel (B), the control
vapour towards Central Africa, a process that simultaneously favours (C; observed topography) and a deeper-than-observed channel (D)
rainfall in the Congo Basin rainforest. Without the valleys, the uplift (Fig. 1).
of the EARS would lead to a wetter climate in East Africa and a drier
climate in the Congo Basin.
The EARS separates relatively dry regions of Eastern Africa from wet- The role of the Turkana Channel
ter Central Africa. It is a leaky barrier to moisture-laden tropical easterly Progressive drying occurs in East Africa with the deepening of the
winds, which have been present from at least the Middle Miocene13. Turkana Channel, corresponding to experiments A–D (Fig. 2). Annual
A series of fault-bounded valleys, oriented east to west, punctuate mean rainfall is highest in East Africa in the Turkana blocked experi-
uplifted topographic domes along the EARS, including the Ethiopian ment (Fig. 2a). In this experiment, the model simulates 1,000 mm year−1
and Kenyan highlands. The valleys are key conduits for water vapour (+500%) more rainfall in parts of dry northern Kenya and South
transport from the Indian Ocean to Central Africa, with transport Sudan compared with the control. Rainfall is lower across rainfor-
occurring by means of five main easterly low-level jets (LLJs), which est regions of central and western Central Africa, with a reduction of
accelerate as they are constrained by the valley sides14,15 (Extended Data 300 mm year−1 near the Atlantic coast. As the channel deepens from
Fig. 1). Strong LLJs lead to enhanced water vapour export from East experiments B to D, including the control, the upstream region of
Africa, resulting in low rainfall15–17. The valleys—and associated water East Africa becomes progressively drier, whereas the Congo Basin
vapour pathways—probably reached their present-day morphology becomes wetter. In the deeper-than-observed experiment (Fig. 2c),
Climate Research Lab, School of Geography and the Environment, University of Oxford, Oxford, UK. 2Met Office Hadley Centre, Exeter, UK. ✉e-mail: callum.munday@ouce.ox.ac.uk
1
8° N 8° N 9° N
6° N
4° N 4° N
T T 3° N
0° 0° 0°
3° S
4° S 4° S
6° S
35° E 40° E 45° E 50° E 35° E 40° E 45° E 50° E 10° E 20° E 30° E 40° E 50° E
c d b
12° N 12° N 12° N
8° N 8° N 9° N
6° N
4° N 4° N
T T 3° N
0° 0° 0°
3° S
4° S 4° S
6° S
35° E 40° E 45° E 50° E 35° E 40° E 45° E 50° E 10° E 20° E 30° E 40° E 50° E
c
12° N
0
0
30
60
90
20
50
80
10
40
70
1,
1,
1,
2,
2,
2,
9° N
Height (m)
6° N
Fig. 1 | Overview of model experiments. Surface altitude (m) for the four Turkana
experiments: blocked (a), incipient (b), control (c) and deeper-than-observed 3° N
channel (d). The ‘T’ marks the location of the Turkana Channel. 0°
3° S
6° S
rainfall is reduced in parts of East Africa and South Sudan by 200– 10° E 20° E 30° E 40° E 50° E
400 mm year−1 (−30% to 50%). This demonstrates the contribution
of the Turkana Channel to the east–west rainfall gradient: the pres-
ence of the channel reduces rainfall in East Africa and contributes to –450 –300 –150 0 150 300 450
mm year –1
the high rainfall totals in Central Africa. The decrease in rainfall over
East Africa induced by the Turkana Channel is consistent across all Fig. 2 | The Turkana Channel influences the east–west rainfall gradient in
months. tropical Africa. Annual rainfall anomalies in the experiments compared with
Changes to the integrated water vapour transport (IWVT) help to control (mm year−1) for Turkana Channel blocked (a), incipient (b) and
diagnose the rainfall alterations (Fig. 3). In the blocked experiment deeper-than-observed channel (c). Grey contours indicate regions with
(Fig. 3a), there is little easterly water vapour flux from East Africa to statistically significant differences between the control and the experiments
Central Africa north of the equator, as the Turkana LLJ is no longer based on the two-tailed Mann–Whitney U test, after controlling for the FDR,
following Wilks31 (see Methods). The PFDR (n = 20) values are 0.024, 0.002 and
present. IWVT anomalies in the blocked experiment are more than
0.0008 for a,b and c, respectively.
100 kg m−1 s−1. The weakened easterlies are still present in the incipient
valley experiment (Fig. 3b). In the deeper-valley experiment (Fig. 3c),
there is enhanced easterly water vapour export, associated with the
reduced rainfall in East Africa compared with the control. Downstream the south (Fig. 4). One can think of this experiment as imposing
of the valley in South Sudan, rainfall decreases in the deeper-valley Andean-like topography across the eastern part of Africa. We find
experiment, as there is increased moisture divergence with a stronger a Pan-African effect on the annual mean rainfall (Fig. 4). Rainfall
jet. In the blocked experiment, rainfall increases in the South Sudan increases across the entire eastern coastal sector of Africa and in the
region. equatorial Indian Ocean, whereas there is large-scale drying in the
continental interior and particularly along the western coast and in
South Africa.
Pan-African effect of valleys In the ‘no valleys’ experiment, the large-scale wetting is associ-
The Turkana Jet is one of five main easterly LLJs that form across the ated with a reduction in water vapour flux through the main valleys
EARS, the others forming in the Limpopo and Zambezi river valleys and (Fig. 4c,d). Meanwhile, in the control experiment, the valleys in the
across topographic lows in the Tanzanian and Malawi highlands17,20,21. rift system export water vapour from East Africa. The total IWVT
These LLJs, and associated valleys, are important for water vapour across the rift system (see Methods) in the ‘no valleys’ experiment
export, and we posit that they have a similar effect on the east–west (2.14 × 108 kg s−1) is 25% less than in the control (2.82 × 108 kg s−1). This
rainfall gradient. leaves more water vapour available for rainfall across Eastern Africa in
To test this hypothesis, we carry out a further experiment (E, no valleys), the ‘no valleys’ experiment (3.66 × 107 kg s−1) compared with the con-
which blocks all the main topographic lows across the EARS, from trol simulation (2.73 × 107 kg s−1) (see Methods for moisture budget
the Turkana Channel in the north to the Limpopo River valley in calculation).
mm year –1
1,800 150
9° N 10° S 10° S 0
1,400
−150
20° S 1,000 20° S −300
6° N 600 −450
3° N 200
°E
°E
°E
°E
°E
°E
°E
°E
°E
°E
10
20
30
40
50
10
20
30
40
50
0°
c d
3° S 4,000 4,000
0.09 0.09
6° S 3,500 3,500
0.08 0.08
3,000 3,000
10° E 20° E 30° E 40° E 50° E 0.07 0.07
Height (m)
Height (m)
b 100
2,000 0.05 2,000 0.05
0.04 0.04
12° N 1,500 1,500
0.03 0.03
9° N 1,000 0.02 1,000 0.02
500 0.01 500 0.01
6° N
0 0
0 0
3° N –20 –10 0 10 –20 –10 0 10
0° Latitude Latitude
3° S Fig. 4 | Valleys lead to lower rainfall in East Africa, with increased water
6° S vapour export across the rift system. a, Surface altitude (m) for the control
simulation. b, The rainfall anomaly (no valleys − control; mm year−1). Vertical
10° E 20° E 30° E 40° E 50° E cross-sections of the water vapour flux (moisture flux, mf; kg kg−1 m−1 s−1)
100 perpendicular to the black line shown in a (positive easterly, negative westerly)
c
for the control (c) and ‘no valleys’ (d) experiments. The black filled area indicates
12° N the surface height in each experiment. The grey contours in b indicate statistically
9° N significant differences in rainfall, calculated by means of the two-tailed Mann–
Whitney U test, after controlling for the FDR, following Wilks31 (see Methods).
6° N
The PFDR value (n = 20) is 0.022.
3° N
0°
The expansion of grassland and mixed habitats, at the expense of
3° S
dense forest, across East Africa in the past 8 million years is linked with
6° S
broad faunal turnover1 and is a cornerstone for several hypotheses
10° E 20° E 30° E 40° E 50° E relating to hominid evolution2,4,25–28. The lower rainfall in East Africa
owing to the formation of valleys is capable of explaining the large-scale
vegetation shift. Although estimates for the timing of valley formation
–60 –45 –30 –15 0 15 30 45 60 vary between studies and across the EARS, processes occurring in the
kg m−1 s−1 past 10 Ma have shaped the present-day morphology11,18. Other global
Fig. 3 | Water vapour export from East Africa increases as the Turkana Channel climate events could have contributed to the expansion of grasslands,
deepens. IWVT anomalies (kg m−1 s−1; shading) and vectors compared with control including the late Miocene cooling (5–7 Ma)29 and onset of Northern
(annual mean) for the three Turkana experiments compared with control: Turkana Hemisphere glaciation (about 2.75 Ma)30, but the development of val-
Channel blocked (a), incipient (b) and deeper-than-observed channel (c). Grey leys is an obvious proximate driver for rainfall change. Today, the pres-
contours indicate regions with statistically significant differences (evaluated on ence of valleys is a key explanation for why East Africa is curiously dry
the IWVT field) calculated by means of the two-tailed Mann–Whitney U test, after for its latitude and prone to drought.
controlling for the FDR, following Wilks31 (see Methods). The PFDR values (n = 20)
are 0.032, 0.001 and 0.001 for a,b and c, respectively.
Online content
Any methods, additional references, Nature Portfolio reporting summa-
ries, source data, extended data, supplementary information, acknowl-
Discussion edgements, peer review information; details of author contributions
The presence of valleys within the EARS leads to a drier East Africa and competing interests; and statements of data and code availability
and wetter Congo Basin. Previous modelling studies have implicated are available at https://doi.org/10.1038/s41586-022-05662-5.
the rift system in East African dryness12,22–24, but the shared assump-
tion in these studies is that the uplift alone—which mainly occurred
1. Bobe, R. The evolution of arid ecosystems in eastern Africa. J. Arid. Environ. 66, 564–584
before 10 Ma—causes the aridity. In the ‘no valleys’ experiment, we (2006).
show mechanistically that uplift alone does the opposite: the removal 2. deMenocal, P. B. African climate change and faunal evolution during the Pliocene–
of valleys reduces the water vapour export from East Africa, whereas Pleistocene. Earth Planet. Sci. Lett. 220, 3–24 (2004).
3. Maslin, M. A., Shultz, S. & Trauth, M. H. A synthesis of the theories and concepts of early
the regions of high topography act as an elevated heat source. This human evolution. Philos. Trans. R. Soc. B Biol. Sci. 370, 20140064 (2015).
favours convection in East Africa, while necessarily reducing convec- 4. Vrba, E. S. in Evolutionary History of the “Robust” Australopithecines (ed. Grine, F. E.)
tion in the Congo rainforest, as diagnosed by the reduction in water 405–426 (Aldine de Gruyter, 1988).
5. Blumenthal, S. A. et al. Aridity and hominin environments. Proc. Natl Acad. Sci. USA 114,
vapour transport across the rift system. Another important factor 7331–7336 (2017).
in East African aridity, the Somali Jet, strengthens in response to an 6. Levin, N. E. Environment and climate of early human evolution. Annu. Rev. Earth Planet.
Sci. 43, 405–429 (2015).
uninterrupted barrier in the blocked valley experiments (Fig. 3). This
7. Trewartha, G. T. The Earth’s Problem Climates (Univ. Wisconsin Press, 1961).
is consistent with other modelling studies, which show a weakening of 8. Yang, W., Seager, R., Cane, M. A. & Lyon, B. The annual cycle of East African precipitation.
the Somali Jet when the rift system is lowered22,24. J. Clim. 28, 2385–2404 (2015).
https://doi.org/10.1038/s41586-023-05760-y Yanhui Dai1,9, Shangbo Yang1,9, Dan Zhao1, Chuanmin Hu2, Wang Xu3, Donald M. Anderson4,
Yun Li5, Xiao-Peng Song6, Daniel G. Boyce7, Luke Gibson1, Chunmiao Zheng1,8 & Lian Feng1 ✉
Received: 17 May 2022
Phytoplankton blooms are accumulations of microscopic algae in the ocean surface continuously since 1997 and have enabled bloom detec-
surface layer of fresh and marine water bodies. Although many blooms tion in many coastal regions17–19. However, the technical difficulties in
can occur naturally, nutrients linked to anthropogenic eutrophication dealing with complex optical features across different types of coastal
are expected to intensify their frequency globally2–4. Many algal blooms waters have so far prohibited their application globally20. To fill this
are beneficial, fixing carbon at the base of the food chain and support- knowledge gap, we developed a method to map global coastal algal
ing fisheries and ecosystems worldwide. However, proliferations of blooms and used this tool to examine satellite images between 2003
algae that cause harm (termed harmful algal blooms (HABs)) have and 2020, addressing three fundamental questions: (1) where and how
become a major environmental problem worldwide5–7. For instance, frequently global coastal oceans have been affected by phytoplankton
the toxins produced by some algal species can accumulate in the food blooms; (2) whether the blooms have expanded or intensified over the
web, causing closures of fisheries as well as illness or mortality of marine past two decades, both globally and regionally; and (3) the identity of
species and humans8–10. In other cases, the decay of a dense algal bloom the potential drivers.
can deplete oxygen in bottom waters, forming anoxic ‘dead zones’ that
can cause fish and invertebrate die-offs and ecosystem restructuring,
with serious consequences for the well-being of coastal communities1,11. Mapping global coastal phytoplankton blooms
Unfortunately, algal bloom frequency and distribution are projected We generated a satellite-based dataset of phytoplankton bloom occur-
to increase with future climate change12,13, with some changes causing rence to characterize the spatial and temporal patterns of algal blooms
adverse effects on aquatic ecosystems, fisheries and coastal resources. in coastal oceans globally. The dataset was derived using global, 1-km
Owing to substantial heterogeneity in space and time, algal blooms resolution daily observations from the Moderate Resolution Imag-
are challenging to characterize on a large scale5,14, and thus present ing Spectroradiometer (MODIS) onboard NASA’s Aqua satellite, and all
knowledge does not allow us to answer one of the most fundamen- 0.76 million images acquired by this satellite mission between 2003 and
tal questions: whether algal blooms have changed in recent decades 2020 were used. We developed an automated method to detect phyto-
on a global basis6,15,16. For example, although HAB events have been plankton blooms using MODIS images (Extended Data Fig. 1) (Methods).
compiled into the UNESCO (United Nations Educational, Scientific, In this study, we define a phytoplankton bloom as the accumulation of
and Cultural Organization) Intergovernmental Oceanographic Com- microscopic algae at the ocean surface that exhibits satellite-detectable
mission Harmful Algae Event Database (HAEDAT) globally since 1985, fluorescence signals21. However, whether a bloom produces toxins or is
bloom trends are difficult to resolve, owing to inconsistent sampling harmful to humans or the marine environment is not distinguishable
efforts and the diversity of the eco-environmental or socio-economic from satellite data. We delineated bloom-affected areas (that is, the areas
effects6. Alternatively, satellite data have been used to monitor the where algal blooms were detected), and enumerated the bloom count
1
School of Environmental Science and Engineering, Southern University of Science and Technology, Shenzhen, China. 2College of Marine Science, University of South Florida, St. Petersburg,
FL, USA. 3Shenzhen Ecological and Environmental Monitoring Center of Guangdong Province, Shenzhen, China. 4Woods Hole Oceanographic Institution, Woods Hole, MA, USA. 5School of
Marine Science and Policy, College of Earth, Ocean, and Environment, University of Delaware, Lewes, DE, USA. 6Department of Geographical Sciences, University of Maryland, College Park,
MD, USA. 7Bedford Institute of Oceanography, Fisheries and Oceans Canada, Dartmouth, Nova Scotia, Canada. 8EIT Institute for Advanced Study, Ningbo, China. 9These authors contributed
equally: Yanhui Dai, Shangbo Yang. ✉e-mail: fengl@sustech.edu.cn
50
Bloom counts
30
10
1
b c Global total affected area:
30.3% 31.47 × 106 km2
10
60
40
5
11.8%
9.0%
9.2%
20
0 0
SA AF EU NA AS AU Global EU NA AS SA AF AU
Fig. 1 | Global patterns of coastal phytoplankton blooms between 2003 and represents the median value, bottom and top bounds of boxes are first and
2020. a, The spatial distribution of annual mean bloom count based on daily third quartiles, and the whiskers show a maximum of 1.5 times the interquartile
satellite detections. b, Continental and global statistics for annual mean range. c, Continental statistics for the long-term annual mean of bloom-
bloom count (South America (SA), n = 3,846,125; Africa (AF), n = 2,516,225; affected areas (n = 18 years). The percentages show the corresponding
Europe (EU), n = 17,703,949; North America (NA), n = 10,034,286; Asia (AS), contributions to the global total. The bars represent s.d. Open circles are
n = 5,371,158; Australia (AU), n = 2,781,998 pixel observations). The centre line the affected areas during different years. Map created using Python 3.8.
at the 1-km pixel level (that is, the number of detected blooms per pixel) nutrient enrichment9,22–26. European LMEs showed mostly large propor-
(Fig. 1). We further estimated the bloom frequency (dimensionless) by tions of bloom-affected areas, and some also showed frequent bloom
integrating the bloom count and affected areas within 1° × 1° grid cells occurrences. By contrast, Asian LMEs exhibited mainly infrequent
(see Methods), and this metric was used to examine temporal dynam- blooms, given their large affected areas. We identified more bloom
ics in bloom intensity. Validation with independent satellite samples events in estuarine regions than along coasts in regions without major
selected via several visual inspection techniques showed an overall accu- river discharge (P < 0.05; Extended Data Fig. 8), highlighting the critical
racy level of more than 95% for our method, and comparisons using dis- role of terrestrial nutrient sources in coastal algal blooms3.
crete events in HAEDAT6 indicated that we successfully identified bloom
counts for 79.3% of the historical HAB events in that database (Extended
Data Figs. 2–6). We examined phytoplankton blooms in the exclusive Long-term trends
economic zones (EEZs) of 153 coastal countries and in 54 large marine The total global bloom-affected area has expanded by 3.97 million km2
ecosystems (LMEs) (Extended Data Fig. 7). Our study area encompasses (13.2%) between 2003 and 2020, equivalent to 0.14 million km2 yr−1
global continental shelves and outer margins of coastal currents, which (P < 0.05; Fig. 2). Furthermore, the number of countries with significant
offer the majority of marine resources available for human use (see Meth- bloom expansion was about 1.6 times those with a decreasing trend.
ods). Out of the 153 coastal countries examined, 126 were observed to The global median bloom frequency showed an increasing rate of 59.2%
have phytoplankton blooms (Fig. 1). The total bloom-affected area was (+2.19% yr−1, P < 0.05) over the observed period. Spatially, areas showing
31.47 million km2, equivalent to approximately 24.2% of the global land significant increasing trends (P < 0.05) in bloom frequency were 77.6%
area and 8.6% of the global ocean area, with a median bloom count of larger than those with the opposite trends (Fig. 2). Globally, our analysis
4.3 per year during the past 2 decades (Fig. 1b). Europe (9.52 million revealed overall consistent fluctuations between the bloom-affected
km2—30.3% of the total affected area) and North America (6.78 million area and bloom frequency between 2003 and 2020 (Fig. 2b). However,
km2—21.5% of the total affected area) contributed the largest bloom there was no significant relationship between bloom extent and fre-
areas. By contrast, the most frequent blooms were found around Africa quency in 23 countries and 10 LMEs over the past two decades, under-
and South America (median bloom counts of more than 6.3 per year). scoring the spatial and temporal variability of algal blooms and the
Australia experienced the lowest frequency (2.4 per year) and affected importance of continuous satellite monitoring.
area (2.84 million km2—9.0% of the total affected area) of blooms. The entire Southern Hemisphere was primarily characterized by
Phytoplankton blooms occurred frequently in the eastern boundary increased bloom frequency, although weakened blooms were also
current systems (that is, California, Benguela, Humboldt and Canary), sometimes found. In the Northern Hemisphere, the low latitude
northeastern USA, Latin America, the Baltic Sea, Northern Black Sea and (<30° N) coasts were mainly featured with strong bloom weakening
the Arabian Sea (Fig. 1a). Five LMEs were found with the most frequent (Fig. 2a), primarily in the California Current System and the Arabian
blooms (annual median bloom count over 15), including Patagonian Sea. Bloom strengthening was found in the northern Gulf of Mexico and
Shelf, Northeast US continental Shelf, the Baltic Sea, Gulf of California the East and South China Seas, albeit at smaller magnitudes. At higher
and Benguela Current (Extended Data Fig. 7). These hotspots are often latitudes, weakening blooms were detected mainly in the northeastern
reported as having a high incidence of algal blooms, some of which are North Atlantic and the Okhotsk Sea in the northwestern North Pacific.
HABs, driven by either coastal upwelling or pronounced anthropogenic Globally, the largest increases in bloom frequency were observed in six
50° N
Positive
Latitude (P < 0.05)
0° (P ≥ 0.05)
Negative
(P < 0.05)
50° S (P ≥ 0.05) Slope (104 yr −1)
100 0 100
Fraction (%) –1.0 –0.5 0 0.5 1.0
2 30
+2.19% yr −1 (P = 0.006)
1 25
2003 2006 2009 2012 2015 2018
Year
Fig. 2 | Trends of global coastal phytoplankton blooms between 2003 and b, Interannual variability and trends in annual median bloom frequency and total
2020. a, Spatial patterns of the trends in bloom frequency at a 1° × 1° grid scale. global bloom-affected area. The linear slopes and P-value (two-sided t-test) are
The latitudinal profiles show the fractions of grids with significant and indicated. The shading associated with the bloom frequency data represents
insignificant trends (positive or negative) along the east–west direction. an uncertainty level of 5% in bloom detection. Map created using Python 3.8.
major coastal current systems, including Oyashio (+6.31% yr−1), Alaska averaged over the growth window of algal blooms within a year (Meth-
(+5.22% yr−1), Canary (+4.28% yr−1), Malvinas (+3.02% yr−1), Gulf Stream ods and Extended Data Fig. 9)) in several high-latitude regions (>40° N),
(+2.42% yr−1) and Benguela (+2.30% yr−1) (Figs. 2a and 3). such as the Alaska Current (r = 0.44), the Oyashio Current (r = 0.48) and
the Baltic Sea (r = 0.41) (Fig. 3). These findings agree with previous stud-
ies, in which the bloom-favourable seasons in these temperate seas
Natural and anthropogenic effects have been extended under warmer temperatures27–29. However, this
Increases in sea surface temperature (SST) can stimulate bloom occur- temperature-based mechanism did not apply to regions with inconsistent
rence. We found significant positive correlations (P < 0.05) between the trends between SST and bloom frequency, particularly for the substantial
annual mean bloom frequency and the coincident SST (SST data were bloom weakening in the tropical and subtropical areas (Figs. 2a and 3b).
a b
8
7
2 6
1
3
5
4 10−6 °C m−1 decade−1 °C decade−1
–2 –1 0 1 2 –1.0 –0.5 0 0.5 1.0
6 8 5 19 14 3 22 14 9 13
26 S = 2.42 8
Bloom frequency (104)
S = 3.02
r = 0.81* r = –0.83* r = 0.84* r = –0.63* r = 0.83*
0 6 2 14 12 0 20 8 7 11
SST (ഒ)
2003 2011 2019 2003 2011 2019 2003 2011 2019 2003 2011 2019
Fig. 3 | Effects of climate change on phytoplankton blooms. a,b, Global and the correlation coefficient (r) between bloom frequency and the SST and
patterns of trends in SST gradient (a) and SST (b) from 2003 to 2020. c, Long- the SST gradient (∇SST) are shown. Asterisks indicate statistically significant
term changes in bloom frequency in the regions labelled in a and b, and their (P < 0.05) correlations. Maps created using ArcMap 10.4 and Python 3.8.
relationship to the SST and SST gradient. Linear slope (S) of bloom frequency
and thus lower nutrient supply25. Conversely, the Canary and Benguela temporally consistent characterization of global coastal algal blooms
currents were characterized by strengthened upwelling and increased between 2003 and 2020. Globally, increasing trends in algal bloom
bloom frequency. The two western boundary current systems at high area and frequency are apparent. Regionally, however, trends were
latitudes (Malvinas and Oyashio)—although characterized by less pro- non-uniform owing to the compounded effects of changes in climate
nounced upwelling34—exhibited a similar mechanism to the subtropical (such as changes in SST and SST gradient and climate extremes),
eastern boundary regions. For the subtropical western boundary Gulf anthropogenic eutrophication and aquaculture development. Our
Stream current, the strengthened current jets (manifested as a larger SST daily mapping of bloom events offers valuable baseline information
gradient) brought more nutrients from the continental shelf35, trigger- to understand the mechanisms underlying the formation, mainte-
ing more algal blooms. Nevertheless, whether these changes in oceanic nance, and dissipation of algal blooms5,40. This could aid in developing
mesoscale activities were responses to wind, stratification, the shear of forecasting models (on either global or regional scales) that can help
ocean currents or other factors33 requires region-based investigations. minimize the consequences of harmful blooms, and can also help in
Global climate events, represented as the multivariate El Niño– policy decisions relating to the control of nutrient discharges and
Southern Oscillation index36 (MEI), also showed connections with coastal other HAB-stimulatory factors. Noting again that many blooms are
bloom frequency. The minimum MEI in 2010 (a strong La Niña year) beneficial, particularly in terms of their positive effects on ecosystems
was followed by a low bloom frequency in the following year, and the as well as on wild and farmed fisheries, the results here can also con-
largest MEI in 2015 (a strong El Niño year) was followed by the strongest tribute toward policies and management actions that sustain those
bloom frequency in 2016 (Fig. 2b and Extended Data Fig. 10a). beneficial blooms.
Changes in anthropogenic nutrient enrichment may have also con-
tributed to the trends in blooms37. For example, the decline in bloom
frequency in the Arabian Sea, without clear links to SST or SST gradient Online content
changes, could result from decreased fertilizer use in the surround- Any methods, additional references, Nature Portfolio reporting summa-
ing countries (such as Iran) (Extended Data Fig. 10). By contrast, the ries, source data, extended data, supplementary information, acknowl-
bloom strengthening in some Asian countries could be attributed to edgements, peer review information; details of author contributions
surges in fertilizer use38. We examined trends in fertilizer usage (either and competing interests; and statements of data and code availability
nitrogen or phosphorus) and bloom frequency and found high positive are available at https://doi.org/10.1038/s41586-023-05760-y.
correlations in China, Iran, Vietnam and the Philippines. Paradoxi-
cally, decreased fertilizer uses and increased bloom frequency were 1. Breitburg, D. et al. Declining oxygen in the global ocean and coastal waters. Science 359,
identified in some countries, suggesting that nutrient control efforts eaam7240 (2018).
2. Anderson, D. M. Turning back the harmful red tide. Nature 388, 513–514 (1997).
might have been counterbalanced by the stimulatory effects of climate 3. Beman, J. M., Arrigo, K. R. & Matson, P. A. Agricultural runoff fuels large phytoplankton
warming or other factors. Furthermore, the intensified aquaculture blooms in vulnerable areas of the ocean. Nature 434, 211–214 (2005).
industry in Finland, China, Algeria, Guinea, Vietnam, Argentina, Russia 4. Heisler, J. et al. Eutrophication and harmful algal blooms: a scientific consensus. Harmful
Algae 8, 3–13 (2008).
and Uruguay may also be linked to their increased bloom incidence, 5. Anderson, D. M., Cembella, A. D. & Hallegraeff, G. M. Progress in understanding harmful
as suggested by the significant positive correlations (r > 0.5, P < 0.05) algal blooms: paradigm shifts and new technologies for research, monitoring, and
between their aquaculture production and bloom frequency. A similar management. Annu. Rev. Mar. Sci. 4, 143–176 (2012).
6. Hallegraeff, G. M. et al. Perceived global increase in algal blooms is attributable to
relationship between aquaculture expansion and positive trends in HAB intensified monitoring and emerging bloom impacts. Commun. Earth Environ. 2, 117 (2021).
incidence was reported from an analysis of HAEDAT data6. However, 7. Smith, V. H. Eutrophication of freshwater and coastal marine ecosystems a global
analogous positive feedbacks for fertilizer or aquaculture were not problem. Environ. Sci. Pollut. Res. 10, 126–139 (2003).
8. Fleming, L. E. et al. Review of Florida red tide and human health effects. Harmful Algae
found in many other countries. Thus, an ecosystem model incorporat- 10, 224–233 (2011).
ing terrestrial and oceanic nutrient transport and nutrient–plankton 9. Richlen, M. L., Morton, S. L., Jamali, E. A., Rajan, A. & Anderson, D. M. The catastrophic
relationships of different species39 is required to quantify the contribu- 2008–2009 red tide in the Arabian Gulf region, with observations on the identification
and phylogeny of the fish-killing dinoflagellate Cochlodinium polykrikoides. Harmful
tions of natural and anthropogenic factors to algal blooms14. Algae 9, 163–172 (2010).
10. Hallegraeff, G. & Bolch, C. Unprecedented toxic algal blooms impact on Tasmanian
seafood industry. Microbiol. Aust. 37, 143–144 (2016).
11. Diaz, R. J. & Rosenberg, R. Spreading dead zones and consequences for marine ecosystems.
Future implications Science 321, 926–929 (2008).
We acknowledge that our criteria for a detectable bloom event is 12. Barton, A. D., Irwin, A. J., Finkel, Z. V. & Stock, C. A. Anthropogenic climate change drives
operationally defined by sensor sensitivities and other factors, and shift and shuffle in North Atlantic phytoplankton communities. Proc. Natl Acad. Sci. USA
113, 2964–2969 (2016).
that the bloom count metric used here may underestimate algal 13. Gobler, C. J. Climate change and harmful algal blooms: insights and perspective. Harmful
bloom incidence, particularly compared to harmful events entered in Algae 91, 101731 (2020).
Extended Data Fig. 1 | Development of the CIE-fluorescence algorithm to selected spectra for phytoplankton blooms, macroalgal blooms (Ulva and
detect phytoplankton blooms using MODIS satellite imagery. (a). A1: The Sargassum), coccolithophore blooms, and sediment-rich turbid waters. The x-y
density plot of manually delineated bloom-containing pixels in the CIE numbers indicate their corresponding positions in the CIE coordinate system.
coordinate system (n = 53,820), and their distribution in the CIE color space The black rectangular boxes in the three lower panels highlight different
(box in A2). A3: Histograms of nFLH and Chla for the delineated pixels, obtained spectral shapes between phytoplankton blooms and other features near the
using NASA standard algorithms 47,57. (b) MODIS true color composites and fluorescence band. Maps created using ArcMap 10.4.
Extended Data Fig. 2 | MODIS-detected bloom count within certain years Database (HAEDAT) within the same year. The lower right panel shows the
for several coastal regions with frequently reported blooms. The MODIS locations of all the HAEDAT records that were used for algorithm validations in
observational year is annotated within each panel, and overlaid points indicate this study (Supplementary Table 1), which also demonstrates the increase in
in situ recorded harmful algal bloom events from the Harmful Algae Event sampling effort in the most recent years. Created using ArcMap 10.4.
Article
Extended Data Fig. 3 | Performance of the CIE-fluorescence algorithm for bloom area (green pixels) detected by the CIE-fluorescence algorithm. Created
phytoplankton bloom detection in 12 selected coastal oceans. From left using ArcMap 10.4.
to right are the RGB-true color composite, ERGB composite, FLHRrc, and the
Extended Data Fig. 4 | Examples showing disadvantages of using NASA amounts of invalid Rrs retrievals can be observed in the red-encircled areas in
standard R rs (i.e., with the removal of both Rayleigh and aerosol scattering) which severe blooms can be found. Additionally, nFLH shows high values at
in algal bloom detection. From left to right are the RGB composites, ERGB, cloud edges (yellow-encircled areas), making it challenging to use a simple
nFLH, and the bloom areas (green pixels) detected by the CIE-fluorescence threshold to classify blooms. However, such problems can be circumvented in
algorithm (based on Rrc, without the removal of aerosol scattering). Substantial our CIE-fluorescence algorithm. Created using ArcMap 10.4.
Article
Extended Data Fig. 5 | Sensitivity analysis of the impacts of aerosols on show the RGB composites, and the right three columns show the bloom areas
bloom detection. (a) Responses of bloom area (BA) to changes in aerosol under different AOTs. The percentages of BA changes are annotated in the
optical thickness (AOT). Aerosol reflectance (ρa) with AOTs of 0.01 and 0.02 at panels. (b) The standard deviation between the 12 monthly mean values of AOT
869-nm is simulated and added to the MODIS images, and the resulting bloom in global coastal waters (i.e., 66.7% of the intra-annual variability), and the
areas (green pixels) with and without added ρa are compared. The left columns histogram is shown in (c). Maps created using ArcMap 10.4.
Extended Data Fig. 6 | Comparison of different index-based algorithms in bloom areas (i.e., high nFLH values, which appear as bright and darkish features
algal bloom detection in various coastal regions. Image-specific thresholds on the ERGB images). The left panels are the bloom areas (green pixels)
(annotated within the panels) are required (labeled within the panels) for RI50, extracted using our CIE-fluorescence algorithm. The RGB-true color and ERGB
ABI (estimated with FLHRrc)48, RBD51, KBBI51, and RDI52 to delineate accurate composites are shown in Extended Data Fig. 3. Created using ArcMap 10.4.
Article
Extended Data Fig. 7 | Annual median bloom count and the proportion of ordered from the largest to the smallest. The LMEs are grouped by continent,
bloom-affected areas for large marine ecosystems (LMEs). (a) Annual and their names, numbers, and locations are shown in (a) and (b). Map created
median bloom count, (b) proportion of bloom-affected areas. The data are using Python 3.8.
Extended Data Fig. 8 | Comparison of bloom counts in the estuarine and
non-estuarine regions. Boxplots for long-term mean bloom count in the
estuarine (n = 13,622 pixel observations) and non-estuarine (n = 361,604 pixel
observations) regions. Comparison analysis was performed by two sided
Welch’s t-test (P < 0.001).Upper and lower bounds are first and third quartiles,
the bar in the middle represents the median value, and the whiskers show the
minimum and maximum values. Sixty-two estuarine zones from large rivers
were selected, and the boundary of each zone was manually delineated
according to high-resolution satellite images.
Article
Extended Data Fig. 9 | Clusters of different bloom growth paths. (a) The deviations are shown with dashed lines and gray shading. The proportions of
spatial distribution of different clusters. The fractions of different clusters different clusters in the global bloom-affected areas are annotated. (c) and (f)
across different latitudes are summarized. (b) The development of the The mean timing of the maximum bloom-affected areas (TMBAA) and the
maximum bloom-affected areas within a year within 1° × 1° grid cells, where associated standard deviations between 2003 and 2019. The whole year in the
all global grid cells are grouped into three distinct clusters according to the Southern Hemisphere is shifted forward by 183 days in (c). Maps created using
similarity of the bloom growth curve. The colored bond curves represent the Python 3.8.
mean values of all the grid cells, and their mean SST and associated standard
Extended Data Fig. 10 | Changes in climate extremes, global fertilizer uses, and La Niña events, respectively. The dots show annual mean values.
and fishery production over the past two decades. (a) Changes in the (b–c) Trends of nitrogen and phosphorus from 2003 to 2019 for different
bi-monthly Multivariate El Niño–Southern Oscillation (ENSO) index (MEI) countries. (d) Trends of fishery production from 2003 to 2018. Gray indicates
between 2002 and 2020. Positive and negative MEI values represent EI Niño no data. Maps created using ArcMap 10.4.
nature portfolio | reporting summary
Corresponding author(s): Lian Feng
Last updated by author(s): Nov 23, 2022
Reporting Summary
Nature Portfolio wishes to improve the reproducibility of the work that we publish. This form provides structure for consistency and transparency
in reporting. For further information on Nature Portfolio policies, see our Editorial Policies and the Editorial Policy Checklist.
Statistics
For all statistical analyses, confirm that the following items are present in the figure legend, table legend, main text, or Methods section.
n/a Confirmed
The exact sample size (n) for each experimental group/condition, given as a discrete number and unit of measurement
A statement on whether measurements were taken from distinct samples or whether the same sample was measured repeatedly
The statistical test(s) used AND whether they are one- or two-sided
Only common tests should be described solely by name; describe more complex techniques in the Methods section.
For null hypothesis testing, the test statistic (e.g. F, t, r) with confidence intervals, effect sizes, degrees of freedom and P value noted
Give P values as exact values whenever suitable.
For Bayesian analysis, information on the choice of priors and Markov chain Monte Carlo settings
For hierarchical and complex designs, identification of the appropriate level for tests and full reporting of outcomes
Estimates of effect sizes (e.g. Cohen's d, Pearson's r), indicating how they were calculated
Our web collection on statistics for biologists contains articles on many of the points above.
Data analysis SeaDAS (Version 7.5) were used to analyze the satellite images.
For manuscripts utilizing custom algorithms or software that are central to the research but not yet described in published literature, software must be made available to editors and
reviewers. We strongly encourage code deposition in a community repository (e.g. GitHub). See the Nature Portfolio guidelines for submitting code & software for further information.
Data
Policy information about availability of data
All manuscripts must include a data availability statement. This statement should provide the following information, where applicable:
March 2021
- Accession codes, unique identifiers, or web links for publicly available datasets
- A description of any restrictions on data availability
- For clinical datasets or third party data, please ensure that the statement adheres to our policy
The MODIS Aqua data can be obtained from the U.S. National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC).
The in situ reported HAB data are available from events from http://haedat.iode.org.
The Exclusive economic zones (EEZs) dataset is available at https://www.marineregions.org/download_file.php?name=World_EEZ_v11_20191118.zip.
The boundaries of large marine ecosystems (LMEs) were obtained from https://www.sciencebase.gov/catalog/item/55c77722e4b08400b1fd8244.
1
Annual data between 2003 and 2019 on synthetic fertilizer use, including nitrogen and phosphorus, are available from https://ourworldindata.org/fertilizers.
Annual aquaculture production includes cultivated fish and crustaceans in marine and inland waters, and sea tanks, and the data between 2003 and 2018 are
Reporting on sex and gender Use the terms sex (biological attribute) and gender (shaped by social and cultural circumstances) carefully in order to avoid
confusing both terms. Indicate if findings apply to only one sex or gender; describe whether sex and gender were considered in
study design whether sex and/or gender was determined based on self-reporting or assigned and methods used. Provide in the
source data disaggregated sex and gender data where this information has been collected, and consent has been obtained for
sharing of individual-level data; provide overall numbers in this Reporting Summary. Please state if this information has not
been collected. Report sex- and gender-based analyses where performed, justify reasons for lack of sex- and gender-based
analysis.
Population characteristics Describe the covariate-relevant population characteristics of the human research participants (e.g. age, genotypic
information, past and current diagnosis and treatment categories). If you filled out the behavioural & social sciences study
design questions and have nothing to add here, write "See above."
Recruitment Describe how participants were recruited. Outline any potential self-selection bias or other biases that may be present and
how these are likely to impact results.
Ethics oversight Identify the organization(s) that approved the study protocol.
Note that full information on the approval of the study protocol must also be provided in the manuscript.
Field-specific reporting
Please select the one below that is the best fit for your research. If you are not sure, read the appropriate sections before making your selection.
Life sciences Behavioural & social sciences Ecological, evolutionary & environmental sciences
For a reference copy of the document with all sections, see nature.com/documents/nr-reporting-summary-flat.pdf
Study description This study developed a novel method to map global coastal algal blooms and used this tool to examine satellite images between
2003 and 2020, addressing three fundamental questions: 1) where and how frequently have global coastal oceans been affected by
phytoplankton blooms? 2) have the blooms expanded or intensified over the past two decades, both globally and regionally? and 3)
what are the potential drivers?
Research sample Three separate samples were selected. 1) MODIS Aqua images were used to develop the phytoplankton bloom extraction algorithm,
2) MODIS Aqua images and were used to verify the reliability of the algorithm and the accuracy of the phytoplankton bloom
extraction results, and 3) in situ reported HAB events from the HAEDAT dataset were used to validate the accuracy of the
phytoplankton bloom extraction results.
Sampling strategy A total of 115 MODIS Aqua images were selected from the different locations where coastal phytoplankton blooms have been
recorded in the published literature, of which 80 were used for algorithm development and 35 were used for algorithm validation. A
total number of 2609 HAB events that occurred in the coastal area were selected from the HAEDAT dataset.
Data collection The HAEDAT dataset is a collection of records of harmful algal bloom (HAB) events , maintained under the UNESCO
Intergovernmental Oceanographic Commission and with data archives since 1985.
Timing and spatial scale The satellite data were acquired from different seasons and across various phytoplankton bloom magnitudes between 2003 and
2020, and HAB data from 2003 to 2020 in the HAEDAT dataset were used.
March 2021
Randomization Excluding data affected by clouds, a total of 0.76 million MODIS Aqua images from 2003 to 2020 were used to extract phytoplankton
blooms in global coastal area.
2
Did the study involve field work? Yes No
March 2021
3
Article
https://doi.org/10.1038/s41586-023-05752-y Lucie A. Bergeron1 ✉, Søren Besenbacher2, Jiao Zheng3,4, Panyi Li3, Mads Frost Bertelsen5,
Benoit Quintard6, Joseph I. Hoffman7,8, Zhipeng Li9, Judy St. Leger10, Changwei Shao11,
Received: 19 November 2021
Josefin Stiller1, M. Thomas P. Gilbert12,13, Mikkel H. Schierup14 & Guojie Zhang1,15,16,17 ✉
Accepted: 23 January 2023
Germline mutations are the proximate source of genomic innovation From a long-term evolutionary perspective, the ‘drift barrier hypoth-
and inherited diseases4. Consequently, considerable effort has been esis’ proposes that lower mutation rates may reflect the increased effi-
spent on characterizing the molecular processes underlying these ciency of natural selection at reducing the occurrence of mutations in
mutations and estimating germline mutation rates (GMRs). Mutations species with large effective population sizes3.
are rare events, yet the frequency at which they are introduced into However, a lack of accurate and standardized GMR estimation
genomes at each generation varies considerably across taxa, from has so far precluded testing current hypotheses of GMR evolution.
approximately 10−11 mutations per site per generation in unicellular Pedigree-based estimates of GMRs per generation have recently been
eukaryotes up to approximately 10−7 mutations per site per genera- published for a handful of vertebrate species, mainly focusing on
tion in multicellular eukaryotes1,5,6. Inferring the driving forces of GMR humans and primates12–17. Furthermore, a recent comparative study
evolution has important implications for understanding the mecha- of 16 mammalian species identified an effect of lifespan on somatic
nisms underlying mutagenesis. Several hypotheses have been proposed mutation rates inferred from the sequencing of intestinal crypts18.
to explain variation in GMRs among lineages. Some of these invoke Nevertheless, interspecific comparisons of GMR variation remain
molecular mechanisms such as DNA methylation7 or microsatellite restricted in taxonomic scope19, partly due to the difficulty of com-
instability8, whereas others invoke external factors such as exposure to paring GMR estimates derived using different methodologies2. For
mutagenic environments9. Other studies have argued that life-history example, alternative bioinformatic pipelines used in different studies
traits might explain some of the variation both in the prevalence of can yield GMR estimates that vary by a factor of two, even when applied
mutations and in the ability to repair DNA. In particular, the genera- to the same parent–offspring trios2. This highlights the importance
tion time10 and the metabolic rate11 have been suggested to be key of applying consistent analytical pipelines for interspecies compari-
life-history traits that could be associated with germline mutations. sons of GMRs. We therefore generated high-depth genome sequences
1
Villum Centre for Biodiversity Genomics, Section for Ecology and Evolution, Department of Biology, University of Copenhagen, Copenhagen, Denmark. 2Department of Molecular Medicine,
Aarhus University, Aarhus, Denmark. 3BGI-Shenzhen, Shenzhen, China. 4BGI Education Center, University of Chinese Academy of Sciences, Shenzhen, China. 5Copenhagen Zoo, Frederiksberg,
Denmark. 6Parc Zoologique et Botanique de Mulhouse, Mulhouse, France. 7Department of Animal Behaviour, Bielefeld University, Bielefeld, Germany. 8British Antarctic Survey, High Cross,
Cambridge, UK. 9College of Animal Science and Technology, Jilin Agricultural University, Changchun, China. 10Department of Biomedical Sciences, Cornell University, Ithaca, NY, USA. 11Key Lab
of Sustainable Development of Marine Fisheries, Ministry of Agriculture and Rural Affairs, Yellow Sea Fisheries Research Institute, Chinese Academy of Fishery Sciences, Qingdao, China.
12
Center for Evolutionary Hologenomics, The GLOBE Institute, University of Copenhagen, Copenhagen, Denmark. 13University Museum, NTNU, Trondheim, Norway. 14Bioinformatics Research
Centre, Aarhus University, Aarhus, Denmark. 15Centre for Evolutionary & Organismal Biology, Women’s Hospital, Zhejiang University School of Medicine, Hangzhou, China. 16Liangzhu
Laboratory, Zhejiang University Medical Center, Hangzhou, China. 17State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences,
Kunming, China. ✉e-mail: lucie.a.bergeron@gmail.com; guojiezhang@zju.edu.cn
●
Betta splendens 19 trios
● ●
Actinopterygii Paralichthys olivaceus
● ●
11 Cynoglossus semilaevis
●
Larimichthys crocea
Amphiprion ocellaris
●
Neovison vison
Ailurus fulgens
●
Odobenus rosmarus
●
13 Arctocephalus gazella
●
●
●
●
Carnivora Vulpes vulpes
Canis lupus familiaris
●
●
●
Panthera tigris
Panthera pardus
Felis catus
Laurasiatheria Rousettus aegyptiacus
Tapirus indicus
Ceratotherium simum simum
Vicugna pacos
Sus scrofa
●
●
●
●
●
Tursiops truncatus 36 mammals
1 12 Orcinus orca
Hippopotamus amphibius 76 trios
Giraffa camelopardalis
Rangifer tarandus
●
Cervus nippon
Cervus elaphus yarkandensis
Moschus berezovskii
Capra hircus
●
Rodentia Mus musculus
Cavia aperea
Eutheria
● ●
●
● ● ●
●
● ●
●
Fukomys damarensis
●
8 Tupaia belangeri
●
Hylobates lar
Pan troglodytes
Mammalia 14 Homo sapiens
●
6 Mandrillus leucophaeus
●
Primates Pithecia pithecia
●
● ●
●
●
Saimiri boliviensis boliviensis
●
●
Procavia capensis
●
●
●
Sarcophilus harrisii
3 Lepidosauria Monodelphis domestica
Thamnophis sirtalis
●
5 Pogona vitticeps
●
Sphaerodactylus inigoi 6 reptiles
9 Eublepharis macularius
Coleonyx brevis 18 trios
Chrysemys picta
●
●
●
●
●
●
●
●
Rhea pennata
4 Gallus gallus
Coturnix japonica
●
●
●
●
●
●
Chauna torquata
Aves Gyps fulvus
Bubo scandiacus
7 Taeniopygia guttata
● ●
Turdus merula 18 birds
● ●
● ●
Saxicola maurus
48 trios
● ●
●
10 Cyanistes caeruleus
●
Ara glaucogularis
Neoaves Phoenicopterus roseus
Larus marinus
● ●
●
Larus argentatus
●
●
●
●
●
Platalea ajaja
Pelecanus crispus
Pygoscelis adeliae
Aptenodytes forsteri
b c No bias
4 Female bias Strong male bias
● Mammals Actinopterygii
Mutation rate per site per generation (×10–8)
● Birds
● Fishes Carnivora
● Reptiles Perissodactyla/Suina/Tylopoda
3
Cetartiodactyla
Fig. 1 | Variation in GMRs and their association with life-history traits significant after removing a single outlier, the Darwin’s rhea. c, The male-to-
across 68 vertebrate species. a, The phylogenetic tree of 68 species is based female contribution ratio (α) is estimated for groups of vertebrates having at
on UCE data and is calibrated with fossil data at 14 nodes (see Methods; least 30 mutations phased to their parents of origin in each group. The highest
Extended Data Fig. 3 and Supplementary Fig. 8). The average pedigree-based male bias (7.6:1) is found in two bird lineages, whereas fishes and reptiles show
mutation rates per generation for each species, which are represented by the negligible male bias. The data are represented with 95% confidence intervals
squares, show 40-fold variation among species. The 95% binomial confidence based on the binomial variance. The silhouette of Syngnathus scovelli was
intervals are shown, and individual trios are represented by round points. See created by J.S. All other silhouettes are from PhyloPic (http://phylopic.org),
Supplementary Table 8 and Extended Data Fig. 4 for a comparison with except for one of the silhouettes of Sarcophilus harrisii, which was created by
published estimated rates of closely related species. b, The per-generation S. Werning, and the silhouette of Pan troglodytes, which was created by T. M.
mutation rate is significantly associated with the average parental age at the Keesey (vectorization) and T. Hisgett (photography); both are available under a
time of offspring production across all individuals with known paternal age CC-BY 3.0 licence (https://creativecommons.org/licenses/by/3.0).
(105 trios), using linear regression. For birds, this relationship is statistically
mutations of maternal origin (α = 0.8), although the 95% CI overlaps 1 sperm cells during a limited period before the mating season43–45, which
(95% CI = 0.5–1.4). This variation among vertebrate classes can be will tend to reduce differences in cell division numbers between males
explained by differences in the process of gametogenesis. Although and females, leading to more equal α. Moreover, female fishes are usu-
most birds and mammals produce sperm cells continuously through ally synchronous ovulators46, producing hundreds to millions of eggs
time42, reptiles and fishes tend to be seasonal breeders, producing at the same time followed by a proliferation of new oogonia47. This
sex. Consequently, a higher number of primordial germ cell specifi- Mammals Birds Fishes Reptiles
cation mutations in some vertebrate groups could be an alternative Fig. 2 | GMRs are associated with long-term substitution rates. a,b, There is
explanation for the lower male-biased contribution to DNMs. a positive association between the modelled yearly pedigree-based mutation
rates and the macroevolutionary substitution rates when using phylogenetic
regression (PGLS) on both UCEs and their flanking sequences (a) and whole-
Yearly mutation rates genome alignments (WGAs) (b). The grey dashed lines indicate equality. See
To use our results for phylogenetic dating and to compare the speed of Extended Data Fig. 5 for plots of the same data on a log scale and Extended Data
evolution among species with different generation times, we needed Fig. 6 for a comparison of UCE and WGA methods.
estimates of yearly mutation rates. Different methods have been
used in the literature to estimate yearly mutation rates. When sample
sizes are small, yearly rates are commonly inferred by dividing the to estimate yearly rates and both have caveats owing to the underly-
per-generation rate by the average age of the parents (or the generation ing assumptions they require. Bearing this in mind, we decided to use
time if parental age is unknown)49–51. However, this method implicitly µyearly_modelled for the current analysis as we believe that this measure is
assumes a constant accumulation of mutations from conception to more representative of the yearly rate at the generation time for each
reproduction, that is, the regression line of mutation rate on parental species (estimated yearly rates are provided in Supplementary Table 9
age should run through the origin. Our results (Fig. 1b), as well as pre- for comparison).
vious studies of mice, humans and cats20,34, imply that parents always The estimated average µyearly_modelled varies more than 120-fold among
carry a minimum number of mutations in their gametes regardless of species (Supplementary Note 1 and Supplementary Table 9), with the
their age. This could lead to the yearly rate being overestimated for a highest µyearly_modelled estimated for the Texas banded gecko at 1.96 × 10−8
given species if the sampled trio (or trios) had young parents compared mutations per site per year (95% CI = 1.23 × 10−8 to 2.83 × 10−8), whereas
with the average generation time for that species52. Consequently, we the lowest µyearly_modelled estimates were obtained for two bird species,
built a model that incorporates this mutational contribution at birth. the griffon vulture and the snowy owl, both with less than 0.18 × 10−9
Unfortunately, small per-species sample sizes in our dataset precluded mutations per site per year (snowy owl: µyearly_modelled = 0.16 × 10−9, 95%
modelling the effects of parental age separately for each species. How- CI = 0.05 × 10−9 to 0.34 × 10−9; griffon vulture: µyearly_modelled = 0.17 × 10−9,
ever, we observed very similar intercepts and slopes across taxonomic 95% CI = 0.07 × 10−9 to 0.32 × 10−9). This large amount of interspecific
groups, allowing us to fit a joint model for all species. A Poisson model variation is remarkable given that pedigree-based GMR estimates of
explaining the number of mutations in each trio using a mutational individual species assessed by previous separate studies only show an
contribution at birth and a weighted average of paternal and maternal approximately 16-fold variation in yearly GMRs34,51. Within primates, we
age fits the data surprisingly well. To incorporate interspecific variation observed a twofold variation across species and found a general trend
in male bias, we used the per-species fraction of paternal and maternal for rates to be higher in the New World monkeys than in the great apes.
mutations estimated using read-backed phasing to weigh the aver- This is consistent with previous independent estimates from primates19
age of the parental ages for each trio. Using this model, the number of and supports the ‘hominoid slowdown’ hypothesis53–56.
predicted mutations matches the observed number with an overall r 2 Next, we used µyearly_modelled to assess the strength of the association
of 0.73 (mammalian r 2 = 0.58, avian r 2 = 0.51; Supplementary Note 1). between GMRs and long-term evolutionary substitution rates. To obtain
The yearly rates inferred with the naive method of dividing the an estimate of the long-term substitution rate, we used the alignment of
per-generation rate by parental age (µyearly) and the rates obtained with ultraconserved elements (UCEs), which are more likely to align among
our model (µyearly_modelled) yielded similar results (Pearson’s correlation taxonomically distant species, plus 1,000 bp of flanking regions on each
r 2 = 0.40, P = 0.002), and for 55% of the species, µyearly falls within the side of the UCE sequences, which will more closely reflect the neutral
95% confidence interval of the µyearly_modelled. As expected, the estimates substitution rate57. We found a significant positive correlation between
showed the greatest differences for those species in which the parents µyearly_modelled and the UCE substitution rate after excluding domesticated
reproduced far from the generation time, with the model-based esti- species owing to their overall much higher yearly mutation rates (see
mates being smaller for those species that reproduced earlier than their the following section; phylogenetic generalized least squares (PGLS):
generation time and larger for those species that reproduced later than adjusted r2 = 0.23, P = 0.002; Fig. 2a). This pattern is especially pro-
their generation time. For example, the pigs in our dataset reproduced nounced for mammals (PGLS: adjusted r 2 = 0.44, P = 0.0008), even
at around 6 months of age, which is more than 5 years earlier than the after removing the two outliers (PGLS: adjusted r 2 = 0.32, P = 0.009).
estimated generation time of this species. Thus, µyearly = 8.64 × 10−9 We also found a significant relationship between µyearly_modelled and the
mutations per site per year was potentially overestimated compared long-term substitution rate inferred using whole-genome alignments
with the µyearly_modelled = 1.05 × 10−9 mutations per site per year at the gen- (PGLS: adjusted r2 = 0.12, P = 0.02; Fig. 2b).
eration time. Conversely, the yearly rate of the Texas banded gecko
was potentially underestimated at µyearly = 3.17 × 10−9 mutations per site
per year using the reproductive age of 2 years of age from our dataset, Life-history traits shape GMR variation
whereas the modelled rate was µyearly_modelled = 1.96 × 10−8 mutations per To test various hypotheses relating to the causes of GMR variation
site per year at a generation time of between 3 and 4 months. Both the among species, we tested for associations between the modelled
naive method and the modelled method have been used in the literature mutation rate per generation (µgeneration_modelled) and life-history traits
1.5 1.5
2.0 2.0
1.0 1.0
0.5 0.5
0.5 0.5
All species All species
r2 = 0.150 r2 = 0.184
P = 0.002 P = 0.0006 0 0
0 0
Yes No Yes No
0 5 10 15 20 25 0 2 4 6 8 10 12
Domestication status Domestication status
Generation time Age at sexual maturity
Mammals Birds Fishes Reptiles
c All species Mammals Birds d
P = 0.013 P = 0.011 P = 0.720 Fig. 4 | The yearly GMRs are higher in domesticated species than in
NS
Mutation rate per site per generation (10–8)
1.0
–8.2 instead (using phylogenetic regression (PGLS) on a total number of 55 species)
shows that there is no difference in yearly GMRs between domesticated and
–8.4 non-domesticated animals, suggesting that this difference is mainly driven by
0.5
the shorter generation time of domesticated species. The box plots represent
All species
–8.6 r2 = 0.081 the median, the interquartile range and the maximum and minimum excluding
P = 0.020
0 outliers.
Few Many Few Many Few Many 4 4.5 5 5.5 6
Number of offspring per generation Harmonic mean Ne (log10)
Fig. 3 | Predictors of interspecific variation in GMRs. a–c, Significant Indeed, if Ne was estimated using the pedigree-based mutation rate,
positive associations are found using phylogenetic regression (PGLS) between a stronger correlation might arise between Ne and the mutation rate
the modelled per-generation mutation rates and three life-history traits: (see Extended Data Fig. 8). We found a significant negative association
species-specific mean generation time (a), age at sexual maturity (b) and the between µgeneration_modelled and the harmonic mean Ne per species over the
number of offspring per generation (c). In total there are 55 species with past 30,000–1,000,000 years (PGLS: adjusted r 2 = 0.08, P = 0.020;
modelled per-generation rates, including 32 mammalian and 15 avian species.
Fig. 3d) as would be expected under the drift barrier hypothesis. This
The box plot in c represents the median, the interquartile range and the
relationship is mainly driven by mammals (PGLS: adjusted r 2 = 0.31,
maximum and minimum excluding outliers. d, Species-specific average
P = 0.0006), a signal that is also observed when using the harmonic
per-generation mutation rates are negatively associated with the harmonic
mean of the effective population size (N e) over the past 1 million years, using
average Ne over a smaller timescale (30,000–130,000 years; PGLS:
phylogenetic regression (PGLS). adjusted r 2 = 0.10, P = 0.04, Extended Data Fig. 8). The most appro-
priate timeframe used to estimate Ne depends on the evolutionary
time necessary for the mutation rate to adapt to changes in Ne. How-
ever, the pairwise sequentially Markovian coalescent method cannot
including mating system (monogamy versus polygamy), maturation accurately estimate recent Ne. To overcome this limitation, we also
time, body mass, longevity, fecundity and the generation time (Supple- estimated Ne as π/4μ, with nucleotide diversity (π) and the substitu-
mentary Table 9). We used the µgeneration_modelled instead of the µgeneration as tion rate per site per generation (μ) estimated from the UCE align-
the former is less dependent on the age of the parents and is more rep- ments. This results in a similar negative association between Ne and
resentative of the rate at generation time for a given species. Although µgeneration_modelled (linear regression: adjusted r 2 = 0.83, P = 2.2 × 10−16;
taking into account phylogenetic relatedness, many of these traits Extended Data Fig. 9), further supporting the drift barrier hypoth-
are significantly associated with µgeneration_modelled including the genera- esis. However, caution should be taken as Ne estimates rely on gen-
tion time (PGLS: adjusted r2 = 0.15, P = 0.002; Fig. 3a), the maturation eration times inferred from contemporary observations, whereas
time (PGLS: adjusted r2 = 0.18, P = 0.0006; Fig. 3b) and the number of generation times could conceivably have changed over evolutionary
offspring per generation (PGLS: adjusted r2 = 0.10, P = 0.013; Fig. 3c). timescales. Furthermore, population size depends negatively on the
Species with a higher number of offspring per generation also showed generation time (PGLS Ne in log scale: adjusted r2 = 0.20, P = 0.0004).
significantly lower µgeneration_modelled when considering only mammalian Therefore, a negative association between Ne and μ could potentially
species (PGLS: adjusted r2 = 0.17, P = 0.011), but this relationship was be driven by a large effect of the generation time on per-generation
not significant for birds (PGLS: adjusted r2 = −0.066, P = 0.720). Collec- mutation rates.
tively, these traits explain almost 18% of the variation in µgeneration_modelled
(multiple PGLS: adjusted r2 = 0.18, P = 0.004). The other life-history
traits that we tested, including longevity, mating strategy and body High yearly rates in domesticated species
mass, are not significantly associated with µgeneration_modelled (see Extended Domestication imposes strong artificial selection, recurrent genetic
Data Fig. 7). bottlenecks or both. Our dataset includes 22 domesticated or semi-wild
Another key parameter for species evolution is the effective popula- species that have been bred in captivity for many generations. When
tion size (Ne), which impacts genetic drift and the efficacy of selection. using the naive method of dividing the per-generation rate by the
To investigate the effect of Ne on µgeneration_modelled and to test the drift bar- parental age, these species show significantly higher µyearly than the
rier hypothesis3, which predicts the evolution of higher mutation rates non-domesticated species (PGLS: adjusted r2 = 0.13, P = 0.0015; Fig. 4a).
in species with small Ne, we calculated Ne using the pairwise sequentially The higher mutation rates of domesticated animals are likely due to
Markovian coalescent method based on one randomly selected father strong artificial selection for traits such as shorter generation times.
per species. To avoid circularity, we estimated Ne based on the substitu- Indeed, using µyearly_modelled, we found no difference between domes-
tion rate calculated from the UCE alignment (Supplementary Table 9). ticated and non-domesticated species (PGLS: adjusted r2 = 0.037,
Extended Data Fig. 2 | Comparison of published male bias estimates (α) species per group (to have a minimum of 30 phased mutations per group) and
using genome alignments and our male bias estimates (modified Fig. 1c of the 95% confidence intervals were based on the binomial distribution. The
the main text). The yellow points are α estimates from Wilson Sayres et al.28, silhouette of Sygnathus was created by J.S. All other silhouettes are from PhyloPic
and the purple points are α estimates from Wu et al. 31. Most of the common (http://phylopic.org), except one of the silhouettes of Sarcophilus harrissi,
species reveal similar estimates with overlapping 95% confidence intervals. which was created by S. Werning, and the silhouette of Pan troglodytes, which
However, the estimates of α based on genome alignments are generally lower for was created by T. M. Keesey (vectorization) and T. Hisgett (photography);
dogs and cats than our estimates, yet the pedigree-based estimate of α for cats both are available under a CC-BY 3.0 licence (https://creativecommons.org/
(Wang et al.20; green point) is similar to our estimate. See also Supplementary licenses/by/3.0).
Table 5. The barplots represent male biases estimated by clustering different
Extended Data Fig. 3 | Robustness of the calibration. We compared the adjusted r 2 = 0.91, F = 9416 on 1 and 950 DF, p-value: < 2.2 × 10 −16). However, some
estimated substitution rates using the 14 initial calibration points with the of the calibration points had a stronger impact on the estimated substitution
inferred substitution rates using only 13 calibration points (with 14 iterations to rates. For instance, removing the two bird nodes (7 and 10), the gekko node (9),
remove each calibration node one by one). We found a strong relationship the Canidae/Arctoidea node (13) and the Glires/Primate node (8) altered some
between the rates estimated with 14 and 13 calibrations (linear regression of the substitution rate estimates.
Article
Extended Data Fig. 4 | Per-generation mutation rates (similar to Fig. 1a) (Malinsky et al.100), close to Canis lupus familiaris, Canis lupus (Koch et al.101), close
including published data on closely related species. For each species, the to Capra hircus, Bos taurus (Harland et al.102), close to Mandrillus leucophaeus,
colored squares represent the average per-generation observed rate, along Papio anubis (Wu et al.13), Macaca mulatta (Wang et al.14, Bergeron et al.12), and
with the 95% confidence intervals based on the binomial distribution, and the Chlorocebus sabaeus (Pfeifer103), close to Saimiri boliviensis boliviensis, Aotus
black points represent published estimates from similar or closely related nancymaae (Thomas et al.17), close to Monodelphis domestica, Ornithorhynchus
species to those included in our dataset. For most of the species, these estimates anatinus (Martin et al.49), close to Taeniopygia guttata, Ficedula albicollis
lie within the 95% confidence intervals of our estimates. Published estimates (Smeds et al. 50). See also Supplementary Table 8. The silhouette of Sygnathus
are from: Felis catus (Wang et. al. 20), Mus musculus (Milholland et al.93, Lindsay was created by J.S. All other silhouettes are from PhyloPic (http://phylopic.org),
et al. 34), Pan troglodytes (Venn et al. 21, Tatsumoto et al. 23, Besenbacher et al.16), except one of the silhouettes of S. harrissi, which was created by S. Werning, and
Homo sapiens (Conrad et al.94, Kong et al.65, Francioli et al. 32, Rahbari et al.95, the silhouette of P. troglodytes, which was created by T. M. Keesey (vectorization)
Wong et al.96, Jónsson et al. 22, Maretty et al.82, Turner et al.97, Sasani et al.98, and T. Hisgett (photography); both are available under a CC-BY 3.0 licence
Kessler et al.99). The closely related species are from: close to the Salmo salar, (https://creativecommons.org/licenses/by/3.0).
Clupea harengus (Feng et al. 51), close to Paralichthys olivaceus, the Cichlid
Extended Data Fig. 5 | Germline mutation rates are associated with long- the per-year rates and the rates derived from Ultraconserved elements (UCEs)
term substitution rates. This figure is similar to the main Fig. 2 but uses and their flanking sequences. b. However, this correlation is not significant
phylogenetic regression (PGLS) on a log scale. The grey dashed lines indicate when comparing the per-year rates with the rates derived from the whole
equality. a. Using a log scale, there is a significant positive correlation between genome alignments (WGAs).
Article
Extended Data Fig. 6 | Comparison of substitution rates estimated with Ultra Conserved Elements (UCEs) and MultiZ alignments. The substitution rates
estimated with the two methods are highly correlated (linear regression: adjusted r2 = 0.73, F = 179.9 on 1 and 66 DF, p < 2.2 × 10 −16).
Extended Data Fig. 7 | Three life-history traits are not significantly associated species with modeled per-generation rate was 55 for the phylogenetic regression
with the per-generation mutation rate. a. lifespan in the wild, b. body mass (PGLS). The boxplots represent the median, the interquartile range, and the
and c. the mating system (polygamy versus monogamy). The total number of maximum and minimum excluding outliers.
Article
Extended Data Fig. 8 | The drift barrier hypothesis on different times and r2 = 0.104, p = 0.04). We used the harmonic mean over the past million years in
different mutation rate parameters used to estimate N e with phylogenetic the main text, as PSMC is not reliable over recent periods. c. When looking at the
regression (PGLS). a. The correlation between N e and the mutation rate per relationship between the mutation rate and N e, estimated using the pedigree-
generation is not significant when using the most recent value before 30,000 based mutation rate, we find a stronger signal over the past 1,000,000 years,
years estimated by PSMC. b. The relationship is also not significant when using probably due to the circularity of this analysis. d. However, the relationship is
the harmonic mean over a more recent period of time (30,000 years to 130,000 still not significant when using the most recent time point or e. the average over
years ago). However, this relationship is significant for mammals (adjusted the past 100,000 years.
Extended Data Fig. 9 | Effective population sizes calculated with two 1,000,000 years ago is significantly correlated with the effective population
different methods (see main text) are significantly correlated. The size estimated from N e = π/4μ (linear regression: adjusted r2 = 0.83, F = 316.3 on
harmonic mean of the population size estimated with PSMC from 30,000 to 1 and 63 DF, p < 2.2 × 10 −16).
Article
https://doi.org/10.1038/s41586-023-05748-8 Brian Hsueh1,6, Ritchie Chen1,6, YoungJu Jo1, Daniel Tang1, Misha Raffiee1, Yoon Seok Kim1,
Masatoshi Inoue1, Sawyer Randles1, Charu Ramakrishnan1, Sneha Patel1, Doo Kyung Kim1,
Received: 31 December 2021
Tony X. Liu1, Soo Hyun Kim1, Longzhi Tan1, Leili Mortazavi1, Arjay Cordero1, Jenny Shi1,
Accepted: 20 January 2023 Mingming Zhao2, Theodore T. Ho1, Ailey Crow1, Ai-Chi Wang Yoo1, Cephra Raja1,
Kathryn Evans1, Daniel Bernstein2, Michael Zeineh3, Maged Goubran3 & Karl Deisseroth1,4,5 ✉
Published online: 1 March 2023
Open access
Emotional states influence bodily physiology, as exemplified in the top-down process
Check for updates
by which anxiety causes faster beating of the heart1–3. However, whether an increased
heart rate might itself induce anxiety or fear responses is unclear3–8. Physiological
theories of emotion, proposed over a century ago, have considered that in general,
there could be an important and even dominant flow of information from the body to
the brain9. Here, to formally test this idea, we developed a noninvasive optogenetic
pacemaker for precise, cell-type-specific control of cardiac rhythms of up to 900 beats
per minute in freely moving mice, enabled by a wearable micro-LED harness and the
systemic viral delivery of a potent pump-like channelrhodopsin. We found that
optically evoked tachycardia potently enhanced anxiety-like behaviour, but crucially
only in risky contexts, indicating that both central (brain) and peripheral (body)
processes may be involved in the development of emotional states. To identify
potential mechanisms, we used whole-brain activity screening and electrophysiology
to find brain regions that were activated by imposed cardiac rhythms. We identified the
posterior insular cortex as a potential mediator of bottom-up cardiac interoceptive
processing, and found that optogenetic inhibition of this brain region attenuated the
anxiety-like behaviour that was induced by optical cardiac pacing. Together, these
findings reveal that cells of both the body and the brain must be considered together to
understand the origins of emotional or affective states. More broadly, our results define
a generalizable approach for noninvasive, temporally precise functional investigations
of joint organism-wide interactions among targeted cells during behaviour.
Interoceptive processing of visceral physiological signals, such as has—although widely debated—remained largely experimentally intrac-
cardiac palpitations or stomach fullness, is crucial for maintaining table11. Available nonspecific interventions that might disrupt cardiac
homeostasis1–3. Diverse psychiatric conditions, such as anxiety dis- signals (such as electrical vagus nerve stimulation) are well known to
orders, panic disorder, body dysmorphic disorders and addiction, also induce numerous physiological changes that would be unwanted
have been hypothesized to be related to dysregulation of interocep- in this context, including direct suppression of respiratory and heart
tive monitoring by the brain3,4, and can be statistically correlated with rates as well as anxiolytic and antidepressive effects11–13, giving rise to
specific visceral organ dysfunction. For example, patients with panic multiple direct confounds for the question explored here. Other non-
disorder and agoraphobia are more likely to have mitral valve pro- specific interventions to alter cardiac rhythms, such as broadly active
lapse or clinical symptoms similar to paroxysmal supraventricular pharmacological stimulants or electrical pacemakers14, also introduce
tachycardia5,6. Modern correlative studies have further suggested insuperable confounds through initial actions beyond the direct pacing
links between cardiac changes and affect regulation7,8, including cor- of cardiomyocytes, and thus lack the necessary precision. Studying the
relations between cardiac interoception with anxiety and functional key question of how cardiac physiology regulates emotional states has
alterations in the insular cortex, a cortical region that has a central role remained inaccessible, and the effects on behaviour remain unknown.
in both the processing of physiological signals and the regulation of Precise modulation of electrochemical signals in the heart and other
emotions4,10. However, determining whether primary physiological peripheral organs in vivo would enable fundamental studies of physi-
signals such as increased heart rate can causally influence behavioural ology and interoceptive signalling15–19, but stimulation methods that
states, as proposed in classical physiological theories of emotion9, operate with high spatial and temporal precision in highly dynamic
1
Department of Bioengineering, Stanford University, Stanford, CA, USA. 2Department of Pediatrics, Stanford University, Stanford, CA, USA. 3Department of Radiology, Stanford University,
Stanford, CA, USA. 4Department of Psychiatry and Behavioral Sciences, Stanford University, Stanford, CA, USA. 5Howard Hughes Medical Institute, Stanford University, Stanford, CA, USA.
6
These authors contributed equally: Brian Hsueh, Ritchie Chen. ✉e-mail: deissero@stanford.edu
Time spent on
120
50 5 Closed
arms
ChRmine 60
b
ChRmine
0 0 0
ul e
OFF ON OFF
e
hR l
n
C tro
im in
in
io
St sel
m
at
on
Ba
C
h i j k l m Control ChRmine
n Control ChRmine
Day 1: Baseline Control ChRmine
* **
* NS * NS **
150 Lever press 50 50 120
10
Time spent in centre (s)
30 10 10 2 20
10% 90% 0% 0%
10% shock 10% shock
0 0.1-mA Water 0 0 0 0
OFF ON OFF shock reward 0 10 20 30 0 10 20 30 0 10 0 10 0 10 0 10
ChRmine
Time (min) Time (min) Shock per session (%) Shock per session (%)
Fig. 2 | Optically induced tachycardia increases anxiety-like behaviour. time effect F(2,24) = 3.42, P = 0.049. Bonferroni post hoc: ON epoch ChRmine
a, Schematic of a micro-LED mounted to a wearable vest and fastened onto a versus control, *P = 0.018). j, Vogel conflict task to assay for cardiogenic effects
mouse. b, Representative ECG trace of optically induced tachycardia (900 bpm on operant behaviour. Water-restricted mice were first trained for 2–3 weeks
for 500 ms every 2 s) used for all behavioural assays. Scale bar, 0.2 mV, 500 ms. until each mouse was able to complete the 50 water-reward lever-press trials
c, Example path trace of a mouse with (red) or without (grey) ChRmine over 30 min for at least 3 consecutive days. On the day of the behavioural task,
expression during an RTPP test, in which mice received optically induced mice received optical pacing while completing a total of 50 lever-press trials
cardiac pacing on one side of the chamber. d, Percentage of time spent on per session (day 1). On the subsequent day, a 10% pseudorandom chance of
stimulation side during baseline and stimulation days for control (grey) and shock was introduced upon lever press (day 2). k,l, Cumulative lever presses
ChRmine-expressing (red) mice (n = 16 mice per group; two-way repeated- during 0% (day 1) and 10% shock (day 2) sessions for control (k) and ChRmine-
measures ANOVA with Bonferroni post hoc test: group (opsin) × time expressing (l) mice (n = 8 mice). m, Average lever-pressing rate during 0%
interaction F(1,30) = 2.29, P = 0.14; group (opsin) effect F(1,30) = 6.2 × 10 −4, P = 0.98; baseline or 10% shock trial sessions (n = 8 mice per group; two-way repeated-
time effect F(1,30) = 2.06, P = 0.16. Bonferroni post hoc: control versus ChRmine measures ANOVA with Bonferroni post hoc test: group (opsin) × condition
P = 0.71 (baseline day); P = 0.67 (stimulation day)). NS, not significant. (shock) interaction F(1,14) = 8.326, P = 0.0120; group (opsin) effect F(1,14) = 7.39,
e, Average velocity on the optically paced side during RTPP (n = 16 mice per P = 0.0166; condition (shock) effect F(1,14) = 3.162, P = 0.0971. Bonferroni
group; unpaired two-tailed t-test, P = 0.81). f, Example path trace of control post hoc: control 0% versus 10%, P = 0.8933; ChRmine 0% versus 10%,
(grey) and ChRmine-expressing (red) mice during an EPM test with optical *P = 0.0106; 0% control versus ChRmine, P > 0.9999; 10% control versus
pacing during the 5-min ON epoch of a 15-min trial. Open arms are vertical; ChRmine, **P = 0.0010). n, Elapsed time between a lever press resulting in
closed arms are horizontal and bordered in grey. g, Time spent in open arms shock and a subsequent lever press as a measure of the mouse’s apprehension
during 5-min epochs of EPM exploration (n = 16 mice per group; two-way state. On 10% shock trials, 3 out of 8 mice did not complete the trial, so the time
repeated-measures ANOVA with Bonferroni post hoc test: group (opsin) × to next lever press for some trials cannot be measured (n = 40, 40, 40 and 32
time interaction F(2,60) = 3.906, P = 0.0254; group (opsin) effect F(1,30) = 3.297, presses per group in control 0%, control 10%, ChRmine 0% and ChRmine 10%;
P = 0.0794; time effect F(2,60) = 9.75, P = 0.0002. Bonferroni post hoc: ON epoch two-way ANOVA with Bonferroni post hoc test: group (opsin) × condition
ChRmine versus control, **P = 0.0079). h, Example path trace of control (grey) (shock) interaction F(1,148) = 6.478, P = 0.0119; group (opsin) effect F(1,148) = 5.041,
and ChRmine-expressing (red) mice during an OFT with optical pacing during P = 0.0262; condition (shock) effect F(1,148) = 7.253, P = 0.0079. Bonferroni
the 3-min ON epoch of a 9-min trial. i, Time spent in the centre during 3-min post hoc: control 0% versus 10%, P > 0.9999; ChRmine 0% versus 10%,
epochs of OFT exploration (n = 5 (control), 9 (ChRmine) mice; two-way repeated- **P = 0.0026; 0% control versus ChRmine, P > 0.9999; 10% control versus
measures ANOVA with Bonferroni post hoc test: group (opsin) × time ChRmine, **P = 0.0074). Data are mean ± s.e.m.
interaction F(2,24) = 1.531, P = 0.024; group (opsin) effect F(1,12) = 5.69, P = 0.0035;
an equal proportion of time on the paced and non-paced sides of pacing, compared to control mice, preferring to remain within the
the two-chamber arena, and showed no difference in locomotion protected areas of the closed arms (Fig. 2f,g). Paced mice also avoided
compared to littermate controls—revealing that optically induced the centre area during an open field test (OFT) (Fig. 2h,i). We observed
intermittent tachycardia was not intrinsically aversive and did not no effects from illumination alone in control (opsin-negative) mice,
cause locomotor impairment (Fig. 2d,e). Optical pacing also did and baseline anxiety levels between control and virally transduced
not modulate pain perception during a hot-plate test, with paced groups were similar (Extended Data Fig. 5d–h). Increased anxiety-like
mice exhibiting comparable behavioural responses to control mice behaviour induced by optical pacing during the EPM and OFT assays
(Extended Data Fig. 5a–c). was similarly observed in female cohorts (Extended Data Fig. 5i–l).
We found that mice that received intermittent cardiac pacing within
baseline ranges (660 bpm) rather than elevated (900 bpm) ranges did
Anxiety-like state evoked by cardiac pacing not exhibit behavioural differences compared to control mice dur-
By contrast, when we tested for anxiety-related behaviour using an ing the EPM or OFT (Extended Data Fig. 5m–p). Because continuous
elevated plus maze (EPM) assay, the same mice exhibited limited ventricular pacing can have a long-lasting effect on animal health20,21,
exploration of the open (exposed) arms of the apparatus after optical we also assessed for potential changes in baseline anxiety levels and
b NS NS
c
10,000 * pIC
Control
1,000
100
TRAP cells
60 *
ChRmine
30
1
20
Control ChRmine 10
0.1 0
AUD VIS ACA PL ILA GU VISC AI P MY VERM CBN Control ChRmine
f g h
ChRmine Control ChRmine Control
pIC neuron 1 pIC neuron 2 pIC neuron 3
* *
10 10 10 0.10 0.08
* NS
*
Trials
0.04 NS
1 1 1 0.05
–5 0 5 10 –5 0 5 10 –5 0 5 10
0
ΔFiring rate (Hz)
2 10
4 0
1
2 5 –0.04
0
0 –0.05
–1 0
.
-s .
.
Po tim
tim
Po Stim
tim
Po tim
tim
–5 0 5 10 –5 0 5 10 –5 0 5 10 –5 0 5 10
S
-s
-s
st
st
st
Time from Time from Time from Time from pacing onset (s)
pacing onset (s) pacing onset (s) pacing onset (s)
pIC SS STR
Fig. 3 | Whole-brain screen for regions that are activated by optically are Fos+, determined from in situ hybridization for Fos mRNA (magenta) after
induced tachycardia. a, Schematic for whole-brain activity mapping to cardiac pacing in control and ChRmine-expressing mice in the pIC (n = 4 mice
identify regions that are activated by optically paced tachycardia. Double- per group; unpaired two-tailed t-test, *P = 0.020). Scale bars, 20 µm. d, Electrode
transgenic TRAP2;Ai14 reporter mice were injected with 4-hydroxytamoxifen tracks from n = 5 mice (3 ChRmine and 2 control) over 60 recording sessions
(4TM) and treated with optically induced tachycardia for 15 min. After two co-registered to the common Allen Brain Atlas. e, Locations of recorded single
weeks of tdTomato reporter gene expression, mice were euthanized and units overlaid onto the Allen Brain Atlas. Red denotes units in the insular cortex.
processed with CLARITY. Whole brains were imaged with a light-sheet AP, anterior–posterior. f, Spike raster and changes in firing rate for three example
microscope, followed by automated registration to a common brain atlas, cell insular neurons after 900-bpm pacing. g, Population-averaged changes in firing
segmentation and quantification to identify brain regions with differential rate of insular neurons from ChRmine (red, n = 391) or control (grey, n = 228)
accumulation of activated TRAP (tdTomato+) cells. b, Regional cell counts of mice (one-sided P values from hierarchical bootstrap: P = 0.026 (during 5 s
paced (ChRmine, red) versus control (grey) cohorts sorted from anterior to pacing); P = 0.357 (during 5 s after pacing)). h, Average change in baseline firing
posterior anatomical regions with select regions from the central autonomic rate per brain region across 5-s epochs during and after photostimulation in
network with increased TRAP cells and regions outside of the central autonomic control (grey) and ChRmine-expressing (red) mice. Single units were obtained
network without statistical significance (n = 9 per group; multiple two-sided from the pIC (n = 228 (control), n = 391 (ChRmine)); somatosensory cortex (SS;
t-tests corrected for multiple comparisons with the Benjamini and Hochberg n = 77 (control), n = 368 (ChRmine)); and striatum (STR; n = 70 (control), n = 800
method (*false discovery rate (FDR) = 10%)). Significantly activated regions (ChRmine)). One-sided P values from hierarchical bootstrap: pIC: P = 0.026
include the prefrontal cortex (ACA, PL and ILA), insular cortex (GUI, VISC and (stimulation; stim.), P = 0.36 (post-stimulation; post-stim.); SS: P = 0.0014
AI) and brainstem (P and MY). Non-significant regions include primary sensory (stim.), P = 0.16 (post-stim.); STR: P = 0.29 (stim.), P = 0.036 (post-stim.). Data
cortices (AUD, VIS) and the cerebellum (VERM, CBN). c, Percentage of cells that are mean ± s.e.m.
c YFP d iC++ e YFP iC++ f YFP iC++ g YFP iC++ h YFP iC++
0% 10% 0% 10% NS
* **** ** **** *
50 50 10 600 ** 180
50
per session
30 30 30 6
20 20 20 4
200 60
10 10 10 2
0 0 0 0 0 0
0 10 20 30 0 10 20 30 0 10 0 10 0 10 0 10 0 10 0 10 OFF ON OFF
Time (min) Time (min) Shock per session (%) Shock per session (%) Shock per session (%)
i j k l m n
YFP iC++ YFP iC++ YFP iC++ YFP iC++ YFP iC++
0% 10% 0% 10% NS **** **** 600
*** **** NS
50 50 10 16
40 40 8
30 30 6 120
30
20 20 20 4
200 60
10 10 10 2
0 0 0 0 0 0
0 10 20 30 0 10 20 30 0 10 0 10 0 10 0 10 0 10 0 10 OFF ON OFF
Time (min) Time (min) Shock per session (%) Shock per session (%) Shock per session (%)
Fig. 4 | Optogenetic inhibition of the posterior insula attenuates the during 5-min epochs of EPM exploration (n = 6 per group; two-way repeated-
anxiogenic response from optical pacing. a, Illustration of the experimental measures ANOVA with Bonferroni post hoc test: group (opsin) × time interaction
protocol for simultaneous optically induced tachycardia and optogenetic F(2,20) = 3.543, P = 0.0482; group (opsin) effect F(1,10) = 1.251, P = 0.2894; time effect
inhibition of the pIC or mPFC using AAVdj-hSyn::iC++-YFP or control virus (YFP F(2,20) = 3.058, P = 0.0694. Bonferroni post hoc: ON epoch YFP versus iC++,
only). b, Left, conditions for the Vogel conflict task, in which mice received *P = 0.0323). i,j, Cumulative lever presses with the same conditions as c,d but
both 473-nm constant illumination in the pIC or mPFC and optically induced with expression of YFP (i) or iC++ ( j) in the mPFC (n = 6 mice). k, Cumulative
tachycardia during the behavioural task. Right, illustration of the experimental number of lever presses during each session. Note that in 10% shock sessions,
protocol for simultaneous optogenetic inhibition of the pIC with optical pacing both YFP- and iC++-expressing mPFC mice cease lever pressing (n = 6 per
during the EPM test. c,d, Cumulative lever presses during baseline (day 1) and group; two-sided Wilcoxon rank-sum test, P = 0.2987). l, Average lever-pressing
10% shock (day 2) sessions for mice expressing control (YFP) (c) or iC++ (d) in rate for 0% and 10% shock sessions (n = 6 per group; two-way repeated-measures
the pIC with optical pacing (n = 6 mice per group). e, Cumulative number of ANOVA with Bonferroni post hoc test: group × condition interaction
lever presses completed in each session. Owing to increased apprehension, F(1,10) = 0.002521, P = 0.9609; group (opsin) effect F(1,10) = 0.4370, P = 0.5235;
only 1 out of 6 control mice completed the 50-lever-press session on the 10% condition (shock) effect F(1,10) = 154.1, P < 0.0001. Bonferroni post hoc: 0% shock
shock session (n = 6 per group; two-sided Wilcoxon rank-sum test, *P = 0.0152). YFP versus iC++, P > 0.9999; 10% shock YFP versus iC++, P > 0.9999; YFP 0%
f, Average lever-pressing rate for 0% and 10% shock experimental sessions. versus 10% shock, ****P = 1.1 × 10 −5; iC++ 0% versus 10% shock, ****P = 1.0 × 10 −6).
Note that iC++ inhibition partially restores overall rates of lever pressing, but m, Time to next lever press after shock (n = 30, 22, 30 and 19 presses per
not to baseline levels (n = 6 per group; two-way ANOVA with Bonferroni group in mPFC YFP 0%, YFP 10%, iC++ 0% and iC++ 10%; two-way ANOVA with
post hoc test: group × condition interaction F(1,10) = 5.533, P = 0.0405; group Bonferroni post hoc test: group (opsin) × condition (shock) interaction
(opsin) effect F(1,10) = 7.439, P = 0.0213; condition (shock) effect F(1,10) = 67.8, F(1,97) = 3.703, P = 0.05725; group (opsin) effect F(1,97) = 3.610, P = 0.0604;
P < 0.0001. Bonferroni post hoc: 0% shock YFP versus iC++, P > 0.9999; 10% condition (shock) effect F(1,97) = 54.18, P < 0.000001. Bonferroni post hoc: YFP
shock YFP versus iC++, **P = 0.0036; YFP 0% versus 10% shock, ****P < 0.0001; 0% versus 10%, ***P = 0.0009; iC++ 0% versus 10%, ****P = 2.95 × 10 −8; 0% YFP
iC++ 0% versus 10% shock, **P = 0.0039). g, Time to next lever press after shock. versus iC++, P > 0.9999; 10% YFP versus iC++, P = 0.0698). n, Time spent in open
Note that iC++ inhibition reduces apprehension to no-shock levels (n = 30, 17, arms during 5-min epochs of EPM exploration with (iC++, blue) and without
30 and 30 presses per group in YFP 0%, YFP 10%, iC++ 0% and iC++ 10%; two- (YFP, grey) mPFC inhibition (n = 6 per group; two-way repeated-measures
way ANOVA with Bonferroni post hoc test: group (opsin) × condition (shock) ANOVA with Bonferroni post hoc test: group (opsin) × time interaction
interaction F(1,103) = 8.7, P = 0.0039; group (opsin) effect F(1,103) = 8.6, P = 0.0041; F(2,20) = 0.3929, P = 0.6802; group (opsin) effect F(1,10) = 0.00039, P = 0.9846; time
condition (shock) effect F(1,103) = 35.6, P < 0.0001. Bonferroni post hoc: YFP 0% effect F(2,20) = 17.41, P < 0.0001. Bonferroni post hoc: ON epoch YFP versus iC++,
versus 10%, ****P < 0.0001; iC++ 0% versus 10%, P = 0.099; 0% YFP versus iC++, P > 0.9999).
P > 0.9999; 10% YFP versus iC++, **P = 0.0011). h, Time spent in open arms
altered haemodynamics (for example, increased heart rate variability)— or asynchronous stimulation close to baseline heart rates at 660 bpm
are associated with panic and other anxiety-related disorders52,53. The (11 Hz) did not result in anxiety-like behaviour.
altered rate, rather than the external nature of cardiac contraction tim- In further investigations of the mechanisms that underlie these
ing, appears to be important; for example, we found that intermittent behaviours, we found that optogenetic pacing activated the pIC,
Extended Data Fig. 2 | In vivo characterization of AAV9-mTNT::ChRmine- ANOVA with Bonferroni post-hoc test: F(2,4)=18.3, p = 0.0097. Post-hoc:
2A-oScarlet. a,b, Representative confocal images of ChRmine-2A-oScarlet ventricle vs. atrium p = 0.99, ventricle vs. liver p = 0.014, atrium vs liver
(red)-infected ventricular (a) and atrial (b) cardiac tissue, co-labelled with p = 0.029). f, Representative confocal image from one of two mice depicting
troponin (white), vimentin (green), and DAPI (blue). Note ChRmine expression lack of neuronal labelling in cardiac ganglia following retro-orbital delivery of
is restricted to troponin+ cardiomyocytes with no off-target labelling in AAV9-mTNT::ChRmine-p2A-oScarlet as measured by immunostaining for the
neighbouring vimentin+ fibroblasts. Scale bar=100 µm. c, Penetrance neural marker PGP9.5 (cyan). No off-target ChRmine expression was observed
of AAV9-mTNT::ChRmine-p2A-oScarlet quantified as percentage of in neurites (centre) or in the soma of cardiac ganglia (bottom). Scale bar=100 µm
troponin+ cells that express ChRmine-2A-oScarlet (n = 3). d, Specificity of (top), 20 µm (center, bottom). g,h, Representative confocal images of oScarlet
AAV9-mTNT::ChRmine-p2A-oScarlet quantified as percentage of ChRmine- (red), ChRmine mRNA (white) and nuclei (DAPI) nuclei across different organs
2A-oScarlet+ cells that are troponin+ (n = 3). e, Quantification of oScarlet (g) after 9 months of expression from one of two mice. No off-target expression
expression in ventricular and atrial cardiac tissue and liver as mean of ChRmine was observed in organs beyond the heart, including throughout
fluorescence signal (arbitrary unit) following 1 month post-injection of the brain (h). Scale bar=100 µm. Data represent mean ± s.e.m.
AAV9-mTNT::ChRmine-p2A-oScarlet (n = 3, one-way repeated-measures
Extended Data Fig. 3 | Quantification of cardiac responses to optical pacing before, during, and after light stimulation (bottom). g, Representative QRS
in vivo. a, Representative ECG recording with optical pacing at 400 bpm below complexes averaged over 100 heart beats before, during, and after pacing for
(top) or above (bottom) a resting heart rate of 400 bpm. b, Percentage of right and left ventricular stimulation. Dark grey bar indicates duration of QRS
photoactivated heart beats that track with the delivered 400 bpm optical complex. h, QRS duration before, during, and after right ventricular pacing
stimulus below or above a resting heart of 400 bpm (n = 4 (below), n = 5 (above) (n = 4 mice, one-way repeated-measures ANOVA with Bonferroni post-hoc test:
mice). c, Measured heart rate before, during, and after pacing at 400 bpm in condition F(1.01, 3.04)=25.4, p = 0.015; individual F(3,6)=0.68, p = 0.59. Post-hoc: OFF
heavily anesthetized mice with a resting heart rate below 400 bpm (n = 4 mice, vs. ON *p = 0.037, OFF vs. OFF p = 0.99). i, QRS duration before, during, and
one-way repeated-measures ANOVA with Bonferroni post-hoc test: condition after left ventricular pacing (n = 4 mice, one-way repeated-measures ANOVA
F(1.01, 3.03)=34.07, p = 0.0097; individual F(3,6)=2.4, p = 0.17. Post-hoc: OFF vs. ON with Bonferroni post-hoc test: condition F(1.18, 3.54)=121.7, p = 6.7e-4; individual
*p = 0.015, OFF vs. OFF **p = 0.002). d, Measured heart rate before, during, F(3,6)=16.64, p = 0.0026. Post-hoc: OFF vs. ON **p = 0.0038, OFF vs. OFF
and after pacing at 400 bpm in lightly anesthetized mice with a resting heart p = 0.20). j, Representative left ventricular blood pressure recordings with
rate above 400 bpm (n = 5 mice, one-way repeated-measures ANOVA with sustained optical pacing delivered at 900 bpm with 10-ms pulse width (top)
Bonferroni post-hoc test: condition F(1.06, 4.24)=3.71, p = 0.12; individual F(4,8)=5.9, with additional traces from before and after light stimulation (bottom).
p = 0.016. Post-hoc: OFF vs. ON p = 0.17, OFF vs. OFF p = 0.72). e, Representative k, Systolic blood pressure (SBP) over time with sustained 900 bpm optical
ECG recording with optical pacing delivered at 900 bpm with 10-ms pulse pacing (orange) for 30 s showing a sustained drop in SBP during stimulation
width with laser positioned at the centre of the chest to induce right ventricular (n = 3 mice). l, Representative left ventricular blood pressure recordings with
pacing (top) with additional traces from before, during, and after light intermittent optical pacing delivered at 900 bpm with 10-ms pulse width for
stimulation (bottom). f, Representative ECG recording with optical pacing 500 ms every 1,500 ms (top) with additional traces during light stimulation
delivered at 900 bpm with 10-ms pulse width with laser positioned more lateral (bottom). m, Averaged SBP over the interval of optical stimulation (500 ms ON
of the chest to induce left ventricular pacing (top) with additional traces from at 900 bpm, 1,500 ms OFF) (n = 3 mice). Data represent mean ± s.d.
Article
Extended Data Fig. 4 | Characterization of the wearable micro-LED vest. pacing to induce a stable heart rhythm (n = 6 mice). f, Representative ECG
a, Schematic of optical pacing vest. b, Photographs of freely moving mouse recording from one mouse receiving 900-bpm stimulation for 10 min (top)
wearing optical pacing vest while receiving 591 nm light stimulation. c, Heating with additional traces from before, during, and after light stimulation (bottom).
of device operated at 900 bpm with 10-ms pulse width at varying duty cycles g, Representative QRS complexes averaged over 100 heart beats before, during
(n = 3 devices, 25% (500 ms ON, 1,500 ms OFF), 50% (1 s ON, 1 s OFF), 100% and after pacing. h, QRS duration before, during and after right ventricular
(constant ON)). d, Percentage of photoactivated QRS complexes as a function pacing (n = 5 mice, one-way repeated-measures ANOVA with Bonferroni post-
of irradiance using the micro-LED device (n = 5). e, Measured heart rate across hoc test: condition F(1.03, 4.10)=13.74, p = 0.02; individual F(4,8)=1.83, p = 0.21. Post-
time over a 10 min stimulation period (900 bpm) showing ability of optical hoc: OFF vs. ON *p = 0.024, OFF vs. OFF p = 0.88). Data represent mean ± s.e.m.
Extended Data Fig. 5 | See next page for caption.
Article
Extended Data Fig. 5 | Additional characterization of optical-pacing effects increased heart rate variability can affect anxiety-like behaviour, we introduced
on mouse behaviour. a–c, A hot-plate test was performed to assess for constant 660 bpm stimulation with a Poisson distribution in mice and measured
potential effects on thermal pain thresholds from optical pacing (n = 17 the time spent in the centre during the OFT (n = 12 (control) and 14 (ChRmine)
(control), 16 (ChRmine)) and the following were quantified: time to first rear mice, two-way repeated-measures ANOVA with Bonferroni post-hoc test:
(unpaired two-tailed t-test, p = 0.53) (a); rears per minute (unpaired two-tailed group (opsin) x time interaction F(2,48)=1.29, p = 0.28; group (opsin) effect
t-test, p = 0.64) (b); and time to first jump (unpaired two-tailed t-test, p = 0.22) F(1,24)=5.80, p = 0.024; time effect F(1.36,32.6)=0.47, p = 0.55. Post-hoc ChRmine vs
(c). Note no statistical significance in thermal thresholds was observed with Control: OFF p = 0.61, ON p = 0.28, OFF p = 0.12) (m); and the time spent in the
cardiac pacing. d–f, To assess behavioural differences between control and open arms during the EPM (n = 14 (control) and 14 (ChRmine) mice, two-way
virally transduced ChRmine-expressing mice, the following comparisons were repeated-measures ANOVA with Bonferroni post-hoc test: group (opsin) x time
performed: time spent in one chamber during baseline day (no light delivery) interaction F(2,52)=1.75, p = 0.18; group (opsin) effect F(1,26)=3.3, p = 0.082; time
(n = 16 per group, unpaired two-tailed t-test p = 0.21) (d); time spent in the open effect F(1.84,47.8)=5.157, p = 0.011. Post-hoc ChRmine vs Control: OFF p = 0.25, ON
arm of the EPM test during the first 5-min epoch with no light delivery (n = 16 p = 0.20, OFF p = 0.99) (n). o,p, To determine whether intermittent tachycardia
per group, unpaired two-tailed t-test p = 0.61) (e); and time spent in the centre at a rhythm below 900 bpm can affect anxiety-like behaviour, we introduced
of the OFT during the first 3-min epoch with no light delivery (n = 5 (control), 9 intermittent 660 bpm stimulation (10-ms pulse width, 660 bpm for 500 ms
(ChRmine), unpaired two-tailed t-test p = 0.15) (f). Note no statistical significance every 2 s) in mice and measured the time spent in the centre during the OFT
in behaviour was observed from viral-transfection. g,h, To assess for effects of (n = 6 (control) and 10 (ChRmine) mice, two-way repeated-measures ANOVA
light stimulation alone on mouse behaviour, the following comparisons were with Bonferroni post-hoc test: group (opsin) x time interaction F(2,28)=0.13,
performed: time spent in the open arms by control (saline injected) mice p = 0.88; group (opsin) effect F(1,14)=0.25, p = 0.63; time effect F(2,28)=1.1, p = 0.35.
during the 15 min EPM assay, where intermittent light delivery (10-ms pulse Post-hoc ChRmine vs Control: OFF p = 0.99, ON p = 0.99, OFF p = 0.99) (o);
width, 900 bpm for 500 ms every 2 s) was delivered during the 5 min ON epoch and the time spent in the open arms during the EPM (n = 6 (control) and 10
(n = 16, one-way repeated-measures ANOVA with Bonferroni post-hoc test: (ChRmine) mice, two-way repeated-measures ANOVA with Bonferroni post-hoc
condition F(1.44,21.62)=2.942, p = 0.088, individual F(15,30)=1.61, p = 0.13. Post-hoc: test: group (opsin) x time interaction F(2,28)=0.52, p = 0.60; group (opsin) effect
OFF vs. ON p = 0.99, OFF vs. OFF p = 0.9, ON vs. OFF p = 0.27) (g); and time spent F(1,14)=0.03, p = 0.86; time effect F(2,28)=2.23, p = 0.12. Post-hoc ChRmine vs
in the centre by control mice during the 9 min OFT, where intermittent light Control: OFF p = 0.99, ON p = 0.99, OFF p = 0.99) (p). q, Schematic overview of
delivery was delivered during the 3 min ON epoch (n = 5, one-way repeated- the chronic stimulation experiment. Mice were stimulated with intermittent
measures ANOVA with Bonferroni post-hoc test: condition F(1.84,7.45)=1.67, optical pacing (900 bpm for 500 ms every 2 s) for 1 h every other day for two
p = 0.25, individual F(4,8)=1.51, p = 0.29. Post-hoc: OFF vs. ON p = 0.99, OFF vs. weeks before performing the OFT and EPM behavioural assays. r, Time spent
OFF p = 0.99, ON vs. OFF p = 0.41) (h). Note no statistical significance in in open arm during the EPM test for control (grey) and ChRmine (red) mice
behaviour was observed from light stimulation alone. i,j, To assess for effects subjected to chronic optical stimulation (n = 6 (control) and 9 (ChRmine) mice,
from optical pacing (10-ms pulse width, 900 bpm for 500 ms every 2 s) on two-way repeated-measures ANOVA with Bonferroni post-hoc test: group
anxiety-like behaviour in female mice, the following behavioural assays were (opsin) x time interaction F(2,26)=0.87, p = 0.43; group (opsin) effect F(1,13)=0.71,
measured: time spent in the open arms during the EPM (n = 8 (control) and 7 p = 0.41; time effect F(1.65,21.4)=0.96, p = 0.38. Post-hoc ChRmine vs Control:
(ChRmine) female mice, two-way repeated-measures ANOVA with Bonferroni 0–5 min p = 0.99, 5–10 min p = 0.89, 10–15 min p = 0.84). s, Time spent in centre
post-hoc test: group (opsin) x time interaction F(2,26)=1.91, p = 0.17, group (opsin) during the OFT test for control (grey) and ChRmine (red) mice subjected to
effect F(1,13)=5.1, p = 0.042; time effect F(2,26)=4.24, p = 0.026. Bonferroni post- chronic optical stimulation (n = 6 (control) and 9 (ChRmine) mice, two-way
hoc: ON epoch ChRmine vs Control *p = 0.033) (i); and time spent in the centre repeated-measures ANOVA with Bonferroni post-hoc test: group (opsin) x time
during the OFT (n = 7 (control) and 7 (ChRmine) female mice, two-way repeated- interaction F(2,26)=0.25, p = 0.78; group (opsin) effect F(1,13)=0.097, p = 0.76; time
measures ANOVA with Bonferroni post-hoc test: group (opsin) x time effect F(1.78,23.2)=0.49, p = 0.60. Post-hoc ChRmine vs Control: 0–3 min p = 0.99,
interaction F(2,24)=0.37, p = 0.70; group (opsin) effect F(1,12)=7.47, p = 0.018; time 3–6 min p = 0.99, 6–9 min p = 0.99). t, Average velocity (cm/s) of mice in the OFT
effect F(2,24)=6.9, p = 0.0043. Post-hoc: ON epoch ChRmine vs Control *p = 0.031) test for control (grey) and ChRmine (red) mice subjected to chronic optical
( j). k,l, To determine whether cardiac pacing was aversive in female mice, we stimulation (n = 6 (control) and 9 (ChRmine) mice, two-way repeated-measures
also measured the percentage of time spent on baseline and stimulation day for ANOVA with Bonferroni post-hoc test: group (opsin) x time interaction
control (grey) and ChRmine-expressing (red) mice during the RTPP assay (n = 7 F(2,26)=0.29, p = 0.78; group (opsin) effect F(1,13)=0.005, p = 0.94; time effect
female mice per group, two-way repeated-measures ANOVA with Bonferroni F(1.34,17.4)=17.3, p = 2.6e-4. Post-hoc ChRmine vs Control: 0–3 min p = 0.99,
post-hoc test: group (opsin) x treatment interaction F(1,12)=0.68, p = 0.42; group 3–6 min p = 0.99, 6–9 min p = 0.99). u, Total distance travelled (cm) mice during
(opsin) effect F(1,12)=0.11, p = 0.91; treatment effect F(1,12)=0.35, p = 0.57. Post-hoc: the OFT test for control (grey) and ChRmine (red) mice subjected to chronic
Baseline vs Stimulation for Control: p = 0.67, ChRmine: p = 0.99) (k); and the optical stimulation (n = 6 (control) and 9 (ChRmine) mice, two-way repeated-
average velocity on the optically paced side during RTPP (n = 7 female mice per measures ANOVA with Bonferroni post-hoc test: group (opsin) x time
group, two-way repeated-measures ANOVA with Bonferroni post-hoc test: interaction F(2,26)=0.29, p = 0.75; group (opsin) effect F(1,13)=0.005, p = 0.94; time
group (opsin) x treatment interaction F(1,12)=0.088, p = 0.77; group (opsin) effect F(1.34,17.4)=17.3, p = 2.6e-4. Post-hoc ChRmine vs Control: 0–3 min p = 0.99,
effect F(1,12)=3.69, p = 0.079; treatment effect F(1,12)=0.12, p = 0.73. Post-hoc: 3–6 min p = 0.99, 6–9 min p = 0.99). Data represent mean ± s.e.m.
Stimulation day Control vs Chrmine: p = 0.59) (l). m,n, To determine whether
Extended Data Fig. 6 | Operant lever-pressing task at higher risk of shock. mice per group, Two-tailed t-test, *p = 0.0367). c, Cumulative lever presses
a, Cumulative lever presses during 20% shock session for control (grey) and during 30% shock session. d, Lever-pressing rate averaged across the entire
ChRmine-expressing (red) mice (n = 8 mice per group). Experiment was 30% shock trial session (n = 8 mice per group, Two-tailed t-test, p = 0.7663).
performed otherwise identically to the behaviour described in Fig. 2. Data represent mean ± s.e.m.
b, Lever-pressing rate averaged across the entire 20% shock trial session (n = 8
Article
Extended Data Fig. 7 | Generation of brain-wide activity maps during (MY), and in the lateral amygdalar nucleus (LA), which are outlined in green in
optical pacing. a, Representative whole-brain CLARITY sagittal (top) and axial the axial reference slice. Scale bar=500 µm. e, Regional cell counts of paced
(bottom) images of control and ChRmine expressing mice exposed to optical (ChRmine, red) vs control (grey) cohorts sorted from anterior to posterior in all
pacing. Heart-targeted ChRmine expression resulted in increased tdTomato+ anatomical regions (n = 9 per group, multiple two-sided t-tests corrected for
cells throughout the brain (seen as black dots) relative to control. b, Following multiple comparisons with the Benjamini and Hochberg method (*FDR=10%).
light-sheet imaging, each image stack was registered to a common Allen p-values: MO p = 0.025, SS p = 0.038, AUD p = 0.082, VIS p = 0.31, ACA p = 0.050,
Reference Atlas using our previously reported computational pipeline40. PL p = 0.027, ILA p = 0.0086, ORB p = 0.012, GU p = 0.013, VISC p = 0.018, AI
Depicted are coronal slices across the brain with the overlaid anatomical atlas, p = 0.016, RSP p = 0.20, TEA p = 0.11, PERI p = 0.074, ECT p = 0.10, OLF p = 0.017,
where different anatomical regions are depicted with different colours. HIP p = 0.10, RHP p = 0.052, CLA p = 0.092, EP p = 0.035, LA p = 0.028, BLA
c, Representative raw image of single plane of TRAP2-tdTomato brain imaged p = 0.051, BMA p = 0.036, PA p = 0.043, STRd p = 0.029, STRv p = 0.015, LSX
under light-sheet microscope (left), and after detection by a supervised p = 0.012, sAMY p = 0.037, PALd p = 0.036, PALv p = 0.033, PALm p = 0.024, PALc
classifier (Ilastik, Arivis plugin), where single-cells are outlined in red (right, p = 0.012, DORsm p = 0.16, DORpm p = 0.095, PVZ p = 0.016, PVR p = 0.020,
bottom). Blue arrows indicate example features that were detected by the MEZ p = 0.029, LZ p = 0.033, MB p = 0.28, P p = 0.030, MY p = 0.054, VERM
classifier. d, Example CLARITY light-sheet images of control and ChRmine- p = 0.50, HEM p = 0.043, CBN p = 0.92). Acronyms for each major brain region is
paced mice in the visceral cortex (VISC), Medulla-behavioural state related listed.
Extended Data Fig. 8 | Optically induced tachycardia increases Fos mRNA induction in these vagal sensory neurons by the cardiac signals (n = 4, control
expression in brain regions associated with the central autonomic 0.96% ± 0.7; ChRmine 5.29% ± 1.6, unpaired two-tailed t-test, p = 0.04).
network. a,b, Percentage of cells that are Fos+ determined from in situ c, Confocal images of the locus coeruleus stained for Fos (magenta), the
hybridization for Fos mRNA (magenta) following cardiac pacing in control norepinephrine transporter Slc6a2 (yellow) and DAPI (blue). d, Quantification
and ChRmine-expressing mice in the nucleus of the solitary tract (NTS) (a) and of neurons that express Slc6a2 that also co-localize with Fos during optical
in the locus coeruleus (LC) (b) (n = 4 mice per group, unpaired two-tailed pacing (n = 4 mice per group, unpaired two-tailed t-test: ****p = 1.0e-7). Scale
t-test, ***p = 0.00029 (NTS), **p = 0.0027). We have also performed in situ bar=20 µm. Data represent mean ± s.e.m.
hybridization for Fos mRNA in the nodose ganglion and observed potential
Article
Extended Data Fig. 9 | Behavioural and physiological effects from conflict task with elevated chance of shock (30%) while wearing the optical
inhibition of the posterior insula. a, Mice were evaluated on the EPM with iC++ pacing vest but without receiving cardiac stimulation. Optogenetic inhibition
inhibition only during the “ON” epoch, with no optical pacing vest (n = 6 mice was performed during the entire duration of the 30 min trial. c, Individual traces
per group; two-way repeated-measures ANOVA: group (opsin) x time of lever presses during shock day with 30% chance of shock and bilateral pIC
interaction F(2,20)=2.569, p = 0.1016; group (opsin) effect F(1,10)=0.0392, inhibition (n = 6 mice per group). d, Lever-pressing rate averaged across entire
p = 0.8470; time effect F(2,20)=0.1486, p = 0.8629). Note inhibition of pIC did not 30% shock session (n = 6 mice per group). e, Heart rate as a function of time
significantly alter time spent in the open arms of the EPM. b, Schematic during pIC inhibition (blue) (n = 3 mice per group). Data represent mean ± s.e.m.
overview of the pIC inhibition experiment. Mice were evaluated on the Vogel
Article
https://doi.org/10.1038/s41586-023-05750-0 Katherine R. Hummels1, Samuel P. Berry2, Zhaoqi Li1, Atsushi Taguchi1,3, Joseph K. Min2,
Suzanne Walker1, Debora S. Marks2 & Thomas G. Bernhardt1,4 ✉
Received: 16 July 2021
The biosynthetic pathways for phospholipids, PG and LPS in Gram- aeruginosa and interaction partners were identified following affin-
negative bacteria rely on shared precursor pools (Fig. 1a). Therefore, ity purification. PaMurA and PA4701 were the only proteins enriched
flux through each pathway must be balanced to prevent overconsump- with H–PaLpxC but not H–EcLpxC (Supplementary Table 1). PA4701 is
tion of essential precursors by a single pathway4–6. LPS biosynthesis a non-essential protein (Extended Data Fig. 3a) of unknown function,
requires both UDP-N-acetylglucosamine (UDP-GlcNAc) and acyl-ACP whereas PaMurA is the essential committed enzyme for PG synthe-
molecules that are also used for PG and phospholipid biosynthesis, sis11,12 (Fig. 1a and Extended Data Fig. 3b,c). We focused on the PaMurA–
respectively6,7. Additionally, overproduction of LPS results in the PaLpxC interaction and validated it using in vivo pulldown assays
toxic accumulation of LPS intermediates in the inner membrane8. Flux with H–PaLpxC and N-terminally Flag-tagged PaMurA (F–PaMurA;
through the LPS pathway must therefore be tightly regulated. Extended Data Fig. 4a). Notably, the co-purification was enhanced
Enterobacteria such as Escherichia coli control LPS synthesis when cells were treated with the LpxC inhibitor CHIR-090, suggest-
through regulated proteolysis of the committed enzyme, EcLpxC, ing that the drug-bound LpxC enzyme may have a greater affinity for
by FtsH4,9. Previous studies of LpxC in P. aeruginosa (PaLpxC), how- MurA (Extended Data Fig. 4a). Purified His-tagged PaMurA (H–PaMurA;
ever, showed that it was not proteolysed10. Accordingly, N-terminally Extended Data Fig. 5a) was also specifically pulled down by Flag-tagged
His-tagged PaLpxC (H–PaLpxC) accumulated normally in an PaLpxC (F–PaLpxC) using anti-Flag resin, indicating that the interaction
ftsH-deletion mutant (Extended Data Fig. 1a). Thus, LPS biogenesis was direct (Extended Data Fig. 4b). Purified F–PaLpxC and H–PaMurA
in P. aeruginosa seems to be regulated through a mechanism distinct were subjected to size-exclusion chromatography (SEC) individually
from that in enterobacteria. or as 1:1 mixtures with or without CHIR-090. In the mixed sample, a
large proportion of protein eluted at a volume corresponding to the
heterodimer of F–PaLpxC and H–PaMurA (Fig. 1b). Consistent with the
PaLpxC is activated by PaMurA pulldown assays, re-application of the heterodimer fractions to the SEC
The overproduction of H–EcLpxC but not H–PaLpxC inhibited growth column showed that the complex remained most stable in the presence
of P. aeruginosa and increased cellular levels of LPS (Extended Data of CHIR-090 (Fig. 1b). Notably, H–PaMurA stimulated the enzymatic
Figs. 1b and 2a), suggesting that PaLpxC is regulated in P. aeruginosa activity of F–PaLpxC (Fig. 1c). This stimulation was specific to PaMurA
cells through a mechanism ineffective against EcLpxC. To identify pos- as the addition of H–EcMurA had no effect (Fig. 1c). We conclude that
sible regulatory factors, H–PaLpxC or H–EcLpxC was produced in P. PaMurA is a direct and specific activator of PaLpxC in vitro.
Department of Microbiology, Blavatnik Institute, Harvard Medical School, Boston, MA, USA. 2Department of Systems Biology, Blavatnik Institute, Harvard Medical School, Boston, MA, USA.
1
SANKEN (The Institute of Scientific and Industrial Research), Osaka University, Ibaraki, Japan. 4Howard Hughes Medical Institute, Boston, MA, USA. ✉e-mail: thomas_bernhardt@hms.harvard.edu
3
mAU
CHIR-090 LpxC MurB 4
0
UDP-MurNAc 2
8 8
PaMurA
mAU
LPS PG 4 4
c 2.5 * 0 0
(×109 TIC LpxC product min–1 mg–1)
10
2.0
10
PaMurA +
mAU
5 PaLpxC
LpxC activity
1.5 5
0 0
1.0
1.5 1
PaMurA +
0.5 1.0 0 PaLpxC
mAU
shifted
0.5 –1 fractions
0 0 –2
14 15 16 17 14 15 16 17
dn
T)
T)
D)
K)
7S
ad
06
58
11
A(
A(
E4
G
o
ur
N
A(
A(
A(
M
ur
55 kDa
ur
55 kDa
ur
Pa
Ec
M
M
Pa
Pa
Pa
+ PaLpxC
Fig. 1 | PaMurA interacts with and activates PaLpxC. a, Schematic followed by Coomassie staining. Dotted lines indicate the peak mobilities
representation of the biosynthetic pathways responsible for PG and LPS for F–LpxC (gold), H–MurA (cyan) or the shifted F–LpxC + H–MurA fractions
biosynthesis, showing the committed enzymes MurA and LpxC, and other (black) in the presence of CHIR-090. The mobilities of H–MurA and F–LpxC in
relevant enzymes (LpxA and MurB). T-bars indicate inhibition by the antibiotics SDS–PAGE assays are indicated by a cyan or gold arrowhead, respectively. Data
fosfomycin and CHIR-090. The green arrow indicates activation of LpxC by are representative of two replicates. For gel source data, see Supplementary
MurA. b, Size-exclusion chromatography in which 7.5 µM of purified F–LpxC Fig. 1. c, Catalytic activity (total ion counts (TIC)) of purified PaLpxC (100 nM)
and H–MurA were resolved either individually or as a mixture in the presence or alone (no addition (No addn)) or in the presence of MurA variants (100 nM).
absence of 37.5 µM CHIR-090 as indicated. The shifted F–LpxC + H–MurA Dots indicate the values obtained for three individual replicates, bars indicate
fractions were subsequently collected, resubjected to size-exclusion the mean, and error bars represent their standard deviation. *P = 0.0109
chromatography, and the resulting fractions were resolved by SDS–PAGE (unpaired, two-tailed t-test).
We reasoned that if PaMurA is an essential activator of PaLpxC in levels to stimulate LPS synthesis on PaMurA overexpression. These
P. aeruginosa cells, then PaMurA depletion should result in a pheno- scenarios predict that the overproduction of catalytically inactive or
type that resembles the simultaneous inactivation of both essential conformationally trapped PaMurA variants should cause lethal levels
enzymes. Cells treated with the MurA inhibitor fosfomycin have a PG of LPS production. We therefore searched for toxic PaMurA variants.
synthesis inhibition phenotype involving membrane bleb formation P. aeruginosa was transformed with a plasmid encoding mutagen-
and lysis11 (Extended Data Fig. 3d–f). However, cells depleted of PaMurA ized PamurA under the control of an isopropyl-β-d-thiogalactoside
instead adopted an enlarged, ovoid shape (Extended Data Fig. 3e,f). (IPTG)-regulated promoter. The resulting library was pooled and grown
This phenotype resembled that of cells treated with both CHIR-090 and in liquid medium with inducer. Plasmids that caused lysis were purified
fosfomycin (Extended Data Fig. 3d–f), suggesting that PaMurA deple- from the culture supernatant, and the PamurA genes from those causing
tion impairs the synthesis of both PG and LPS. Accordingly, PaMurA an IPTG-dependent growth defect on retransformation were sequenced.
depletion reduced LPS levels, whereas depletion of the next enzyme Twenty-three toxic PaMurA variants (designated PaMurA*) were
in the pathway, PaMurB, did not (Extended Data Figs. 2b and 3b,c) and identified (Fig. 2a and Extended Data Fig. 6a). Their growth inhibitory
instead caused a terminal phenotype resembling that following fosfo- activity was alleviated by a normally lethal concentration of CHIR-090,
mycin treatment (Extended Data Fig. 3d–f). We conclude that PaMurA suggesting that they hyperactivate PaLpxC (Extended Data Fig. 6a). The
is required for the biosynthesis of normal cellular levels of LPS. amino acid changes in the PaMurA* variants mapped around the active
site of the enzyme14 (Extended Data Fig. 6b) and included the catalytic
cysteine residue (C117) that forms a covalent intermediate with the
PaMurA has two essential functions phosphoenolpyruvate substrate15. A subset of PaMurA* variants were
Overproduction of wild-type (WT) PaMurA did not increase LPS levels purified (Extended Data Fig. 5a) and found to have markedly reduced
as expected for an activator of PaLpxC (Extended Data Fig. 2c). We enzymatic activity while retaining their ability to activate purified
suspected this result might be due to the enzymatic activity of PaMurA PaLpxC (Extended Data Fig. 6c,d).
competing with the LPS pathway for UDP-GlcNAc (Fig. 1a) thereby pre- The equivalent of the C117S substitution in PaMurA has been well
venting runaway LPS synthesis. Alternatively, a particular MurA con- characterized in other orthologues in which it has been shown to
former13 may be the activator and it may not be produced in sufficient trap the enzyme in a closed conformation bound to its product16,17.
T
AW
pt
11
m
AC
am
ur
c
la
am
P
PamurAC117S allele, but not the murA deletion (Extended Data Fig. 8d).
-P
-P
E406
c
la
P
Interaction score
35 kDa F–XspLpxC (bait)
55 kDa
H–LpnMurA (prey)
F–LpnLpxC (bait)
35 kDa
55 kDa
H–AbaMurA (prey)
M. kuznetsovii
F–AbaLpxC (bait)
35 kDa
55 kDa
H–EcMurA (prey)
Fig. 3 | Direct interaction between LpxC and MurA is observed in diverse or absence of CHIR-090 (5.7 µM) as indicated. The mixtures were pulled down
bacteria. a, MurA–LpxC interaction scores calculated from a direct coupling with anti-Flag resin and the input and eluate were subjected to SDS–PAGE and
analysis-based approach (Methods) plotted on a maximum-likelihood Coomassie staining. Mobilities of H–MurA and F–LpxC are indicated by a cyan
phylogenetic tree based on concatenated MurA and LpxC sequences generated or gold arrowhead, respectively. Data are representative of at least two
with FastTree. Experimentally tested interactions are highlighted. b, Purified replicates. For gel source data, see Supplementary Fig. 1.
F–LpxC (2.5 µM) was mixed in a 1:1 ratio with purified H–MurA in the presence
Extended Data Fig. 1 | Regulation of LpxC in P. aeruginosa differs from that supplemented with arabinose and/or the LpxC inhibitor CHIR-090 as
observed in E. coli. (a) Anti-His immunoblot detecting H-Pa LpxC expressed indicated. Plates were incubated at 37 °C for 20 h before being imaged. Data
from the native chromosomal locus in wild-type cells or an ftsH deletion are representative of 3 biological replicates. (c) Anti-His immunoblot analysis
mutant. A corresponding blot for RpoA was used as a loading control. Data are of His-PaLpxC or His-EcLpxC protein levels in exponentially growing PAO1.
representative of 3 biological replicates. (b) Spot titer assay in which serial Immunoblot for RpoA serves as a loading control. Data are representative of
dilutions of PAO1 harboring an empty plasmid or one encoding His-PalpxC or 3 biological replicates. For gel source data, see Supplementary Fig. 1.
His-EclpxC under arabinose-inducible control were plated on LB agar
Extended Data Fig. 2 | LPS levels are altered upon mis-regulation of LpxC. the presence or absence of 1 mM IPTG as indicated before samples were
Silver stain of LPS harvested from exponentially growing cultures and western processed. (C) PAO1 harboring an empty plasmid or one encoding PamurA(WT)
blot of RpoA from the same samples as a loading control. (a) PAO1 harboring an or PamurA(C117S) under IPTG-inducible control were induced with 1 mM IPTG 1 h
empty plasmid or one encoding PalpxC or EclpxC under arabinose-inducible prior to harvesting samples. Data are representative of 3 biological replicates.
control were induced with 0.1% arabinose 1 h prior to harvesting samples. For gel source data, see Supplementary Fig. 1.
(b) PAO1, PA1118 [∆murA Plac-murA], or PA1135 [∆murB Plac-murB] were grown in
Article
Extended Data Fig. 3 | MurA is essential and its depletion phenocopies absence of inducer as indicated. MurB depletion was analyzed as a control to
simultaneous inhibition of PG and LPS biosynthesis. (a–c) Growth curves compare the phenotype of inactivating another early step in PG synthesis
of P. aeruginosa strains in LB with or without IPTG as indicated. Dots represent with that of MurA. Scale bar indicates 2 µm. Data are representative of at least
the average of 3 biological replicates and dashed lines indicate the standard 3 biological replicates (f) Quantification of cell width after 1 hr treatment
deviation. The following strains were used: (a) PAO1 [WT] and PA1080 [∆PA4701], with the indicated antibiotic(s) or after depletion of MurA or MurB. Each dot
(b,c) PAO1 [WT], PA1118 [∆murA Plac-murA], and PA1135 [∆murB Plac-murB]. represents an individual cell and the median of the population is indicated by
(d) Phase contrast images of P. aeruginosa cells after 1 hr treatment with the a black line. n indicates the number of cells analyzed. For each condition,
indicated antibiotic(s). Scale bar indicates 2 µm. Data are representative of the cells quantified were derived from a single population and data are
at least 2 biological replicates (e) Phase contrast images of the indicated representative of biological duplicates.
P. aeruginosa murA or murB depletion strains grown for 4 h in the presence or
Extended Data Fig. 4 | PaMurA interacts with PaLpxC. (a) H-PaLpxC in vivo PA1071 (lanes 4 and 6), and PA1121 (lanes 5 and 7). Data are representative of at 3
pulldowns. The expression status of H-PaLpxC and F-Pa MurA before (input) and biological replicates. (b) Purified F-Pa LpxC (2.5 µM) was mixed in a 1:1 ratio with
after (elution) co-affinity purification using Ni-NTA resin is indicated above purified H-MurA variants in the presence or absence of CHIR-090 (5.7 µM) as
the immunoblots. The variant of F-Pa MurA produced is indicated by WT for indicated. The mixtures were pulled down with anti-FLAG resin and the input
F-Pa MurA(WT) or * for F-Pa MurA(C117S). When indicated, 0.5 µg/mL CHIR-090 and elution subjected to SDS-PAGE and Coomassie staining. Mobilities of
was added to cultures 1 hr prior to harvesting and was maintained in all lysis and H-MurA and F-LpxC are indicated by a cyan or gold carrot, respectively. Data are
wash buffers as detailed in the methods section. The following strains were representative of 3 replicates. For gel source data, see Supplementary Fig. 1.
used to generate the lysates: PA239 (lane 1), PA1013 (lane 2), PA1068 (lane 3),
Article
Extended Data Fig. 5 | Purified proteins used in this study and linearity of Fig. 1. (b) Time course in which turnover of UDP-3-O-(R-3-hydroxydecanoyl)-N-
LpxC activity assay. (a) Purified proteins used in this study were resolved by acetylglucosamine (Pa LpxC substrate) to UDP-3-O-(R-3-hydroxydecanoyl)-
SDS-PAGE and protein was visualized with Coomassie staining. Data are glucosamine (Pa LpxC product) by FLAG-PaLpxC over the course of 20 min was
representative of at least two 2 replicates. For gel source data, see Supplementary monitored by LC-MS. The R 2 value of the linear regression is presented.
Extended Data Fig. 6 | Mutations in the PaMurA active site are toxic but can measured by Lanzetta assay. Dots indicate the values obtained for three
be suppressed by inhibition of PaLpxC. (a) Spot titer assay in which serial individual replicates, bars indicate the mean, and error bars represent their
dilutions of PAO1 harboring an empty vector, one encoding Pa MurA(WT) or the standard deviation. (d) Catalytic activity of purified Pa LpxC (100 nM) alone or in
indicated Pa MurA variant were plated on LB agar supplemented with IPTG and/ the presence of MurA variants (100 nM) assayed by conversion of UDP-3-O-(R-
or CHIR-090 as indicated. Plates were incubated at 37 °C for 20 h before imaging. 3-hydroxydecanoyl)-N-acetylglucosamine (Pa LpxC substrate) to UDP-3-O-(R-
†
indicates the presence of a silent mutation in the construct. See Table S2 for 3-hydroxydecanoyl)-glucosamine (Pa LpxC product). Dots indicate the values
details. Data are representative of 3 biological replicates. (b) Crystal structure of obtained for three individual replicates, bars indicate the mean, and error bars
E. cloacae MurA (PDB 1EJC)14 in which residues corresponding to the identified represent their standard deviation. (e) LpxC enzymatic activity detected from
Pa
MurA dominant negative alleles are depicted in gold spheres, or in the case of preparation of MurA variants (100 nM) alone assayed as in panel d. Dots indicate
Cys117, a red sphere. Note that the substitutions all cluster around the active the values obtained for three individual replicates, bars indicate the mean, and
site. (c) MurA activity assay in which purified PaMurA variants (100 nM) were error bars represent their standard deviation.
mixed with UDP-GlcNAc (1 mM) and PEP (0.5 mM) and the release of Pi was
Article
Extended Data Fig. 7 | LC-MS/MS analysis of PaLpxC substrate and product. The parent ion is indicated by an asterisk and fragment ions corresponding to
(a) Chemical structure of the PaLpxC substrate. The acetyl moiety removed by those highlighted in panel a are labeled. (e-g) EICs PaLpxC product and PaLpxC
LpxC is highlighted in gold. Boxed regions indicate putative fragment ions substrate detected by LC-MS in the aqueous fraction of methanol-chloroform
highlighted in panels c, d, and h-j. (b) Extracted ion chromatogram (EIC) of extracted whole cell lysates. The dashed lines indicate the peak assigned to the
UDP-3-O-(R-3-hydroxydecanoyl)-N-acetylglucosamine (PaLpxC substrate, Pa
LpxC substrate (S) and PaLpxC product peaks (P1 and P2). Note that the PaLpxC
776.1986 m/z, black line) and UDP-3-O-(R-3-hydroxydecanoyl)-glucosamine product has been previously reported to resolve as two peaks43, both of
(PaLpxC product, 734.1872 m/z, gold line) derived from in vitro reaction which were integrated to infer the relative product abundance. Data are
mixtures containing the PaLpxC substrate along with purified PaLpxC and representative of biological triplicates. (h-j) MS/MS spectrum associated with
Pa
MurA resolved using LC-MS operating in negative mode. The dashed lines the panel g peaks S, P1, and P2, respectively. The parent ion is indicated by an
indicate the peaks assigned to the PaLpxC substrate (S) and PaLpxC product (P). asterisk and fragment ions corresponding to those highlighted in panel a are
(c—d) MS/MS spectrum associated with the panel b peaks S and P, respectively. labeled.
Extended Data Fig. 8 | MurA(G58D) and MurA(E406K) impact binding and F-PaLpxC and H-MurA variants were mixed in a 1:1 ratio in the presence or
activation of PaLpxC. (a) Anti-FLAG immunoblot detecting F-Pa MurA variants absence of CHIR-090 and processed as in Extended Data Fig. 4b. Data are
after 1 h of induction with 1 mM IPTG. A corresponding blot for RpoA was used representative of at least two replicates. (d) Spot titer assay in which serial
as a loading control. Data are representative of 3 biological replicates. (b) MurA dilutions of a PAO1 strain harboring a PamurA deletion or PamurA(C117S) allele
activity assay in which purified PaMurA variants (100 nM) were mixed with at the native locus complemented by a chromosomally-integrated, IPTG-
UDP-GlcNAc (1 mM) and PEP (0.5 mM) and the release of Pi was measured by inducible copy of PamurA(WT) were plated on LB agar with the indicated
Lanzetta assay. Dots indicate the values obtained for three individual supplements. As indicated, the strains also contained an empty plasmid or
replicates, bars indicate the mean, and error bars represent their standard one encoding PamurA(G58D) under arabinose-inducible control. Plates were
deviation. The dashed line indicates the average catalytic activity of incubated at 37oC for 20 h before being photographed. Data are representative
Pa
MurA(C117S) observed in Fig S7C. (c) in vitro pulldowns in which purified of 3 biological replicates. For gel source data, see Supplementary Fig. 1.
Article
Extended Data Fig. 9 | PaLpxC and PaMurA are predicted to interact. (a,b) indicating the presence of a population with low interaction scores (blue line)
AlphaFold2 predicted aligned error matrices of the PaLpxC/PaMurA complex and high interaction scores (orange line). (f) Catalytic activity of purified
and EcLpxC/EcMurA complex structures, respectively. (c) Distribution of Lpn
LpxC (100 nM) alone or in the presence of LpnMurA (200 nM) assayed by
initial interaction scores among all LpxC and MurA pairs analyzed. Red bars conversion of UDP-3-O-(R-3-hydroxydecanoyl)-N-acetylglucosamine to UDP-
indicate the sequences used to train the final EVcomplex model and the 3-O-(R-3-hydroxydecanoyl)-glucosamine. Dots indicate the values obtained for
score corresponding to the PaLpxC/PaMurA pair is indicated by a dashed line. three individual replicates, bars indicate the mean, and error bars represent
(d) Model structure of the PaLpxC/PaMurA complex predicted by AlphaFold219. their standard deviation. (g) Catalytic activity of purified EcLpxC (100 nM)
Pa
LpxC is represented in gold and PaMurA is represented in cyan. The top six alone or in the presence of EcMurA (200 nM) assayed by conversion of UDP-3-O-
intermolecular couplings between LpxC/MurA residues from the final (R-3-hydroxydecanoyl)-N-acetylglucosamine to UDP-3-O-(R-3-hydroxydecanoyl)-
EVcomplex model are highlighted in red with red lines connecting the coupling glucosamine. Dots indicate the values obtained for three individual replicates,
pairs. (e) Distribution of final interaction scores among all LpxC and MurA pairs bars indicate the mean, and error bars represent their standard deviation.
analyzed. The data fit a two-component Gaussian mixture model (black line)
Article
First desc ribed by John Langdon Down in 1866, Down’s syndrome (DS) Recent studies into the molecular mechanisms of immunological
or trisomy 21 is the most common chromosomal anomaly in the USA disease have focused on the overactive interferon (IFN) response7–9
today, affecting 1 in 700 newborn babies3,4. This extra copy of around and thymic dysfunction10 reported in individuals with DS as most IFN
200 genes results in a syndrome with considerable phenotypic variabil- receptor subunits and AIRE are expressed from chromosome 21. On the
ity that includes intellectual disability, developmental malformations— innate side, monocytes from individuals with DS exhibit basal IFN-I and
particularly of the heart and the gut—and increased risk of Alzheimer’s II signalling and hyper-respond to IFNα and IFNγ stimulation7. On the
disease1. As care for individuals with DS has substantially improved in adaptive side, thymic architecture perturbations10 and T cell polariza-
recent decades5, the immune features of DS have become apparent: tion towards differentiated subsets have been described11. Furthermore,
patients have an increased risk of severe infectious disease concomitant low B cell counts in individuals with DS have been documented for
with a higher incidence of autoimmunity including thyroiditis (50%), decades12 and recent investigations have identified decreased prolif-
coeliac disease (5%), alopecia areata (1–11%) and type 1 diabetes (1%)1,2,6. eration and increased apoptosis in this population13.
Center for Inborn Errors of Immunity, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 2Department of Pediatrics, Icahn School of Medicine at Mount Sinai, New York, NY, USA.
1
3
Mindich Child Health and Development Institute, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 4Precision Immunology Institute, Icahn School of Medicine at Mount Sinai, New
York, NY, USA. 5Department of Microbiology, Icahn School of Medicine at Mount Sinai, New York, NY, USA. 6Laboratory of Human Genetics of Infectious Diseases, Necker Branch, INSERM U1163,
Necker Hospital for Sick Children, Paris, France. 7University of Paris, Imagine Institute, Paris, France. 8St Giles Laboratory of Human Genetics of Infectious Diseases, Rockefeller Branch, The
Rockefeller University, New York, NY, USA. 9Pediatric Hematology-Immunology and Rheumatology Unit, Necker Hospital for Sick Children, Assistance Publique-Hôpitaux de Paris (AP-HP), Paris,
France. 10Institut Jérôme Lejeune, Paris, France. 11Department of Pediatrics, Necker Hospital for Sick Children, Paris, France. 12Howard Hughes Medical Institute, New York, NY, USA. 13Laboratory
of Clinical Immunology and Microbiology, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD, USA. 14These authors contributed equally:
Marta Martin-Fernandez, O’Jay Stewart. ✉e-mail: Dusan.Bogunovic@mssm.edu
–10 –5 0 5 10 DS group
2 HC
Class DS low cyt.
DS DS int. cyt.
DS high cyt.
HC
1
DS group
Dim 2 (5.3%)
DS high cyt.
DS int. cyt. 0
DS low cyt.
HC
Female –1
Male
Age
40 –2
30
20
10
0 –5 0 5 10
IL-13
IL-12A
IFNγ
IL-15
IL-12B
IL-7
IL-5
GCSF
VEGF
GMCSF
IFNA2
IL-2
IL-3
IL-1B
IL-10
EGF
IP10
MCP1
MIP1B
EOTAXIN
IL-6
TNFβ
IL-4
IL-8
Class
DS group
Gender
Age
IL-1α
TNF
IL-1RA
IL-17A
MIP1A
Dim 1 (76.4%)
DS001
DS002
DS003
DS004
DS005
DS006
HC
–10 –5 0 5 10
10,000 * * * 10,000 * 0.13
* DS 20
10
Concentration (pg ml–1)
100 100
10 10
1 1
0.1 0.1
IL-6 IL-1α IL-1β TNF TNFβ IL-4 IL-5 IL-13
e f
HC DS low and int. cyt. DS high cyt.
8
***
(percentage of CD66b– cells)
*** **** **
**** **** **** ***
Concentration (pg ml–1)
10,000
6
****
Basophils
1,000
NS NS
4 NS
100 NS
10
2
1
MCP1
EOTAXIN
IL-2
IFNA2
IL-5
IL-13
IL-15
IL-7
IL-3
IL-1B
TNFβ
MIP1B
IL-12B
IL-10
IL-4
IP10
IL-8
IL-6
Class
Patient
GMCSF
VEGF
GCSF
EGF
Age
IL-12A
IL-1α
IL-17A
TNF
IL-1RA
MIP1A
IFNγ
0 0.1
HC DS IL-2 IFNγ IL-12B IL-12A
h Blood draw 1
Blood draw 2
10,000
Concentration (pg ml–1)
1,000
100
10
1
IL A
RA
M A
Fβ
M 1
3
-3
A2
IL 0
-2
10
-8
B
1B
-6
-4
IL 5
-5
N
IL B
-7
F
G SF
IF F
F
2A
F
γ
P
-1
-1
-1
1
-1
-1
EG
G
N
TN
2
XI
IL
IL
IL
IL
IL
IL
TN
IL
IP
-1
IP
C
N
-1
IP
-1
-1
C
IF
VE
IL
IL
IL
IL
IL
TA
M
G
M
EO
Fig. 1 | Cytokine profiling indicates broad immune dysregulation in most individuals (n = 8). f, Raw values of IL-2 and TH1 cytokines in the plasma of
individuals with DS. a, Multiplex cytokine analysis using the magnetic individuals with DS (n = 21) and HC individuals (n = 10) measured using the
Luminex assay of plasma from individuals with DS (n = 21) and HC individuals magnetic Luminex assay. g,h, Multiplex cytokine analysis using the magnetic
(n = 10), expressed as the log 2-transformed fold change (FC) over the mean HC Luminex assay of plasma from blood drawn at separate timepoints from
per cytokine (cyt.). Unsupervised clustering of samples and cytokines using individuals with DS (n = 6) expressed as log 2-transformed fold change over the
the complete method (distance metric, Euclidean). Int., intermediate. b, PCA mean HC individuals per cytokine followed by unsupervised clustering (g) and
analysis of serum cytokines from the samples. c,d, Raw values of acute phase as raw values (h). No significant differences were detected on the basis of
proteins (c) and TH2 cytokines (d) in the plasma of individuals with DS (n = 21) paired t-tests between blood draws for each individual for each cytokine
and HC individuals (n = 10) measured using the magnetic Luminex assay. (P > 0.05 for all pairs). For c–f, data are mean ± s.d. Significance was assessed
e, The frequency of basophils expressed as the percentage of CD66b− cells using two-tailed unpaired t-tests (c–e) and ANOVA with Tukey’s post hoc
(non-granulocytes) from adults with DS (n = 11) and age-matched HC analysis (f); *P ≤ 0.05; **P ≤ 0.005; ***P ≤ 0.0005; ****P ≤ 0.0001.
It is now understood that a tightly regulated immune response is and age-matched healthy control (HC, n = 10) individuals. Donors had
critical to prevent infection and excessive inflammation: the absence no signs of infection at sampling. On the basis of unsupervised hierar-
of a well-orchestrated immune response leads to opportunistic infec- chical clustering on 29 analytes, individuals with DS segregated into
tions, whereas an overactive immune response leads to systemic organ 3 distinct categories (Fig. 1a,b). One-third had widespread soluble
damage14. Where DS lies on this spectrum of immune dysregulation and immune dysregulation with up to 2,000-fold elevation in 22 out of
how it contributes to clinical manifestations is still largely unknown. the 29 markers assayed. In 9 out of 21 individuals, a subset of cytokines
was significantly elevated compared with in the control individuals
(including IL-13, IL-4, TNFβ (also known as LTα) IL-6 and IL-1α). Finally,
Down’s syndrome is a cytokinopathy the remaining five individuals with DS clustered with HC individuals.
To capture the soluble immune landscape at steady-state in DS, we As previously reported for HC individuals15, there was a correlation
performed a cytokine array on plasma from individuals with DS (n = 21) between inflammatory cytokine profiles and age in DS (analysis of
100 100
** ** HC
** HC *
CM Naive DS CM Naive DS
pSTAT3
55.33 42.30 36.29 27.00
DS DS 40 0
40
20 20
155Gd-CD27
155Gd-CD27
–2
0 0
Naive CM EM TEMRA Naive CM EM TEMRA
1.58 0.79 11.92 24.79
143Nd-CD45RA 143Nd-CD45RA Total Activated Naive Central Effector TEMRA
memory memory
d e f g
DMSO Tofacitinib mIgG control IFN-I blockade rIgG control IL-10 blockade hIgG control Tocilizumab (anti-IL-6R)
pSTAT3 (percentage of max. MFI)
50 50 50 50
0 0 0 0
Total Activated Naive CM EM TEMRA Total Activated Naive CM EM TEMRA Total Activated Naive CM EM TEMRA Total Activated Naive CM EM TEMRA
Fig. 2 | T cell activation in DS is rescued by Jak inhibition or IL-6 blockade. to the maximum value per experiment after ex vivo whole-blood treatment
a,b, Representative plots and calculated frequencies of CD4+ (a) and CD8+ for 4 h with JAK inhibition (tofacitinib) (500 nM) (n = 7) (d); IFN blockade
T cell naive, central memory (CM), effector memory (EM) and terminally (anti-IFNAR2 (5 μg ml−1), anti-IFNα (0.2 μg ml−1) and anti-IFNβ (0.2 μg ml−1)
differentiated effector memory (TEMRA) (b) subsets in whole blood from antibodies) (n = 6) (e); IL-10 blockade (anti-IL-10 (5 μg ml−1) and anti-IL-10R
adults with DS (n = 10) and age-matched HC individuals (n = 8). c, Basal STAT3 (5 μg ml−1) antibodies) (n = 6) (f) or IL-6 blockade (tocilizumab, 50 μg ml−1) (n = 7)
phosphorylation in CD4+ T cell subsets from individuals with DS (n = 19) and (g). In a and b, the whiskers denote the minimum and maximum values, the
age-matched HC individuals (n = 13) and expressed as the log 2-transformed box limits denote quartiles 1–3, and the centre bar denotes the mean. For a–g,
fold change over the mean of HC individuals per subset. d–g, STAT3 significance was assessed using two-tailed unpaired t-tests; NS, not significant
phosphorylation in CD4+ T cell subsets from individuals with DS, normalized (P > 0.05).
variance (ANOVA), P = 0.0231; Extended Data Fig. 1a). After scoring TH9 cells, must be further examined. IL-2, TH1 cytokines IL-12 and IFNγ,
samples based on clinical immunological manifestations (Methods and and the TH17 cytokine IL-17 were elevated in only the high-cytokine
Extended Data Table 1), we observed a significant association between subgroup of individuals with DS (Fig. 1a,f).
immune scores and the cytokine-based clusters (ANOVA, P = 0.0141; Measuring cytokine levels in multiple blood samples, drawn 5 to
Extended Data Fig. 1b). It is not yet clear whether dysregulated cytokines 10 months apart, we found that the immune profile of individuals
drive clinical immune dysfunction in individuals with DS, or vice versa. with DS was highly stable for both the high- and low-cytokine groups
To determine the magnitude of this global cytokine dysregulation, (Fig. 1g,h). Our findings suggest that individuals with DS have stable,
we compared the cytokine profiles of individuals with DS and HC indi- long-lasting perturbations in their cytokine levels similar to those
viduals at steady state, in mild or severe COVID-19 (n = 13 (control) and in acute COVID-19. We conclude that DS can be considered to be a
n = 7 (individuals with DS)) or another acute respiratory infection (n = 1 cytokinopathy.
individual with DS) (Extended Data Fig. 1c). The COVID-19 samples
were collected during hospitalization or at follow-up. Samples from
donors with DS and with COVID-19 were available at only one point, Basal IL-6-mediated T cell activation
whereas control samples were collected during the acute phase and Cytometry by time-of-flight (CyTOF)-based immunophenotyping of
at follow-up. Notably, the cytokine profiles of the patients with an whole blood from individuals with DS and age-matched HC individuals
infection (irrespective of ploidy, disease severity or infecting virus) (Extended Data Fig. 2a–i) revealed that both CD4 and CD8 T cells in DS
were not significantly different from those of uninfected individu- were skewed towards a memory phenotype (Fig. 2a,b and Extended Data
als with DS—unbiased hierarchical clustering placed patients with an Fig. 2d,e). There were fewer naive CD4 and CD8 T cells in individuals with
infection across all three groups of individuals with DS. The uninfected DS, with a concurrent increase in CD4 central memory frequency11,19.
high-cytokine DS group had a broader, more severe inflammatory pro- We also uncovered baseline phosphorylated STAT3 (pSTAT3) in naive,
file compared with any patient with an infection. Our findings suggest activated and central memory CD4 T cells of individuals with DS,
that at least a third of individuals with DS have cytokine levels similar suggesting active cytokine signalling (Fig. 2c and Extended Data Fig. 3a).
to severe acute infection at the baseline. STAT3 is a transcription factor that is activated downstream of mul-
The acute-phase proteins IL-6, IL-1α and TNFβ were basally elevated in tiple cytokines and growth factors20. When aberrantly phosphoryl-
most individuals with DS (Fig. 1a,c), consistent with previous studies16,17. ated, STAT3 contributes to lymphoproliferation, recurrent infections
Intracellular staining suggested that CD16+ monocytes, conventional and increased autoimmunity including eczema, type 1 diabetes and
dendritic cells (cDCs), and central memory CD4 and CD8 T cells from hypothyroidism21. Clinically, Mendelian STAT3 gain of function (GOF)
individuals with DS contained slightly more IL-6 (Extended Data Fig. 1d). substantially overlaps with DS, indicating that engagement of STAT3
T helper 2 (TH2) cytokines IL-4 and IL-13, two central drivers of the aller- in CD4 T cells in DS may contribute to immune pathogenesis. The
gic response18, were significantly elevated in the plasma of individuals molecular mechanism of disease in STAT3 GOF is still debated, but
with DS (Fig. 1a,d), possibly explained by the concurrent increase in STAT3 attenuation of STAT5 phosphorylation is the leading hypothesis.
basophils (Fig. 1e). The role of other T cell subsets, especially TH2 and In DS, basal phosphorylated STAT5 (pSTAT5) levels were unaffected in
Percentage of B cells
15 10 **
DS 10
t-SNE 2
5 HC
DS
0 0.1
HC DS IgD+ naive Memory DN Plasmablasts
t-SNE 1
d e f g
*** 0.07 * **
30 **
* * ** ***
(percentage of DN B cells)
DS
CD11c+ B cells
8 40
aN B cells 20 SLE
DN2 B cells
30
5
2
20
10
0.5
10
0
0.125 0 0
Activated naive DN2 HC DS SLE HC DS SLE rN:aN ratio DN1:DN2 ratio
B cells B cells
h i 50
j 4,000
l
3 CD11c– CD11c– 6 CD11c–
CD11c+ ** CD11c+ **
CD11c– **** CD11c+ 20
CD11c+ r = 0.6837
(percentage of B cells)
40 **
** **** 3,000 P < 0.0001
CD11c+ B cells
15
2 4 ***
CD86 (MSI)
CD21 (MFI)
Tbet (MFI)
FAS (MSI)
30
2,000 10
20
1 2
1,000 5 HC
10 *
DS
0 0 0 0 0
IgD+ naive DN IgD+ naive DN IgD+ naive DN IgD+ naive DN 0 200 400 600 800
IL-6 (pg ml–1)
k m
300 CD11c– 150 4 CD11c– 20
**** CD11c+
CD11c–
CD11c+ CD11c+
NS CD11c–
NS 30
CD11c+ (percentage of B cells) r = 0.0.5565
P = 0.0053
*** 3 15
CD11c+ B cells
CXCR3 (MSI)
CCR4 (MSI)
CXCR5 (MSI)
200 100
CCR7 (MSI)
0.08 20
* 2 ** 10 ****
100 50 10
1 5
HC
DS
0 0 0 0 0
IgD+ naive DN IgD+ naive DN IgD+ naive DN IgD+ naive DN 0 2 4 6 8 10
cTFH1/17 (percentage of memory CD4+ T cells)
Fig. 3 | Increased frequency of CD11c+TbethighCD21low B cells in DS. B cells, and the log 2-transformed ratios of CD11c+ subsets to CD11c− subset
a, Representative t-distributed stochastic neighbour embedding (t-SNE) (rN:aN and DN2:DN1) (g). h–k, Intracellular Tbet expression (h), and surface
analysis of a fixed number of B cells to illustrate subset distribution in whole expression of FAS and CD86 (i), CD21 ( j) and CXCR5, CCR7, CCR4 and CXCR3
blood from adults with DS and age-matched HC individuals. b,c, The frequency (k) in naive and DN B cells from both HC individuals (n = 2–4) and individuals
in adults with DS (n = 10) and age-matched HC individuals (n = 10) of total B cells with DS (n = 3–10). MSI, mean signal intensity; MFI, mean fluorescence intensity.
expressed as the percentage of CD66b− cells (non-granulocytes) (b) and B cell l,m, Correlation of CD11c+ B cells and circulating IL-6 (l) and cTFH1/17 (m).
subsets expressed as the percentage of total B cells (c). d–g, The frequency r, Pearson correlation coefficient. In b–g, the whiskers denote the minimum
in HC adults (n = 10), adults with DS (n = 10) and patients with SLE (n = 6) of and maximum values, the box limits denote quartile 1 to quartile 3, and the centre
CD11c+ B cells in the IgD+ naive (CD27−CD38lowIgD+) or DN (CD27−CD38lowIgD −) bar denotes the mean. Significance was assessed using two-tailed unpaired
compartments expressed as the percentage of total (d), IgD+ naive (e) or DN (f) t-tests (b and h–k) and one-way ANOVA with Tukey’s post hoc analysis (d–g).
differentiation (Fig. 4e). Thus, the cytokines present in DS plasma—at have a major role in the TH1-mediated atypical B cell differentiation and
least, IL-6, IFN-I, IFNγ and TNF—are drivers of naive B cell differentia- was indeed present in the TH1 supernatants, we did not detect IFNγ in
tion into plasmablasts. the IL-6 conditions (Extended Data Fig. 5h), which indicates that other
Given the mounting evidence in vivo that T cells drive extrafollicular cytokines drive B cell activation in these conditions. Together, these
B cell activation24,28, together with our findings of basal IL-6 signalling results demonstrate that cytokines and T cells in combination can drive
in DS CD4 T cells, we tested whether T cells contribute to this B cell an extrafollicular B cell response.
response. Previous studies have demonstrated that TH1-polarized T cells To better replicate the physiological conditions of DS, we performed
can induce extrafollicular differentiation of naive B cells in vitro33,37. these experiments with pre-incubation of T cells in plasma derived from
When we modelled DS CD4 T cell activation with exogenous IL-6, individuals with DS. We found that these cells induced increased plas-
co-culture of naive B cells and T cells pretreated with IL-2 and IL-6 mablast differentiation of naive B cells compared with T cells incubated
resulted in plasmablast differentiation equivalent to that of TH1–B cell in control plasma (Extended Data Fig. 5i). Finally, to determine whether
co-cultures (Fig. 4f). Exogenous IL-6 alone did not affect plasmablast activated CD4 T cells of individuals with DS are poised to induce dif-
differentiation (Extended Data Fig. 5b). Furthermore, TH1-cell- and ferentiation of naive B cells, we isolated CD4 T cells from control indi-
IL-6-primed CD4 T cells induced CD11c expression in co-cultured B viduals (n = 4) and individuals with DS (n = 2) and co-cultured them
cells (Fig. 4g), together with CD21 downregulation (Fig. 4h) and a slight with CD11c− naive B cells in syngeneic co-cultures. Without exogenous
increase in Tbet (Extended Data Fig. 5g). Although IFNγ is thought to polarization, T cells from individuals with DS induced more CD11c
+IFNγ 0
–IFNγ +IFNγ
CD27
0
0 1 2 3 4 5
CD38 Plasmablasts (percentage of B cells)
40 16
0.23
CD27
30 14
CD38
HC2 DS2 DS4 20 12 0.98
14.6 25.3 24.5
10 10
0 8
CD27
a
a
a
m
m
m
pl C
pl o
pl S
pl C
pl S
pl o
as
N
as
as
as
D
H
as
as
N
D
CD38
f *** g * h **** i j
55 ** 700 *** **** 800
1,000 90
(percentage of B cells)
NS NS **
(percentage of B cells)
50 650 600
800 80
Plasmablasts
CD11c (MFI)
Plasmablasts
CD11c (MFI)
600
CD21 (MFI )
45 70
600 400
550
40 400 60
500 200
35 50
450 200
0 40
30 400 0 HC DS HC DS
T cell T cell T cell
.
.
6
.
tim
H1
H1
tim
-2 6
-6
6
tim
-2 -6
H1
L-
IL IL-
L-
L-
IL
IL
T
ns
ns
,I
ns
,I
,I
U
-2
U
IL
IL
Fig. 4 | B cell activation by DS plasma and stimulated T cells. a,b, Plasma cell using two-tailed unpaired t-tests. Data are mean ± s.e.m. The results are
differentiation (a) and secreted IgG in the supernatant (b) after culture for representative of two independent experiments with n = 2 donors per group.
4 days of sorted HC naive or CD11c+ B cells in the presence of BAFF, IL-2, IL-10, IL-21, f–h, Co-cultures containing T cells activated with IL-6, IL-2, both or polarized
the TLR7/8 ligand R848 with or without IFNγ. n = 3 biologically independent into TH1 cells with IL-2, IL-12 and anti-IL-4 together with MACS-isolated naive
samples. Norm., normalized. c, Correlation of CD11c+ B cell and plasmablast B cells from the same donor, run in triplicates. The frequency of plasmablasts
frequencies in adults DS (n = 12) and age-matched HC individuals (n = 8). (f) and extracellular CD11c induction (g) and downregulation of CD21 expression
d, Plasma cell differentiation after culture for 6 days of sorted HC naive B cells (h) in non-plasmablast B cells after co-culture for 3–6 days. Significance was
in the presence of BAFF, IL-2, IL-10, IL-21, R848 and IgG-depleted plasma from assessed using one-way ANOVA with Tukey’s post hoc analysis. i,j, CD11c
HC individuals (n = 2) or individuals with DS (n = 4). e, Magnetic-activated cell induction (i) and plasmablast differentiation ( j) in naive CD11c− B cells isolated
sorting (MACS)-isolated naive B cells from a healthy donor were cultured for from controls (n = 4) or individuals with DS (n = 2) after 3 days of co-culture with
3 days with BAFF, IL-2, IL-21, R848, anti-IgM and plasma of HC individuals or CD4 T cells isolated from the same donors (syngeneic cultures). For b, d and f–j,
individuals with DS in the presence of a combination of antibodies blocking data are mean ± s.d.
IFN-I, IFN-II, IL-6 and TFNα signalling, in triplicates. Significance was assessed
expression and plasmablast differentiation than those of HC individu- To assess the clonality of CD11c+ B cells, we performed B cell recep-
als (Fig. 4i,j). These data indicate that cytokine milieu and steady-state tor (BCR) sequencing (BCR-seq) of DNA from sorted naive, CD11c+
cellular activation contribute to atypical B cell activation in DS. and memory B cells from individuals with DS (n = 6) and age-matched
control individuals (n = 6) at steady state (Extended Data Fig. 6b,c). In
naive cells, around 99% of BCRs were unique, whereas, in CD11c+ cells
Autoimmune features in CD11c+ B cells and memory cells, up to 7% of BCRs were expanded (Fig. 5c), suggesting
Next, we looked at immunoglobulin isotype expression to further ascer- that, like memory B cells, CD11c+ B cells undergo clonal expansion (or
tain the antibody-secreting potential and the naivety of CD11c+ B cells. are the result of clonal expansion) rather than non-specific stimula-
The frequency of IgD+CD11c+ B cells was intermediate between naive tion. There was no difference in clonality in CD11c+ B cells between HC
and memory B cells (Fig. 5a). The proportion of IgA+CD11c+ B cells was individuals and individuals with DS, as evidenced by similar fractions
similar to memory B cells (Fig. 5b), demonstrating that a portion of these of non-unique BCR templates (Fig. 5c) and similar Simpson diversity
atypical cells have gone through class switching and are therefore prob- index metrics (Extended Data Fig. 6d). The complementarity deter-
ably antigen experienced. We did not detect significant differences in mining region 3 (CDR3) repertoires of CD11c+ and memory B cell sub-
isotype usage between HC and DS CD11c+ B cells (Extended Data Fig. 6a). sets overlapped at the nucleotide and amino acid levels (Extended
HC
NS NS
NS 80
DS
20 20 2
HC
0 DS
0 45
Naive CD11c+ Memory
c+
c+
Naive CD11c+ Memory
ve
ve
s
s
y
y
st
st
or
or
ai
ai
11
11
la
la
em
em
N
N
ab
ab
D
D
C
C
M
M
m
m
as
as
**
Pl
e f Pl g h 1.0 NS *
NS 30 *
HC
0.25 **
DS
(productive frequency)
DS
* 0.20
Mean non-reference
20
nucleotide count
0.15 NS
NS NS NS
2 0
0.10 10
1 NS
0.05
–0.5
0 0 0
ki DS
ki DS
s
s
H
ne
ne
Naive CD11c+ Memory Naive CD11c+ Memory Naive CD11c+ Memory
to
to
cy
cy
t.
h
/In
ig
H
w
Lo
Fig. 5 | CD11c+ B cells from individuals with DS are more prone to expression in naive, CD11c+ and memory B cells from HC individuals (n = 3)
autoreactivity. a,b, Expression of IgD (a) and IgA (b) in naive, CD11c+ and and individuals with DS (n = 3). h, ELISA quantification of 9G4 antibodies in the
memory B cells and plasmablasts from adults with DS and age-matched HC plasma of HC individuals (n = 8), and individuals with DS in the low/medium
individuals. n = 3 each. c–h, BCR sequencing analysis of genomic DNA isolated (n = 7) and high (n = 5) cytokine groups, expressed as the fold change over
from sorted naive, CD11c+ and memory B cells from controls (n = 6) and HC individuals. OD490, optical density at 490 nm. For a, b, g and h, data are
individuals with DS (n = 6). c, The fraction of productive BCRs represented mean ± s.d. For d–f, the whiskers denote the minimum and maximum values,
more than once in each sample. Individuals from whom a sample had fewer the box limits denote quartile 1 to quartile 3, and the centre bar denotes the
than 1,000 productive templates were excluded. d, CDR3 length of productive mean. Significance in a and h and significance between cell subsets in d was
BCRs in B cells subsets in HC and DS, expressed as the number of nucleotides assessed using one-way ANOVA with Tukey’s post-hoc analysis. Significance in
(nt). e, The mean number of nucleotides different from reference in the V gene d–g between the HC and DS groups was assessed using two-tailed paired
of productive BCRs in B cells subsets in HC and DS. f, The frequency of productive t-tests.
BCRs that were aligned to the IGHV4-34 gene in each sample. g, 9G4 surface
Data Fig. 6e,f), demonstrating that cells in these two phenotypically B cells in DS (Fig. 5f). We confirmed these BCR-seq results using flow
defined subsets derive from the same lineage. In future studies, BCR-seq cytometry: 9G4 idiotype antibodies encoded by this IGHV4-34 gene seg-
analysis of donors immunized with a known antigen will enable closer ment were more highly expressed in these atypical B cells in DS (Fig. 5g).
examination of clonal expansions of these B cells. In vitro stimulation of sorted CD11c+ B cells into antibody-secreting cells
The median CDR3 length of CD11c+ B cells was similar to that of naive led to higher 9G4 secretion than from memory B cells (Extended Data
cells and significantly longer than that of memory cells (Fig. 5d). It Fig. 4h), further accentuating the link between these rare B cells and
was not significantly different between these cells in individuals with autoimmune potential. Circulating 9G4 antibodies were also elevated
DS and HC individuals. Increased CDR3 length in antibody-secreting in the plasma of individuals with DS and were more abundant in the
cells is associated with antibody polyreactivity and autoimmunity38, high-cytokine individuals with DS than in the low/intermediate groups
suggesting that these CD11c+ B cells are prone to autoreactivity. (Fig. 5h). 9G4 antibodies are known contributors of autoimmunity
The number of non-reference nucleotides in the V genes of CD11c+ in SLE, displaying specificity for nuclear antigens, dsDNA and apop-
B cells was intermediate between that of naive and memory B cells totic cells39,40. In conclusion, CD11c+ B cells in DS are present at a higher
(Fig. 5e). Notably, CD11c+ B cells in individuals with DS had significantly frequency and are more likely to exhibit features of self-reactive BCRs.
fewer non-reference nucleotides compared with in HC individuals.
This may indicate a comparative lack of somatic hypermutation, which
could lead to a broader, more non-specific humoral response. Our Autoantibodies are enriched in DS
method was limited to CDR3 sequencing; thus, characterization of the Given clinical autoimmunity in DS and our findings of cytokine dysregu-
full antigen-binding region is still needed to ascertain the true somatic lation and autoimmune-prone B cells, we hypothesized that trisomy
hypermutation rate. 21 results in the generation of autoantibodies. To characterize the DS
Analysis of BCR V gene usage (Extended Data Fig. 6g) revealed that autoreactive repertoire, we assessed the plasma IgG and IgA reactivity
CD11c+ B cell expansion is probably more autoreactive in individuals of individuals with DS (n = 5), age-matched healthy individuals (n = 4),
with DS than in HC individuals. There was a significantly higher usage of 3 individuals with immunodysregulation polyendocrinopathy enter-
the IGHV4-34 gene, which is associated with autoreactivity27,38, in CD11c+ opathy X-linked syndrome (IPEX) and 1 individual with autoimmune
Sex
h i 0.4 *
5 ***
4
IFNGR2 autoantibodies
3 0.08 *** 0.3
2 *
(A490 nm)
1 HC
CD64
DS 0.2
0
–1
–2 0.1
–3
–4 0
Group HC DS IPEX APS Sex F M NA log2[FC over HC]
Neutrophils CD14+ CD16+ NK cells HC DS
−1.0 −0.5 0 0.5 1.0
mono. mono.
e 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1819202122 X Y Chromosome
j
4,500
4 4 Enriched in **
DS
*
Fold change over HC
4,000
pSTAT1 MFI
3,500 No treatment
0 0 HC IgG
3,000 DS IgG
Anti-IFNGR2 antibodies
–4 Enriched in 2,500
–4
HC
2,000
Autoantigen density pSTAT1
Cerebral cortex
Cerebellum
Brain Caudate
Hippocampus
Skin 2
Skin Skin 1
Bone marrow
Immune Spleen
Tonsil
Pancreas Lymph node
Pancreas
Small intestine
Duodenum
Gastro- Stomach 1
intestinal Stomach
Rectum
2
Appendix
Oesophagus
Colon
Thyroid Thyroid gland
Detection level
IFNGR2
IL1R2
CYP20A1
LYSMD4
MUC4
CALR
ENPP3
FABP6
SIGLEC5
ATP1B2
ATP6V1G2
LRRC4C
CTRL
AMY1A
CELA3A
0 1 2 3
Fig. 6 | Autoantibody repertoire in individuals with DS. a, PCA analysis of colour intensity correspond to the FDR-adjusted P value. Med., mediated; NK,
the HuProt IgG dataset for adults with DS (n = 5), age-matched HC individuals natural killer; reg., regulation; sig, signalling; surf, surface; sys., system. h, The
(n = 4), and patients with IPEX (n = 3) and APS-1 (n = 1). b, The number of IgG surface expression of CD64 in monocytes, natural killer cells from individuals
autoantigens enriched at least twofold in individuals with DS, IPEX and APS-1 with DS (n = 14) and age-matched HC individuals (n = 8). Mono, monocytes. i,
compared with HC individuals. c, Enriched IgG autoantigens overlapping ELISA analysis of anti-IFNGR2 autoantibodies in the plasma from adults with DS
between disease groups. d, Enriched IgG autoantigens in HC individuals and in (n = 4) and age-matched HC individuals (n = 7). j, Neutralizing IFNγ signalling in
individuals with DS, IPEX and APS-1. The colour intensity corresponds to the THP-1 cells by IgG fraction of plasma from adults with DS (n = 3), age-matched
log 2-transformed fold change expression value relative to the mean of healthy HC individuals (n = 3) or recombinant anti-IFNGR2 antibody. Significance was
adult controls. F, female; M, male; NA, unknown. e, Chromosomal expression assessed using one-way ANOVA with Tukey’s post hoc analysis. For h and i,
pattern of IgG autoantigens enriched in DS. f, Gene expression pattern of IgG significance was assessed using two-tailed unpaired t-tests. For h and j, data are
autoantigens enriched in DS (n = 5) according to the Human Protein Atlas. mean ± s.d. For i, the whiskers denote the minimum and maximum values, the
g, GO analysis of IgG autoantigens enriched in DS ranked by the number of box limits denote quartile 1 to quartile 3, and the centre bar denotes the mean.
autoantigens found to be enriched in the associated gene set. The dot size and
polyglandular syndrome type 1 (APS-1) (disease controls; n = 4) against with APS-1 (n = 1) (caused by mutation in AIRE), although the low sample
>21,000 conformationally intact human proteins (CDI HuProt protein number is an important caveat (Fig. 6a).
microarray) (Fig. 6a and Extended Data Fig. 7a–d). Analysis of differentially abundant autoantigens in individuals with
Principal component analysis (PCA) grouped DS samples together DS compared with HC individuals (log2-transformed fold change > 1,
and away from HC individuals (Fig. 6a), indicating differential P < 0.05) yielded 365 proteins, in contrast to 257 and 829 proteins
self-antigen binding. The DS samples clustered with samples from for APS-1 and IPEX, respectively (Fig. 6b). This indicates that autoim-
patients with IPEX (n = 3), and away from the sample from the individual munity in trisomy 21 is on par with bona fide autoimmune diseases.
Tissue-protein expression heat map. Tissue-protein detection values Functional evaluation of anti-type I IFNs autoantibodies using
of all human proteins were extracted from the Human Protein Atlas API luciferase reporter assays
using the HPAanalyze (v.1.8.1)62 package. Differentially abundant auto The blocking activity of anti-IFNα2 and anti-IFNω autoantibodies was
antibodies (obtained from the DS versus HC contrast; Supplementary determined with a reporter luciferase activity as described previously64.
Data 1) were subset from the full dataset (Supplementary Data 2) and HEK293T cells were transfected with a plasmid containing the firefly
visualized using the ComplexHeatmap library. luciferase gene under the control of the human ISRE promoter in the
pGL4.45 backbone and a plasmid constitutively expressing Renilla
GO analysis. GO enrichment analysis was conducted on over-abundant luciferase for normalization (pRL-SV40). Cells were transfected in the
(log2[fold change] > 1) autoantibodies with limma’s goana function, and presence of the X-tremeGENE9 transfection reagent (Sigma-Aldrich,
biological process GO terms with P < 0.0001 were subset and visualized 6365779001) for 24 h. Cells in Dulbecco’s modified Eagle medium
using the ggplot263 (v.3.3.3) package. (DMEM; Thermo Fisher Scientific) supplemented with 2% fetal calf
serum and 10% healthy control or patient serum/plasma (after inactiva-
ELISA assays tion at 56 °C for 20 min) were stimulated with IFNα2 (Miltenyi Biotec,
Recombinant protein ELISA. Overnight, 96-well Costar plates were 130-108-984) and IFNω (Merck, SRP3061) at 10 ng ml−1 or 100 pg ml−1 for
coated at 4 °C with 100 μl per well of a 1 μg ml−1 solution of recombinant 16 h at 37 °C. Each sample was tested once for each cytokine and dose.
IFNGR2, MSTN or ATP6V1G2 protein (OriGene) suspended in 1× PBS. Finally, cells were lysed for 20 min at room temperature, and luciferase
The next morning, the coating solution was removed and wells were levels were measured with the Dual-Luciferase Reporter 1000 Assay
washed three times with 100 μl of washing buffer (PBS with 0.05% (v/v) System (Promega, E1980) according to the manufacturer’s protocol.
Tween 20; PBS-T). Next, 200 μl of blocking buffer (PBS with 1% with Luminescence intensity was measured with a VICTOR-X Multilabel Plate
bovine plasma albumin (endotoxin-free)) was added to each well at Reader (PerkinElmer Life Sciences). Firefly luciferase activity values
room temperature and incubated at room temperature for 1 h. Plasma were normalized against Renilla luciferase activity values.
samples were diluted 1:100 in blocking buffer.
Reporting summary
Total IgG and 9G4 IgG ELISA. Overnight, 96-well Costar plates Further information on research design is available in the Nature Port-
were coated at 4 °C with 100 μl per well of a 2 μg ml−1 solution of goat folio Reporting Summary linked to this article.
anti-human IgG, F(ab′)2-fragment-specific ( Jackson ImmunoResearch)
or 1:100 dilution of anti-human 9G4 IgG antibody (provided by J. Farmer)
suspended in 1× PBS. The next morning, the coating solution was Data availability
removed and wells were washed with three times with 100 μl of washing The data supporting the findings of this study are available in the Article
buffer (PBS with 0.05% (v/v) Tween-20; PBS-T). Next, 200 μl of block- and its Supplementary Information.
ing buffer (PBS with 1% with bovine plasma albumin (endotoxin-free))
was added to each well at room temperature and incubated at room 51. Geanon D, et al. A streamlined whole blood CyTOF workflow defines a circulating
immune cell signature of COVID-19. Cytometry A. 99, 446-461 (2021).
temperature for 1 h. The supernatants from B cell stimulation experi- 52. Robins, H. S. et al. Comprehensive assessment of T-cell receptor β-chain diversity in αβ
ments were diluted 1:10. T cells. Blood 114, 4099–4107 (2009).
Article
53. Carlson, C. S. et al. Using synthetic templates to design an unbiased multiplex PCR assay. Grants R01AI150300, R01AI150300-01S1 and R01AI151029. L. Malle was supported by the
Nat. Commun. 4, 2680 (2013). National Institute of Child Health and Human Development T32 training grant T32HD075735.
54. Robins, H. et al. Ultra-sensitive detection of rare T cell clones. J. Immunol. Methods 375, L.N. is supported by the Division of Intramural Research, National Institute of Allergy and
14–19 (2012). Infectious Diseases, NIH. S.G. was supported by NIH grants CA224319, DK124165 and
55. Gnjatic, S. et al. Seromic profiling of ovarian and pancreatic cancer. Proc. Natl Acad. Sci. CA196521.
USA 107, 5088–5093 (2010).
56. Ritchie, M. E. et al. limma powers differential expression analyses for RNA-sequencing Author contributions L. Malle designed and performed experiments and analysed the data for
and microarray studies. Nucleic Acids Res. 43, e47 (2015). cytokine array, CyTOF, B–T cell co-cultures and BCR sequencing, and wrote the manuscript.
57. Lê, S., Josse, J. & Husson, F. FactoMineR: an R package for multivariate analysis. J. Stat. R.S.P. analysed the CDI array and edited the manuscript. M.M.-F. performed steady-state B–T
Softw. 25, 1–18 (2008). cell co-cultures from DS donors. O.S. performed 9G4 and IFNy ELISA. J.T. edited the
58. Conway, J. R., Lex, A. & Gehlenborg, N. UpSetR: an R package for the visualization of manuscript. Q.P. performed IFN autoantibody Gyros and neutralization assays. S.B. and A.R.
intersecting sets and their properties. Bioinformatics 33, 2938–2940 (2017). coordinated DS cohort and processed whole-blood samples. V.B., K.T. and S.G. performed the
59. Gu, Z., Eils, R. & Schlesner, M. Complex heatmaps reveal patterns and correlations in CDI array. B.R.R. helped to analyse BCR sequencing data. P.B., J.S., C.M., A.-S.R., L. Maillebouis,
multidimensional genomic data. Bioinformatics 32, 2847–2849 (2016). M.V.-M., R.T., J.-L.C., L.N. and D. Bush recruited patients. D. Bogunovic supervised the work,
60. Carlson, M. org.Hs.eg.db (2017). wrote the manuscript, and helped to design the experiments and analyse the data.
61. Gel, B. karyoploteR (2017).
62. Nhat, A. HPAanalyze (2018). Competing interests D.B. is the founder and part owner of Lab11 Therapeutics. S.G. reports
63. Wickham, H. ggplot2 (2009); https://doi.org/10.1007/978-0-387-98141-3. other research funding from Genentech, Boehringer-Ingelheim, Celgene, Takeda, and
64. Bastard, P. et al. Autoantibodies neutralizing type I IFNs are present in ~4% of uninfected Regeneron.
individuals over 70 years old and account for ~20% of COVID-19 deaths. Sci. Immunol. 6,
abl4340 (2021). Additional information
Supplementary information The online version contains supplementary material available at
https://doi.org/10.1038/s41586-023-05736-y.
Acknowledgements We thank all of the patients and their families for their participation; Correspondence and requests for materials should be addressed to Dusan Bogunovic.
A. Rahman, D. Geanon and G. Kelly from the Human Immune Monitoring Centre at the Icahn Peer review information Nature thanks Stuart Tangye and the other, anonymous, reviewer(s)
School of Medicine for their technical assistance; and J. Farmer and K. Hillier for sharing for their contribution to the peer review of this work.
reagents. This study was funded by the National Institute of Allergy and Infectious Diseases Reprints and permissions information is available at http://www.nature.com/reprints.
Extended Data Fig. 1 | Global cytokine dysregulation in DS. (A-B) Correlation with acute respiratory infection (n = 1), or individuals with DS and COVID-19
between cytokine group and (A) Age and (B) Clinical Immune Dysfunction (n = 7) with severity and time of sampling as indicated, expressed as log2FC
score (determined according to reported clinical history, see Methods) and over the mean HC per cytokine. Unsupervised clustering of samples and
Age in individuals with DS. Significance assessed by one-way ANOVA with cytokines using the complete method (distance metric: Euclidean).
Tukey’s post-hoc analysis, ns denotes p > 0.05, *p ≤ 0.05; **p ≤ 0.005, (D) Intracellular staining of IL-6 in CD4 T cells, CD8 T cells, and Myeloid
***p ≤ 0.0005. (C) Multiplex cytokine analysis by Magnetic Luminex assay of cells from HCs (n = 4) and individuals with DS (n = 5).
plasma from HCs (n = 10), uninfected individuals with DS (n = 21), and individual
Article
Extended Data Fig. 2 | Cellular immune landscape in DS. (A) Representative frequencies of (H) T helper (Th) and (I) T follicular helper (Tfh) cell subsets in
t-SNE of agranulocytes adults with DS (n = 3) and age-matched HCs (n = 3) whole blood from adults with DS (n = 5) and age-matched HCs (n = 5), expressed
illustrating the immune cell distribution in whole blood. (B-E) Frequencies of as percent of memory CD4 T cells. In (B-E), whiskers denote min and max
(B) agranulocyte subsets, (C) granulocyte subsets, and (D) CD4 and (E) CD8 values, bounds of box denote Q1–Q3, and centre bar denotes mean. (F-I) Error
T cell subsets in whole blood from adults with DS (n = 10), adults with DS and bars denote SD. (B-E) Significance assessed by one-way ANOVA with Tukey’s
COVID-19 (n = 5), and age-matched HCs (n = 8). (F-G) Frequencies (F) and post-hoc analysis, ns denotes p > 0.05, *p ≤ 0.05; **p ≤ 0.005, ***p ≤ 0.0005.
absolute counts (G) of T regulatory (Treg) cells (CD4+CD25+CD127−) and naive (F-I) Significance assessed by two-tailed paired t tests, ns denotes p > 0.05,
(CD45RA+) and memory (CD45RA−) subsets in whole blood from adults with DS *p ≤ 0.05; **p ≤ 0.005, ***p ≤ 0.0005.
(n = 5) and age-matched HCs (n = 5). (H-I) Representative plots and calculated
Extended Data Fig. 3 | Basal signalling in CD4 T cells in DS. (A) Basal STAT3 after ex vivo whole blood treatment for 4 h with (C) Tofacitinib (500nM)
phosphorylation in CD4 T cell subsets from HCs (n = 13), individuals with DS (n = 6 HC, n = 7 DS), (D) Tocilizumab (50 μg ml−1) (n = 4 HC, n = 7 DS). (E) Surface
(n = 19), and adults with DS and COVID-19 (n = 5) expressed as Log2FC over the expression of IL-6R in CD4 T cells from adults with DS (n = 3) and age-matched
mean HCs per subset. Significance assessed by one-way ANOVA with Tukey’s HCs (n = 3). (F) STAT3 phosphorylation in CD4 T cell subsets induced by
post-hoc analysis, ns denotes p > 0.05, *p ≤ 0.05; **p ≤ 0.005, ***p ≤ 0.0005. stimulation of whole blood with recombinant IL-6 (50 ng ml−1) for 15 min,
Whiskers denote min and max values, bounds of box denote Q1–Q3, and centre expressed as Log2FC over the mean mock-treated HCs (n = 2 HC, n = 4 DS). Box
bar denotes mean. (B) Basal STAT5 phosphorylation in CD4 T cell subsets from plots denote min and max values for HCs, error bars indicate SD and centre
individuals with DS (n = 14) and age-matched controls (n = 10), expressed as denotes mean for DS. (C-E) Error bars denote SD. (B-F) Significance assessed
Log2FC over the mean HCs per subset. (C-D) STAT3 phosphorylation in CD4 by two-tailed paired t tests, ns denotes p > 0.05, *p ≤ 0.05; **p ≤ 0.005,
T cell subsets expressed as Log2FC over the mean mock-treated HCs per subset ***p ≤ 0.0005.
Article
Extended Data Fig. 4 | Abnormal B cell subsets in DS. (A) Raw B cell counts *p ≤ 0.05. (H-I) Correlation of CD11c+ B cell frequency and (H) age and (I) total
in HCs (n = 6) and adults with DS (n = 7) or patients with SLE (n = 4). Error bars cytokines (calculated as the sum of all circulating cytokines, pg ml−1) in
denote SD. (B) Gating scheme of B cells subtypes. (C) Frequency in children individuals (H) or adults (I) with DS and age-matched controls. (r: Pearson
with DS (n = 11) and age-matched HCs (n = 7) of total B cells expressed as percent correlation coefficient). (J) Correlation of CD11c+ B cell frequency and
of CD66b− cells (non-granulocytes), Significance assessed by two-tailed autoimmune score (calculated as the sum of autoimmune diseases) in
unpaired t tests, *p ≤ 0.05. (D-F) Frequency in children with DS (n = 8) and individuals with DS. (r: Pearson correlation coefficient). (K) Total IgG in the
age-matched HCs (n = 4) of CD11c+ B cells in the IgD+ naive or DN compartments, plasma of HCs (n = 7) and individuals with DS (n = 12) or SLE (n = 6) assessed by
expressed as percent of (D) total, (E) IgD+ naïve, or (F) DN B cells. (G) Ratios of ELISA. Significance assessed by one-way ANOVA with Tukey’s post-hoc analysis,
CD11c+ subsets to CD11c− subset (rN:aN and DN2:DN1) in HC and DS groups, ns denotes p > 0.05, *p ≤ 0.05. In (C-F, K), whiskers denote min and max values,
Log2-transformed. Significance assessed by two-tailed unpaired t tests, bounds of box denote Q1–Q3, and centre bar denotes mean.
Extended Data Fig. 5 | Atypical activation of naive B cells by cytokines and total IgG in supernatant at day 6. (F) Plasmablast differentiation of MACS-
activated T cells. (A Plasmablast differentiation of MACS-isolated total B cells isolated naive B cells from a healthy donor after 3-day culture in the presence
from 2 healthy donors after 3-day culture in the presence of BAFF (10 ng ml−1), of BAFF, IL-2, IL-21, R848, anti-IgM (same concentrations as J), and IgG-depleted
IL-2 (50 ng ml−1), IL-21 (50 ng ml−1), R848 (1 μg ml−1), anti-IgM (1 μg ml−1), and DS plasma in the presence of Tofacitinib (500nM) or antibodies blocking
IgG-depleted plasma from HCs (n = 3) or individuals with DS (n = 3), run in IFN-I, IFN-II, IL-6, and TFN-ɑ signalling, run in duplicates. (G-H) Co-cultures
duplicates. (B-C) MACS-isolated total B cells from 2 healthy donors were containing T cells activated with IL-6, IL-2, both, or polarized into “Th1 cells”
cultured in the presence of BAFF, IL-2, IL-21, R848, anti-IgM (same concentrations together with MACS-isolated naive B cells from the same donor, run in triplicates.
as A), in the presence of IL-6 (100 ng ml−1), IFN-α2b (100 U ml−1), or both, run in (G) Intracellular T-bet expression in non-plasmablast B cells and (H) quantification
duplicates. After 3 days, cells were washed and cultured for another 3 days in of IFN-g in the supernatant after 3-6 days of co-culture. (I) Frequency of
media with anti-IgM. (B) Plasmablast differentiation at day 3 and (C) ELISA for plasmablasts in co-cultures containing T cells previously polarized with serum
total IgG in supernatant at day 6. (D-E) MACS-isolated total B cells from 2 healthy from HCs (n = 3) or individuals with DS (n = 3) together with MACS-isolated
donors were cultured for 3-days in the presence of BAFF, IL-2, IL-21, R848, anti- naive B cells from the same donor. Significance assessed by two-tailed
IgM (same concentrations as A), and IL-4 (20 ng ml−1), IFN-ɣ (20 ng ml−1), or both, unpaired t-test. (A-I) Error bars denote SD. (A,H) Significance assessed by
run in duplicates. Cells were then washed and cultured for another 3 days in One-way ANOVA with Tukey’s post-hoc analysis, ns denotes p > 0.05;
media with anti-IgM. (D) Plasmablast differentiation at day 3 and (E) ELISA for **p ≤ 0.005; ***p ≤ 0.0005; ****p ≤ 0.0001.
Article
Extended Data Fig. 6 | Receptor sequencing in atypical B cells. with DS (n = 6). In (C-D), significance assessed by two-tailed unpaired t-test
(A) Expression of IgD and IgA in CD11c+ B cells from adults with DS (n = 3) and (ns denotes p > 0.05) and whiskers denote min and max values, bounds of box
age-matched HCs (n = 3). Significance assessed by unpaired t-tests, ns denotes denote Q1–Q3, and centre bar denotes mean. (E-F) Representative heatmaps of
p > 0.05. Error bars denote SD. (B-F) BCR sequencing from gDNA isolated from Morisita index indicating overlap between B cell subsets in HC and DS at the
sorted naïve, CD11c+ and memory B cells from controls (n = 6) and individuals (E) nucleotide and (F) amino acid levels. (G) Heatmap of IGHV gene frequency
with DS (n = 6). (B) Sorting scheme for naïve, CD11c+ and memory B cells (left) in HC and DS. Only genes that occurred at higher than 0.1% frequency in more
and number of cells sorted and number of productive BCRs obtained by than 10 samples are shown. (H) 9G4 IgG antibodies in supernatant after 4-day
sequencing for each cell type (right). (C) Fraction of in-frame BCRs containing culture of sorted HC naïve, CD11c+ or memory B cells in the presence of BAFF,
no stop codons (“productive BCRs”) in naïve, CD11c+ and memory B cells IL-2, IL-10, IL-21, the TLR7/8 ligand R848 with or without IFN-ɣ. Results
from controls (n = 6) and individuals with DS (n = 6). (D) Simpson clonality in representative of 2 independent experiments.
productive BCRs from CD11c+ B cells from controls (n = 6) and individuals
Extended Data Fig. 7 | See next page for caption.
Article
Extended Data Fig. 7 | Autoantibodies in DS plasma. (A) Principal HCs (n = 6) and individuals with DS (n = 6). Significance assessed by two-tailed
component analysis of HuProt IgA dataset for adult HCs (n = 4), adults with DS unpaired t tests, * denotes p ≤ 0.05. Whiskers denote min and max values,
(n = 5), and patients, Immunodysregulation polyendocrinopathy enteropathy bounds of box denote Q1–Q3, and centre bar denotes mean. (G) Heatmap of
X-linked syndrome (IPEX) (n = 3) and Autoimmune polyglandular syndrome IgG type I IFN autoantigens in HCs, DS, IPEX, and APS-1. Colour intensity
type 1 (APS-1) (n = 1). (B) Number of IgA autoantigens enriched at least 2-fold in corresponds to the log2FC expression value relative to the mean of healthy
DS, IPEX, and APS-1 compared to HCs. (C) Venn diagram of enriched IgA adult controls. (H) Quantification of antibodies against IFNα2 and IFNω in
autoantigens overlapping between disease groups. (D) Heatmap of enriched serum from HCs (n = 32), DS without COVID-19 (n = 10), DS with COVID-19 (n = 6),
IgA autoantigens in HCs, DS, IPEX, and APS-1. Colour intensity corresponds to and APS-1 (n = 1) by Gyros assay. (I) Neutralization of IFNα2 and IFNω activity by
the log2FC expression value relative to the mean of healthy adult controls. serum from HCs (n = 32), DS without COVID-19 (n = 10), DS with COVID-19 (n = 6),
(E) Component loadings (PC1 and PC2) from Principal component analysis and APS-1 (n = 1) by Gyros assay. (H-I) Significance assessed by One-way ANOVA
of HuProt IgG dataset for adults with DS (n = 5) and age-matched HCs (n = 4). with Tukey’s post-hoc analysis, ns denotes p > 0.05, *p ≤ 0.05; **p ≤ 0.005;
(F) ELISA of anti-MSTN and anti-ATP6V1G2 autoantibodies in plasma from ***p ≤ 0.0005; ****p ≤ 0.0001.
Extended Data Fig. 8 | Graphical abstract. Breaking Immune Tolerance in Down Syndrome: A Triad of Cytokines, Activated T cells and CD11c+ B Cells. Created
with BioRender.
Article
Extended Data Table 1 | Clinical history and calculated immune dysfunction scores of individuals with DS
Extended Data Table 2 | Clinical summary of the individuals with DS studied
Article
Extended Data Table 3 | Immunological and clinical features of individuals with SLE studied
nature portfolio | reporting summary
Corresponding author(s): Dusan Bogunovic
Last updated by author(s): 12/14/2022
Reporting Summary
Nature Portfolio wishes to improve the reproducibility of the work that we publish. This form provides structure for consistency and transparency
in reporting. For further information on Nature Portfolio policies, see our Editorial Policies and the Editorial Policy Checklist.
Statistics
For all statistical analyses, confirm that the following items are present in the figure legend, table legend, main text, or Methods section.
n/a Confirmed
The exact sample size (n) for each experimental group/condition, given as a discrete number and unit of measurement
A statement on whether measurements were taken from distinct samples or whether the same sample was measured repeatedly
The statistical test(s) used AND whether they are one- or two-sided
Only common tests should be described solely by name; describe more complex techniques in the Methods section.
For null hypothesis testing, the test statistic (e.g. F, t, r) with confidence intervals, effect sizes, degrees of freedom and P value noted
Give P values as exact values whenever suitable.
For Bayesian analysis, information on the choice of priors and Markov chain Monte Carlo settings
For hierarchical and complex designs, identification of the appropriate level for tests and full reporting of outcomes
Estimates of effect sizes (e.g. Cohen's d, Pearson's r), indicating how they were calculated
Our web collection on statistics for biologists contains articles on many of the points above.
Data analysis Autoantibody analysis was done in R (v4.0.4) using the following packages: limma microarray analysis suite (v3.46.0), UpSetR (v1.4.0)59 and
ggvennDiagram (https://github.com/gaospecial/ggVennDiagram) (v1.2.1) packages. Heatmaps were generated using the ComplexHeatmap
(v2.7.4), HPAanalyze (v1.8.1).
CyTOF analysis was performed in Cytobank. Flow cytometry analysis was performed with FlowJo.
BCR sequencing analysis was performed usign the immunoSEQ Analyzer toolset.
Graphpad Prism 9 and Microsoft Excel 16.57 were also used for data analysis.
For manuscripts utilizing custom algorithms or software that are central to the research but not yet described in published literature, software must be made available to editors and
March 2021
reviewers. We strongly encourage code deposition in a community repository (e.g. GitHub). See the Nature Portfolio guidelines for submitting code & software for further information.
1
nature portfolio | reporting summary
Data
Policy information about availability of data
All manuscripts must include a data availability statement. This statement should provide the following information, where applicable:
- Accession codes, unique identifiers, or web links for publicly available datasets
- A description of any restrictions on data availability
- For clinical datasets or third party data, please ensure that the statement adheres to our policy
The data that support the findings of this study are available in the article and supplementary materials
Reporting on sex and gender The study cohort was comprised of both sexes as shown in Supplemental Tables 1 and 2. Sexes were included whenever
possible. There were no significant differences between genders for any of the reported findings.
Recruitment "Individuals with DS" participants with a diagnosis of Down syndrome were recruited, via their referring physicians or via the
NIH’s DS-Connect ® national registry (dsconnect.nih.gov).
Ethics oversight Mount Sinai Health System (MSHS) (IRB-18-00638/ STUDY-18-00627 and IRB-20-03276), Boston Children’s Hospital
(04-09-113R), National Institute of Allergy and Infectious Disease (NIAID, NIH) (05-I-0213), Rockefeller University (JCA-0700
and XFK-0815), the French Ethics Committee “Comité de Protection des Personnes,” the French National Agency for
Medicine and Health Product Safety, and the “Institut National de la Santé et de la Recherche Médicale” (protocols # C10-13
and C10-14).
Note that full information on the approval of the study protocol must also be provided in the manuscript.
Field-specific reporting
Please select the one below that is the best fit for your research. If you are not sure, read the appropriate sections before making your selection.
Life sciences Behavioural & social sciences Ecological, evolutionary & environmental sciences
For a reference copy of the document with all sections, see nature.com/documents/nr-reporting-summary-flat.pdf
We require information from authors about some types of materials, experimental systems and methods used in many studies. Here, indicate whether each material,
system or method listed is relevant to your study. If you are not sure if a list item applies to your research, read the appropriate section before selecting a response.
2
Materials & experimental systems Methods
Antibodies
Antibodies used Cd111-GranzymeB, Cd112-IgA, In113-CD57, In115-CD11c, Cd116-IgD, I127-127I, Ce140-140Ce, Pr141-Ki67, Nd142-CD19, Nd143-
CD45RA, Nd144-CD103, Nd145-CD4, Nd146-CD8, Sm147-pSTAT5, 150Nd-pSTAT5, Nd148-CD16, Sm149-CD127 Sm149-pSTAT6,
Nd150-CD1c, Eu151-CD123, Sm152-CD66b, Eu153-pSTAT1, Sm154-ICOS, Gd155-CD27, Gd156-p38, 158Gd-pSTAT3, Tb159-
pMAPKAP2, Gd160-CD14, Dy161-CD56, Dy162-TCRgd, Dy162-CD169, Dy163-CD172a_b, Dy164-CD69, Ho165-CD64, Ho165-STAT3,
Er166-CD25, Er167-pERK1_2, Er168-CD3, Tm169-CD71, Tm169-STAT1, Er170-CD38, Yb171-CD95, Yb171-CD141, Yb172-CD39, Yb173-
Tbet, Yb174-HLADR, Lu175-pS6, Yb176-CD54, Pr141-IFNg, Nd144-CD141, 171Yb-CD141, Sm147-IL_1b, Sm149-IL_1RA, Eu153-TNFa,
Gd156-IL_6, Gd158-IL_2, Tb159-GM_CSF, Dy164-IL_17A, Ho165-CCL4, Er166-IL_10, Tm169-IFNa2b, Yb173-IL_8, Lu175-IL_29, Yb176-
CXCL10.
CD19 APC-Cy7 (SJ25C1), CD27 FITC (M-T271), CD38 APC (HIT2), CD38 PE-Cy7 (HIT2), CD11c PE (B LY6), IgD BV421 (IA6), CD21 APC
(Bu32), anti-phospho-STAT1-PE (1:25, BD) , anti-human 9G4 IgG APC (generously provided by Jocelyn Farmer).
Tofacitinib (500nM, ApexBio), Tocilizumab (50ug/mL, Selleckchem), anti-IFNAR2 (2.5ug/mL PBL Assay Science), anti-IFN-a (0.2ug/mL,
PBL 31110–1), and IFN-b (0.2ug/mL, PBL 31401-1), anti-IL10 (5ug/mL, Biolegend), anti-IL-10R (5ug/mL, Biolegend), nti-IFNGR2 (2ug/
mL, Thermofisher PA5-47938), Adalimumab (2ug/mL, Selleckchem).
Validation N/A
Clinical data
Policy information about clinical studies
All manuscripts should comply with the ICMJE guidelines for publication of clinical research and a completed CONSORT checklist must be included with all submissions.
Study protocol Mount Sinai Health System (MSHS) (IRB-18-00638/ STUDY-18-00627 and IRB-20-03276), Boston Children’s Hospital (04-09-113R),
National Institute of Allergy and Infectious Disease (NIAID, NIH) (05-I-0213), Rockefeller University (JCA-0700 and XFK-0815), the
French Ethics Committee “Comité de Protection des Personnes,” the French National Agency for Medicine and Health Product
Safety, and the “Institut National de la Santé et de la Recherche Médicale” (protocols # C10-13 and C10-14).
Outcomes N/A
Flow Cytometry
Plots
Confirm that:
The axis labels state the marker and fluorochrome used (e.g. CD4-FITC).
The axis scales are clearly visible. Include numbers along axes only for bottom left plot of group (a 'group' is an analysis of identical markers).
All plots are contour plots with outliers or pseudocolor plots.
A numerical value for number of cells or percentage (with statistics) is provided.
Methodology
March 2021
Sample preparation CYTOF: Frozen stabilized blood samples were thawed according to the manufacturer’s recommended protocol, then washed
with barcode permeabilization buffer (Fluidigm). Samples were uniquely barcoded with Cell-ID 20-Plex Pd Barcoding Kit
(Fluidigm) and pooled together. For previously unstained samples, cells were then incubated with an antibody cocktail for
surface markers to identify major immune populations, followed by methanol permeabilization, heparin-block and stain with
a cocktail of antibodies against intracellular targets, including markers of phosphorylation and signaling. After washing, cells
were then incubated in freshly diluted 2.4% formaldehyde containing 125nM Ir Intercalator (Fluidigm), 0.02% saponin and 30
nM OsO4 (ACROS Organics) for 30 min at room temperature. Samples were then washed and acquired immediately.
Flow: For extracellular markers, cells were immunostained with antibodies in 0.5% BSA in PBS for 1 hour, washed 3x in 0.5%
BSA in PBS for 1 hour and acquired immediately.
3
Instrument CyTOF: Helios mass cytometer (Fluidigm) with a modified wide-bore injector (Fluidigm).
Gating strategy Major populations were The gated populations were manually gated based on the previously described gating scheme
(Geanon, D. et al. A Streamlined CyTOF Workflow To Facilitate Standardized Multi-Site Immune Profiling of COVID-19
Patients. medRxiv (2020)). B cell populations were gated according to gating in Supplemental Figure 4B.
Tick this box to confirm that a figure exemplifying the gating strategy is provided in the Supplementary Information.
March 2021
4
Article
https://doi.org/10.1038/s41586-022-05692-z Nayan Jain1,2,5, Zeguo Zhao2,5, Judith Feucht2,4, Richard Koche3, Archana Iyer2, Anton Dobrin1,2,
Jorge Mansilla-Soto2, Julie Yang3, Yingqian Zhan3, Michael Lopez2, Gertrude Gunset2 &
Received: 21 October 2021
Michel Sadelain2 ✉
Accepted: 30 December 2022
CARs are synthetic receptors for antigens that instruct T cell specificity FDA-approved CD28 or 4-1BB-based CD19 CARs, hereafter designated
and augment antitumour functions2,4. CAR T cell therapy for relapsed Rv-1928z and Rv-19BBz, respectively, and compared their activity in the
and refractory acute lymphoblastic leukaemia, non-Hodgkin lym- well-established B cell acute lymphoblastic leukaemia NALM6 model
phoma and multiple myeloma yields a high rate of complete responses, in NSG mice (Fig. 1a). Human peripheral blood T cells typically showed
although a large fraction of patients will eventually relapse from their a CRISPR–Cas9-mediated TET2 editing efficiency of approximately
disease3,17. Novel strategies are needed to augment the overall efficacy of 67% (Fig. 1b) and retroviral CAR transduction efficiency on the order
CAR T cells to prevent these relapses and tackle solid tumour therapy2,3,18. of approximately 50%. No discernible phenotypic differences were
We hypothesized that epigenome programming could act in concert observed between infused edited and control CAR T cells (Extended
with CARs to promote CAR T cell activity by supporting T cell prolifera- Data Fig. 1a,b). CAR T cells were administered at low doses to better com-
tion and functional persistence. TET2 is a member of the TET family of pare their antitumour efficacy (‘stress test’ condition23). TET2-edited
epigenetic regulators that successively oxidize 5-methyl cytosine in Rv-19BBz CAR T cells afforded greater survival of tumour-bearing mice
DNA19. A study of the T cell receptor in transgenic mice9 and a case report than their unedited counterparts (Fig. 1d and Extended Data Fig. 1d).
of a patient with lymphoma with a hypomorphic TET2 allele treated with By contrast, no survival difference was observed between recipients
CAR T cells10 suggest that loss of TET2 may enhance T cell responses. of TET2-edited or unedited Rv-1928z CAR T cells (Fig. 1c and Extended
Mutations in TET2 are frequent in myeloid and lymphoid malignancies Data Fig. 1c). Flow cytometric quantification and phenotyping of CAR
but are not sufficient to establish a malignant state20–22. Here we report T cells isolated from bone marrow and the spleen 3 weeks after their
unexpected antigen-independent clonal expansions of CAR T cells infusion revealed no significant difference in quantity (Extended Data
lacking TET2, which is dependent on sustained expression of BATF3. Fig. 1e,f) and differentiation state (Extended Data Fig. 1g,h) between
Rv-1928z CAR T cells. However, TET2-edited Rv-19BBz CAR T cells were
more abundant than their unedited counterparts (Extended Data
Effect of TET2 on CAR T cell efficacy Fig. 1e,f). TET2-edited CAR T cells showed increased expression of
To assess the effect of TET2 on CAR T cell efficacy, we disrupted TET2 CCR7 in Rv-19BBz CAR T cells but not in Rv-1928z CAR T cells (Extended
in human T cells before retrovirally transducing them with either Data Fig. 1g,h), whereas inhibitory receptor expression (PD1, LAG3
1
Louis V. Gerstner Jr Graduate School of Biomedical Sciences, Memorial Sloan Kettering Cancer Centre, New York, NY, USA. 2Centre for Cell Engineering and Immunology Program, Memorial
Sloan Kettering Cancer Centre, New York, NY, USA. 3Centre for Epigenetics Research, Memorial Sloan Kettering Cancer Centre, New York, NY, USA. 4Present address: University Children’s Hospital,
Tübingen, Germany. 5These authors contributed equally: Nayan Jain, Zeguo Zhao. ✉e-mail: m-sadelain@ski.mskcc.org
Y
Y
Y
Day 0 Day 2 Day 3 IL-7 + IL-15 Day 7 Y
Y
Y
Y
CD3+ T cells
Y
Y
CAR transduction
gRNA
Stop
scFV scFV scFV TRAC locus 1 2 3 4
4-1BBL
CD28 4-1BB CD28 LHA RHA
CD3z CD3z CD3z AAV SA 2A 1928z pA
b Monitoring
for 90 days
uuagucuguugcccucaaca 33.38% Modified
Chromosome 4 Unmodified 0 3 4
1 2 66.62%
ATG
TET2 genomic locus Tumour CAR T cell
Mice injected with NALM6 imaging injection
c d e f
Untreated Untreated Untreated Untreated
WT Rv-1928z WT Rv-19BBz WT Rv-1928z + 4-1BBL WT TRAC-1928z
NS
TET2etd Rv-1928z TET2etd Rv-19BBz ** TET2etd Rv-1928z + 4-1BBL * TET2etd TRAC-1928z ***
100 100 100 100
80 80 80 80
Survival (%)
Survival (%)
Survival (%)
Survival (%)
60 60 60 60
40 40 40 40
20 20 20 20
0 0 0 0
0 20 40 60 80 100 0 10 20 30 40 50 60 0 20 40 60 80 100 0 20 40 60 80 100
Time (days) Time (days) Time (days) Time (days)
Fig. 1 | Effect of TET2 disruption on CAR T cell therapeutic efficacy is TRAC-1928z (dose: 1 × 105; n = 15) (f) CAR T cells. Data were collated from two
dependent on CAR design. a,b, Schematics of in vitro CAR T cell generation donors. Untreated n = 5. Log-rank Mantel–Cox test was used; P < 0.05 was
and the NALM6 xenograft mouse model (a), and TET2 targeting gRNA and considered statistically significant. P values are denoted: not significant (NS)
editing efficiency (b). c,d, Mice survival under Rv-1928z (dose: 1 × 105; n = 12) (c) P > 0.05, *P < 0.05, **P < 0.01 and ***P < 0.001 (c–f). The human, mouse and lipid
and Rv-19BBz (dose: 2 × 105; n = 12) (d) CAR T cell treatments. e,f, Cancer-free bilayer illustrations in part a were generated using Servier Medical Art, CC BY 3.0.
survival of mice treated with Rv-1928z + 4-1BBL (dose: 5 × 104; n = 10) (e) and
and TIM3) was indistinguishable between unedited and TET2-edited kidneys, and lungs with extensive T cell infiltration and absence of
groups for both CAR designs (Extended Data Fig. 1i). Intrigued by the CD19+ leukaemia. The infiltrating T cells were CAR+ and Ki67+ (Fig. 2b).
different outcome between the two CARs, we further evaluated the This prompted us to treat additional cohorts of mice with all four CAR
1928z CAR design in two distinct contexts that extend its persistence, T cell types (Rv-19BBz, Rv-1928z, Rv-1928z + 4-1BBL and TRAC-1928z),
by either co-expressing 4-1BBL (Rv-1928z + 4-1BBL)23 or by transcribing administering 2–5 × 105 CAR T cells to ensure tumour elimination in
the CAR from the TRAC locus (TRAC-1928z)24 (Fig. 1a). As with Rv-1928z most mice to allow for long-term follow-up of all four groups (Fig. 2c).
and Rv-19BBz, TET2 editing did not affect CAR transduction efficiency All CARs maintained long-term tumour remission as assessed by biolu-
or the pre-infusion T cell phenotype of either CAR T cell populations minescence imaging (BLI), tumour was eliminated within 2–3 weeks of
(Extended Data Fig. 2a,b), but their efficacy was increased relative to CAR T cell administration. Mice treated with Rv-CARs were euthanized
their non-edited counterparts (Fig. 1e,f and Extended Data Fig. 2c,d). on day 90 and TRAC-CAR T cells recipients on day 75. Bone marrow
This increased efficacy was associated with increased expression of and splenic CAR T cell numbers were considerably increased in mice
CCR7 in Rv-1928z + 4-1BBL and TRAC-1928z CAR T cells (Extended treated with TET2-edited Rv-19BBz, Rv-1928z + 4-1BBL and TRAC-1928z
Data Fig. 2e,f). Although, it did not reach statistical significance for CAR T cells, compared with their unedited counterparts (Fig. 2d). CAR
Rv-1928z + 4-1BBL (Extended Data Fig. 2f). Inhibitory receptor expres- T cell numbers in recipients of TET2-edited and unedited Rv-1928z in
sion was similar between wild-type (WT) and TET2-edited groups for both the bone marrow and the spleen, however, did not significantly
both Rv-1928z + 4-1BBL and TRAC-1928z CARs (Extended Data Fig. 2g). differ (Fig. 2d), except for a single mouse (1 out of 10) that showed an
These findings thus established that disruption of TET2 could augment increase in TET2-edited CAR T cells. Flow cytometric analysis of CAR
therapeutic efficacy of either CAR, albeit depending on CAR expression. T cells isolated from the bone marrow confirmed increased expression
of CCR7 in TET2-edited Rv-19BBz, Rv-1928z + 4-1BBL and TRAC-1928z
CAR T cells, but not in TET2-edited Rv-1928z CAR T cells (Extended
Hyperproliferative CAR T cells emerge Data Fig. 3a,b). Inhibitory receptor expression was again unchanged
Continued follow-up of these mice uncovered signs of clinical dis- upon TET2 editing across all four CAR designs (Extended Data Fig. 3c).
tress developing after 50 days in the absence of detectable tumour This long-term follow-up thus confirmed that TET2 editing increases
in mice treated with TET2-edited T cells (Fig. 2a and Extended Data therapeutic efficacy and T cell accumulation, but with pathological
Fig. 2c,d). Gross pathology revealed an enlarged spleen and liver, pale consequences appearing weeks or months after tumour clearance.
Survival (%)
Survival (%)
60 60
40 40
20 20 50 μm 50 μm 50 μm 50 μm
0 0
0 20 40 60 80 100 0 20 40 60 80 100
Time (days) Time (days)
Fig. 2 | Effect of CAR design on long-term T cell accumulation upon of 5 × 105, Rv-1928z + 4-1BBL CAR T cells at a dose of 2 × 105 and TRAC-1928z
CRISPR–Cas9 editing of the TET2 locus. a, Overall survival of NALM6- CAR T cells at a dose of 4 × 105. d, CAR T cell quantification in the bone marrow
bearing mice treated with Rv-1928z + 4-1BBL (n = 10) and TRAC-1928z (n = 15). (left panel) and spleen (right panel). Bars show median values. Two-sided
b, Immunohistochemistry and immunofluorescence staining of a liver section Mann–Whitney test was used (n = 5 (Rv-1928z), n = 5 (Rv-19BBz), n = 5 (WT
of mice treated with WT Rv-1928z + 4-1BBL and TET2etd Rv-1928z + 4-1BBL at day Rv-1928z + 4-1BBL), n = 7 (TET2etd Rv-1928z + 4-1BBL), n = 4 (WT TRAC-1928z)
90. Across four CARs, immunohistochemistry and immunofluorescence were and n = 5 (TET2etd TRAC-1928z)). P < 0.05 was considered statistically significant.
performed for 15 mice treated with WT CAR T cells and 20 mice treated with P values are denoted: NS P > 0.05, *P < 0.05 and **P < 0.01. Exact P values are
TET2etd CAR T cells. c, Schematics of long-term CAR T cell and tumour monitoring. available in Supplementary Table 4. The mouse illustration in part c was
Rv-1928z CAR T cells were used at a dose of 4 × 105, Rv-19BBz CAR T cells at a dose generated using Servier Medical Art, CC BY 3.0.
To ascertain that acquisition of this hyperproliferative phenotype was We assessed clonal composition in the hyperproliferative CAR
not specific to a single tumour model or a particular guide RNA (gRNA), T cell populations by TCRvβ sequencing. All five Rv-1928z + 4-1BBL
we established a human prostate cancer model in NSG mice (Extended populations were multiclonal, with no clone constituting more than
Data Fig. 4a), targeting prostate-specific membrane antigen (PSMA) in 50% of the total CAR product, except for sample 17-1 in which a single
PC3-bearing mice with PSMA-28z + 4-1BBL CAR T cells. Peripheral blood clone accounted for approximately 82% of the CAR T cells (Fig. 3f and
PSMA-28z + 4-1BBL CAR T cells edited with either gRNA-g1 or gRNA-g2 Extended Data Fig. 5d–g). By contrast, both Rv-1928z populations
were tenfold more abundant than control PSMA-28z + 4-1BBL CAR (2-2 and 2-00) largely consisted in a single clone (more than 95%; Fig. 3e
T cells edited with a scrambled gRNA by day 30 (Extended Data Fig. 4b). and Extended Data Fig. 5c), consistent with the lesser probability of
Splenic CAR T cell quantification revealed over 100 million CAR T cells 1928z CAR T cells achieving clonal expansion. TCRvβ sequencing of
per spleen in recipients of TET2-edited PSMA-28z + 4-1BBL by day 45 hyperproliferative TRAC-1928z and Rv-19BBz also revealed multiclonal
(Extended Data Fig. 4c), establishing that late acquisition of a hyper- expansion (Extended Data Fig. 5i,j).
proliferative phenotype is not specific to a tumour model or gRNA. Lack of shared TCRs between different hyperproliferative popu-
As Cas9-mediated TET2 editing resulted in either unedited, monoal- lations, the absence of graft-versus-host disease in mice bearing
lelic or biallelic disruption in individual T cells, we could test whether hyperproliferative CAR T cell population and the emergence of clonal
total loss of TET2 is required for achieving sustained proliferation. For dominance in TRAC-1928z CAR T cell-treated mice (in which CAR
this analysis, we focused on two Rv-1928z CAR populations yielding T cells lack TCR expression24) strongly suggested that the TCR is not
different rates of T cell accumulation: Rv-1928z and Rv-1928z + 4-1BBL required for acquisition of a hyperproliferative phenotype. To further
(Extended Data Figs. 5a and 7a). Pre-infusion, Rv-1928z and Rv-1928z + exclude a role for TCR in sustained clonal expansion, we ablated TCR
4-1BBL CAR T cells showed similar TET2-editing efficiency (Fig. 3a,b). By expression in conjunction with TET2 disruption before transduction
day 21 post-infusion, TET2 editing was enriched for Rv-1928z + 4-1BBL of Rv-1928z + 4-1BBL and compared the frequency of emergence of the
but not Rv-1928z (Extended Data Fig. 5b). In subsequent follow-up, hyperproliferative phenotype in recipient mice. Long-term follow-up
very high T cell counts were reached in 12 out of 15 mice treated with of TCR+TET2-edited and TCR−TET2-edited Rv-1928z + 4-1BBL CAR
TET2-edited Rv-1928z + 4-1BBL, but only in 2 of 15 mice treated with T cells revealed no differences in frequency of CAR T cells achieving
TET2-edited Rv-1928z CAR T cells, becoming apparent by day 90 and a hyperproliferative state and their differentiation state (Extended
day 200. In these latter two cases (2-2 and 2-00), we found a 19-bp dele- Data Fig. 6a–c), confirming that TCR is not required for sustained
tion in both alleles in 2-2 (Fig. 3e) and a biallelic integration of a partial proliferation.
retroviral vector fragment in 2-00 (Extended Data Fig. 5c). Five of the We hypothesized that the increased expansion and clonal diversity
expanded TET2-edited Rv-1928z + 4-1BBL populations harvested at imparted by Rv-19BBz, Rv-1928z + 4-1BBL and TRAC-1928z, contrasting
day 90 were randomly selected for analysis and all were found to be with that of Rv-1928z, were owed to the CAR and not only TET2 edit-
nearly entirely (more than 98%) biallelically TET2-edited (Fig. 3f and ing (Fig. 3e,f and Extended Data Fig. 5d–j). To this end, we introduced
Extended Data Fig. 5d–g). Western blot analysis showed an absence of either Rv-1928z or Rv-1928z + 4-1BBL in the same pool of TET2-edited
TET2 protein in biallelically edited CAR T cells (Extended Data Fig. 5h). T cells and compared the fate of common TCRvβ clonotypes express-
Thus, biallelic TET2 editing (TET2bed) is enriched over time, irrespec- ing either CAR (Extended Data Fig. 7a). Pairwise analysis of the same
tive of CAR design, consistent with it being required for achieving a TCRvβ clonotypes in different mice revealed major differences in
hyperproliferative T cell state. clonal evolution between Rv-1928z and Rv-1928z + 4-1BBL from day 0
Sequences (%)
33_48_65
Sequences (%)
Sequences (%)
30_51_62 39_57_62 42_58_62
39_57_62 30_51_62 33_51_59
45_59_67 21 33_50_62 24 21
33_53_66 42_53_63
33_53_66 39_55_65
33_50_62 45_59_67 14
45_62_69 14 42_57_66 16 39_53_66
45_62_69 39_55_67
42_57_66 42_61_66
45_58_64 7 39_54_62 8 39_57_63 7
0 0 0
−50 0 50 100 −50 0 50 100 −50 0 50 100
Indel size (bp) Indel size (bp) Indel size (bp)
No indel No indel No indel
Indel Indel Indel
d e f
Indel size distribution Indel size distribution Indel size distribution
35
39_55_64 100
36_51_66 42_54_65 30
36_53_62 28 39_51_67 39_57_63
Sequences (%)
39_55_65 80
Sequences (%)
33_53_66 27_44_67 25
Sequences (%)
39_55_67 36_54_66 39_59_65
45_59_65 21 42_57_63
60 33_48_66 20
42_54_64 39_55_63 36_54_64
36_46_59 45_62_66 39_53_72 15
36_53_66 14 36_55_63 40 45_57_66
30_47_67 30_50_66 39_57_65 10
39_55_64 7 36_53_65 36_55_62
20 5
0 0 0
−50 0 50 100 −100 −50 0 50 100 −100 −50 0 50 100
Indel size (bp) Indel size (bp) Indel size (bp)
No indel No indel No indel
Indel Indel Indel
Fig. 3 | Hyperproliferative TET2-edited CAR T populations are oligoclonal week 3 post-infusion in mice. e,f, TCRvβ sequencing (left panel) and TET2
and biallelically edited for TET2. a,b, Pre-infusion TCRvβ sequencing (left status (right panel) of hyperproliferative Rv-1928z (2-2; e) and Rv-1928z +
panel) and TET2 status (right panel) of Rv-1928z (a) and Rv-1928z + 4-1BBL (b). 4-1BBL (15-1; f). The CAR T cell population reveals that multiple clones from
CAR T cells were generated from the same donor. Indels include insertions (+) the pre-infusion population can become hyperproliferative but they require
and deletions (–). c,d, TCRvβ sequencing (left panel) and TET2 status (right biallelic TET2 editing. Hyperproliferative CAR T cells were isolated at day 90.
panel) of Rv-1928z (c) and Rv-1928z + 4-1BBL (d). CAR T cells were isolated at
(pre-infusion CAR T cells) to day 21 (Extended Data Fig. 7b,c). This CAR T cells as the unedited Rv-1928z + 4-1BBL CAR T cells persisted
divergent evolution is illustrated by tracking the persistence of the the most among the four tested CAR designs and thus could provide a
100 most frequent clones in the Rv-1928z pre-infusion cell population, matched, unedited control. Transcriptional profiling of hyperprolifera-
all of which were also present in the Rv-1928z + 4-1BBL pre-infusion tive TET2bed and WT Rv-1928z + 4-1BBL CAR T cells revealed an increased
product (Extended Data Fig. 7d). By day 21, most (70 out of 100) of expression of cell-cycle-related factors in the former (Fig. 4c,d).
these clones were still detected in Rv-1928z + 4-1BBL CAR T cells, TET2bed Rv-1928z + 4-1BBL CAR T cells demonstrated diminished
whereas only 3 out of 100 were detectable in recipients of Rv-1928z effector cytokine induction upon activation (Fig. 4e and Extended
CAR T cells (Extended Data Fig. 7d). By retro-tracking clones present Data Fig. 8d), which led us to further examine effector function in WT
in hyperproliferative populations (day 90) to pre-infusion, we found and TET2etd CAR T cells over multiple rounds of antigen stimulation
few persisting clones for Rv-1928z in contrast to Rv-1928z + 4-1BBL (Extended Data Fig. 8e). Early on, TET2etd and WT CAR T cells displayed
(Extended Data Fig. 7e,f), even though both Rv-1928z and Rv-1928z + indistinguishable cytolytic capacity and effector cytokine secretion
4-1BBL had similar pre-infusion clonal diversity (Extended Data Fig. 7g). (Extended Data Fig. 8f–i). However, after multiple rounds of stimulation
The difference between Rv-1928z and Rv-1928z + 4-1BBL in their respec- (five stimulations over 14 days), TET2etd CAR T cells exhibited reduced
tive clonal longevity was further evidenced by tracking the 100 most cytolytic function and effector cytokine secretion compared with WT
frequent shared clones from the pre-infusion Rv-1928z and Rv-1928z + CAR T cells (Extended Data Fig. 8j,k). Collectively, these observations
4-1BBL CAR populations up to day 90. None was detected in Rv-1928z establish that TET2 deficiency leads to a gradual erosion of effector
(Extended Data Fig. 7h), whereas some of the earliest clones detected function but predisposes to the emergence of TET2bed CAR T cell clones
on day 0 in the Rv-1928z + 4-1BBL population remained detectable that are characterized by sustained proliferation, moderate cytolytic
by day 90 (Extended Data Fig. 7i), although they were not dominant potential and poor cytokine responses.
(Extended Data Fig. 7j). These tracking data confirmed that the prob- Consistent with this functional profile, we did not find expression
ability of a given clonotype acquiring a hyperproliferative phenotype of the memory-associated transcription factor TCF1 (Extended Data
upon loss of TET2 is determined by the CAR and that the relative resist- Fig. 8l) or an enrichment of memory gene sets in TET2bed compared with
ance imparted by Rv-1928z could be overcome on engaging the 4-1BB WT Rv-1928z + 4-1BBL (Fig. 4f), despite the increased expression of
pathway by overexpressing 4-1BBL. some memory-associated biomarkers such as CCR7. Instead, we found
enrichment in angioimmunoblastic T cell lymphoma and HTLV1-driven
adult T cell leukaemia/lymphoma datasets (Fig. 4g). This led us to search
Reduced effector function in CAR T cells for potential genetic drivers of proliferation and investigate the pro-
To assess the functional properties of the hyperproliferative CAR liferative potential of TET2bed CAR T cells upon secondary transplant.
T cell population, we first evaluated the cytolytic function of hyper-
proliferative TET2bed CAR T cells in vitro and in vivo. TET2bed CAR T cells
demonstrated diminished cytolytic ability and were relatively ineffec- BATF3 drives hyperproliferation
tive for eliminating established NALM6 in vivo (Fig. 4a and Extended To assess whether TET2bed clones had acquired mutations that could
Data Fig. 8a,b), requiring a higher CAR T cell dosage to delay tumour account for their clonal dominance, we performed whole-exome
progression (Extended Data Fig. 8c). TET2bed CAR T cells showed a pro- sequencing in three clones expressing different CARs (Extended
found loss of effector cytokine secretion upon activation (Fig. 4b). For Data Fig. 9a,c,e). Numerous non-synonymous point mutations were
further molecular characterization, we focused on Rv-1928z + 4-1BBL observed in all three dominant clones (Extended Data Fig. 9b,d,f).
log2(fold change)
4
Survival (%)
4-1BBL (pre-infusion)
60 TET2etd TRAC-1928z (pre-infusion) 10,000 ****
TET2bed Rv-1928z (hyperproliferative) −20
40 TET2bed Rv-19BBz (hyperproliferative) 5,000
−20 0 20 40 ****
TET2bed Rv-1928z +
UD UD UD 2 **
4-1BBL (hyperproliferative) 0 PC1: 44% variance ***
20 TET2bed TRAC-1928z IL-2 IFNγ TNF
(hyperproliferative)
TET2etd Rv-1928z + WT Rv-1928z + 4-1BBL (rest)
0 4-1BBL (pre-infusion) WT Rv-1928z + 4-1BBL (stimulated)
0 10 20 30 40 50 TET2bed Rv-1928z + 4-1BBL (rest) 0
TET2bed Rv-1928z +
TET2bed Rv-1928z + 4-1BBL (stimulated)
E1
1
Time (days)
B1
F1
A2
B2
E2
F2
4-1BBL (hyperproliferative)
DK
N
E2
E2
N
N
C
C
C
C
C
C
e f g
*
10 AKL HTLV up 1.0 1.5
−log10(P value)
–1.0
GSE23321 CM versus EM up 2 –1.5
1 –1.5
Angioimmunoblastic lymphoma down –2.0 Positive Negative Positive Negative
0.01
IL-2 IFNγ TNF −4 −2 0 2
NES
WT Rv-1928z + 4-1BBL
TET2bed Rv-1928z + 4-1BBL
Fig. 4 | Loss of effector function in hyperproliferative TET2bed CAR T cells. 4-1BBL. Data are represented as mean ± s.d. (n = 3). P values were determined
a, NALM6-bearing NSG mice were either treated with 5 × 105 hyperproliferative by two-sided Student’s t-test with false discovery rate correction. f,g, Gene set
TET2bed Rv-1928z (n = 7), Rv-19BBz (n = 3), Rv-1928z + 4-1BBL (n = 7) and TRAC- enrichment analysis reveals no enrichment in central memory (CM) and stem
1928z (n = 5) CAR T cells or pre-infusion TET2etd Rv-1928z (dose: 4 × 105), Rv-19BBz cell memory (SCM) compartments for TET2bed Rv-1928z + 4-1BBL compared
(dose: 5 × 105), Rv-1928z + 4-1BBL (dose: 2 × 105) and TRAC-1928z (dose: 4 × 105) with WT Rv-1928z + 4-1BBL (f), and enrichment in angioimmunoblastic T cell
(n = 5 for all pre-infusion TET2-edited CAR T cells). b, Effector cytokine secretion lymphoma (left panel) and HTLV1-driven adult T cell leukaemia/lymphoma
upon activation of pre-infusion TET2etd and hyperproliferative Rv-1928z + 4-1BBL (right panel) gene sets of TET2bed Rv-1928z + 4-1BBL (g). Red line indicates
population. Data are represented as mean ± s.d. (n = 3). c, Principal component enrichment profile in the upregulated gene dataset and blue line indicates
(PC) analysis of resting and stimulated (24-h after co-culture with CD3/CD28 enrichment profile in the downrequlated gene dataset in g. P values were
beads at 1:1 bead-to-cell ratio) WT Rv-1928z + 4-1BBL and TET2bed Rv-1928z + corrected for multiple comparisons by the BKY method. P < 0.05 was considered
4-1BBL. d, Elevated levels of cell cycle factors in TET2bed Rv-1928z + 4-1BBL statistically significant. P values are denoted: NS P > 0.05, *P < 0.05, **P < 0.01,
compared with WT Rv-1928z + 4-1BBL. Data are represented as mean ± s.d. ***P < 0.001 and ****P < 0.0001. Exact P values are available in Supplementary
(n = 3). P values were determined by Wald test with false discovery rate correction Table 4. UD, undetected; EM, effector memory; NES, normalized enrichment
(two-sided). e, Reduced induction of effector cytokines in response to CD3/ score.
CD28 bead stimulation in TET2bed Rv-1928z + 4-1BBL compared with WT Rv-1928z +
Analysis of translocations for these three samples only identified CAR sustained proliferation. Assay for transposase-accessible chromatin
(CD28–CD3z) fusions (Supplementary Table 1). Some chromosomal using sequencing analysis revealed significant differences between
amplifications and megabase-scale deletions were observed in a subset accessible chromatin regions of WT and TET2bed Rv-1928z + 4-1BBL
of the dominant clone population in samples 17-1 and 4-1 (Extended CAR T cells (Supplementary Fig. 1a). The AP-1 family binding motif was
Data Fig. 9a,e). Given their substantially lower frequency than that of the most significantly enriched motif in differentially open chroma-
the dominant clone, these gross chromosomal defects appeared to be tin regions of TET2bed CAR T cells (Fig. 5a). Transcriptional analyses in
late occurring secondary events. For the retroviral-encoded CARs in these same cells revealed that, among the AP-1 factors, BATF3 was the
samples 17-1 and 2-2, we identified the sites of retroviral integration. most significantly upregulated in TET2bed CAR T cells (Fig. 5b). BATF3
None of them disrupted or integrated next to cancer-related genes asso- has been previously implicated as a driver of proliferation in T cell
ciated with angioimmunoblastic T cell lymphoma or T cell lymphoma leukaemia/lymphoma25–27 in part by inducing a MYC transcriptional
(Supplementary Table 2). Together, we found that hyperproliferative program25,26. Distinct promoter and gene body regions of BATF3, with
TET2bed T cells are prone to acquiring somatic mutations, but do not some encompassing consensus AP-1-binding motifs, were found to be
bear recurrent genetic mutations or mutations known to be associated more readily accessible in hyperproliferative TET2bed Rv-1928z + 4-1BBL
with T cell malignancies. CAR T cells than WT Rv-1928z + 4-1BBL CAR T cells (Fig. 5c,d and Supple-
Secondary transplant studies of TET2bed CAR T cells have shown mentary Fig. 1b). TET2bed Rv-1928z + 4-1BBL CAR T cells showed a strong
that they did not engraft on their own, but could persist with exog- enrichment in hallmark MYC targets when compared with WT Rv-1928z
enous cytokine supplementation, promptly declining after cessation + 4-1BBL CAR T cells (Fig. 5e). Flow cytometric analyses of unedited
of cytokine administration (Extended Data Fig. 10a,b). Cell numbers and hyperproliferative CAR T cells isolated at day 90 showed a higher
remained modest and were barely detectable at day 150 when the study fraction of BATF3+MYC+ in hyperproliferative CAR T cells (Fig. 5f,g).
reached its intended end point (Extended Data Fig. 10c). These findings Analysis of BATF3 and MYC expression upon TET2 editing in CAR T cells
indicate that TET2bed CAR T cells are unable to autonomously sustain (Supplementary Fig. 1c) revealed that CAR activation induced BATF3
their proliferation upon secondary transplant. expression (Supplementary Fig. 1d). The levels of BATF3 and MYC did
The lack of a conserved genetic driver of proliferation of TET2bed CAR not differ between WT and TET2-edited CAR T cells at early time points
T cells prompted us to study whether their epigenetic state enables (days 1 and 8) (Supplementary Fig. 1e), but increased after five rounds of
WT Rv-1928z + 4-1BBL
800 JUN-AP-1
FRA2 4
700
−log10(P value)
FRA1
600 ATF3 2
AP-1 BATF3
500 BATF
BACH2 0 TGANTCA
400 CTCF
–2
300 d 10
48 kb
200 –4 WT Rv-1928z + 4-1BBL
100 –6
0
IR D
AT 1
BA H1
FO L1
IR 1
AT 3
FO 3
F3
AT 2
BA 2
FO S
IR 2
FO SB
JU B
AT 6
AT 4
F4
AT 5
JU N
BA F7
BA TF
F
F
F
TF
F
SL
F
F
F
F
N
N
JU
S
AT
10
IR
C
C
0 100 200 300 400 500
TET2bed Rv-1928z
Rank
+ 4-1BBL
e f 105
16.6 6.23
g
TGANTCA CASC11 MYC
104
100 DN BATF3 SP h
MYC
Running enrichment score
WT
0.5 MYC SP DP
0 Analysis of TET2 and BATF3
80
genome editing in pre-infusion
CAR T cells at curative dose NALM6-bearing mice
Percentage
0 –104 74.6 2.54 and hyperproliferative population
60
–104 0 104 105 106 YI
NES = 4.49, P = 0.001 105
YI
YI
3.57 77.3
YI
40
YI
YII
YI
YI
Y YI
–0.5
YI
YI
Y YI
YI
YI
104 YI YII
TET2bed
YI Y
YI
MYC
20
YII
Y
YI
YI
d
TE WT
TE WT
TE T
TE T
be
be
be
be
W
4.09 15.1
T2
T2
T2
T2
W
–104
–104 0 104 105 106
i BATF3
j k l m
In-frame editing Out-of-frame editing 1.2 1.2 0.8 * 2.0
**** ****
Normalized transcripts
Normalized transcripts
Day 0 Day 50
(dexa/DMSO)
0.6 1.5
(dexa/DMSO)
***
(JQ1/DMSO)
Editing status %
(JQ1/DMSO)
100 100 Editing status %
0.8 0.8
80 80 WT 40.6 WT 35.6
0.4 1.0
****
Editing (%)
–6 2.6 –6 32.8
60 60 0.4 0.4 **
–3 2.6 –30 10.2 0.2 0.5
40 40 –9 1.8 1 (mutated) 1.4
20 20 –36 0.8 –30* 1.0 0 0 0 0
BATF3 MYC BATF3 MYC
Sum 48.4 Sum 81.0
0 0 Pre-infusion TET2etd Rv-1928z + 4-1BBL TET2bed Rv-1928z + 4-1BBL
0 50 0 50
Time (day) Time (day)
n
BATF3
TET2 TET2
ET TE
TET2
ET2
E T2
T TET2 TET2
ET TE
TET2
ET2
ET TET2
ET TET2
ET TET2
ET BATF3
TET2 TET2 TET2
ET TET2 TET2 TE
ET2
E T2
T
TET2 TET2
ET TE
ET2
E T2
T
TET2 TET2
ET BATF3
BATF3
Enrichment of TET2etd Enrichment of TET2bed TET2
ET MYC
CAR T cells CAR T cell clones TET
ET
T2
T2
TET2
TET2 TE
TET2
ET2
E T2
T TET2
ET MYC
TET2
ET TET2
ET TET2
ET TET2
ET TET2
ET TET2
ET
TET2 TET2 ET
TET2
TET2 TET2
TE
ET2
E T2
T TET2
ET TET2
TE
ET2
E T2
T TET2
TE
ET2
E T2
T TE
ET2
E T2
T
TET2
Antigen-independent proliferation
Attenuated effector function
CAR TET2: WT allele TET2
E
TET2: disrupted allele
Fig. 5 | The BATF3–MYC axis drives hyperproliferation of TET2bed CAR (left panel) and BATF3-editing (right panel and table) outcomes were determined
T cells. a, The AP-1-binding motif was most significantly enriched in the open at pre-infusion and hyperproliferation. P values were determined by two-sided
chromatin region of TET2bed Rv-1928z + 4-1BBL. b, RNA expression of the AP-1 χ2 test. j,k, Cells were either treated with DMSO, JQ1 (500 nM) or dexamethasone
family of transcription factors in TET2bed Rv-1928z + 4-1BBL and WT Rv-1928z + (dexa; 1 μm). DMSO-normalized cell counts for JQ1 ( j) and dexa (k) are shown.
4-1BBL. Data are represented as mean ± s.d. (n = 3). P values were determined Data are represented as mean ± s.d. (n = 4). P values were determined by two-
by Wald test with false discovery rate correction (two-sided). c,d, Increased sided, unpaired t-test. l,m, Quantitative PCR study for BATF3 and MYC under JQ1
genomic accessibility (highlighted by the grey background) in promoter and and dexa treatment. Transcripts were normalized to B2M. DMSO-normalized
gene body regions of BATF3 (c) and MYC (d). The AP-1-binding motif is marked BATF3 and MYC levels under JQ1 treatment (l) and dexa (m) are shown. Data are
by green dashes. e, Gene set enrichment analysis reveals increased MYC represented as mean ± s.d. (n = 4). P values were determined by two-sided,
signalling (Hallmark_MYC_V1, M5926) in TET2bed Rv-1928z + 4-1BBL compared multiple unpaired t-tests corrected by the BKY method. n, Graphical model
with WT Rv-1928z + 4-1BBL. P values were corrected for multiple comparisons summarizing the results. SP, single positive; DN, double negative; DP, double
by the BKY method. f,g, Flow cytometry for BATF3 and MYC in WT and TET2bed positive. P < 0.05 was considered statistically significant. P values are denoted:
Rv-1928z + 4-1BBL CAR T cells at day 90 (f). The WT sample was pooled from ten NS P > 0.05, *P < 0.05, **P < 0.01, ***P < 0.001 and ****P < 0.0001. Exact P values
mice. The TET2bed sample is a representative population from one mouse in f. are available in Supplementary Table 4. The mouse illustration in part h was
Data in g are a summary from three mice and are presented as mean ± s.d. generated using Servier Medical Art, CC BY 3.0.
h, Schematics of the TET2 and BATF3 dual-editing study. i, TET2-editing
stimulation (day 15) in the TET2-edited group (BATF3, Supplementary BATF3 and TET2etd Rv-1928z + 4-1BBL CAR T cells to allow for long-term
Fig. 1f; MYC, Supplementary Fig. 1g). These observations suggest that monitoring (Fig. 5h). Deep sequencing at both TET2 and BATF3 loci
TET2 deficiency gradually establishes an epigenetic state conducive indeed confirmed an enrichment of out-of-frame edits at the TET2
to increased BATF3 and MYC expression that may ultimately result in locus and in-frame edits at the BATF3 locus when the hyperprolifera-
the sustained proliferation of TET2bed CAR T cell clones. tive population emerged at day 50 (Fig. 5i), confirming the essential
To directly test the role of BATF3 in acquisition of the hyperprolif- requirement for BATF3 expression to acquire the hyperproliferative
erative state, we designed an in vivo study in which BATF3 and TET2 phenotype.
are both edited in Rv-1928z + 4-1BBL CAR T cells (Supplementary We further corroborated this dependency on BATF3 pharmaco-
Fig. 2a), hypothesizing that in-frame BATF3 edits would be enriched, logically. JQ1 is an inhibitor of the BET protein BRD4, which has been
and out-of-frame edits would be counter-selected over time. previously shown to inhibit BATF3 and MYC expression in adult T cell
NALM6-bearing mice were treated with a predictably curative dose of leukaemia/lymphoma cells26. Although JQ1 inhibited proliferation of
S-EPTS/LM-PCR integration site analysis 45. Riviere, I., Brose, K. & Mulligan, R. C. Effects of retroviral vector design on expression of
Shearing-extension primer tag selection ligation-mediated PCR human adenosine deaminase in murine bone marrow transplant recipients engrafted
(S-EPTS/LM-PCR) is a shearing DNA-based integration site analysis with genetically modified cells. Proc. Natl Acad. Sci. USA 92, 6733–6737 (1995).
46. Gallardo, H. F., Tan, C., Ory, D. & Sadelain, M. Recombinant retroviruses pseudotyped with
method in orientation to the original EPTS/LM-PCR54. S-EPTS/LM-PCR the vesicular stomatitis virus G glycoprotein mediate both stable gene transfer and
starts with shearing of genomic DNA to an intended length of 500 bp pseudotransduction in human peripheral blood lymphocytes. Blood 90, 952–957 (1997).
47. Brentjens, R. J. et al. Eradication of systemic B-cell tumors by genetically targeted human
using the Covaris M220 instrument. Sheared DNA is split into three
T lymphocytes co-stimulated by CD80 and interleukin-15. Nat. Med. 9, 279–286 (2003).
equal replicates (500 ng each) and purified, followed by primer exten- 48. Brentjens, R. J. et al. Genetically targeted T cells eradicate systemic acute lymphoblastic
sion using two vector, long-terminal-repeat-specific biotinylated leukemia xenografts. Clin. Cancer Res. 13, 5426–5435 (2007).
49. Gong, M. C. et al. Cancer patient T cells genetically targeted to prostate-specific membrane
primers. The extension product is purified, and biotinylated DNA cap-
antigen specifically lyse prostate cancer cells and release cytokines in response to prostate-
tured by paramagnetic beads. The captured DNA is ligated to linker specific membrane antigen. Neoplasia 1, 123–127 (1999).
cassettes including a molecular barcode, and the ligation product is 50. Brentjens, R. J. et al. CD19-targeted T cells rapidly induce molecular remissions in adults
with chemotherapy-refractory acute lymphoblastic leukemia. Sci. Transl Med. 5, 177ra138
amplified in an exponential PCR using biotinylated vector-specific
(2013).
and linker-cassette-specific primers. Biotinylated PCR products are 51. Stephan, M. T. et al. T cell-encoded CD80 and 4-1BBL induce auto- and transcostimulation,
magnetically captured, washed and used as template for amplification resulting in potent tumor rejection. Nat. Med. 13, 1440–1449 (2007).
52. Stoklasek, T. A., Schluns, K. S. & Lefrancois, L. Combined IL-15/IL-15Rα immunotherapy
in a second exponential PCR with barcoded primers, allowing sequenc-
maximizes IL-15 activity in vivo. J. Immunol. 177, 6072–6080 (2006).
ing by MiSeq technology (Illumina). Final preparation for sequencing 53. Buenrostro, J. D., Giresi, P. G., Zaba, L. C., Chang, H. Y. & Greenleaf, W. J. Transposition of
was done as previously described55,56. Applied DNA double barcoding native chromatin for fast and sensitive epigenomic profiling of open chromatin,
DNA-binding proteins and nucleosome position. Nat. Methods 10, 1213–1218 (2013).
allowed for parallel sequencing of multiple samples in a single sequenc-
54. Schmidt, M. et al. Detection and direct genomic sequencing of multiple rare unknown
ing run while minimizing sample cross-contamination. Amplicons flanking DNA in highly complex samples. Hum. Gene Ther. 12, 743–749 (2001).
were then sequenced on the MiSeq instrument using the V2 Reagent 55. Gabriel, R. et al. Comprehensive genomic access to vector integration in clinical gene
therapy. Nat. Med. 15, 1431–1436 (2009).
Kit (Illumina). 56. Paruzynski, A. et al. Genome-wide high-throughput integrome analyses by nrLAM-PCR
and next-generation sequencing. Nat. Protoc. 5, 1379–1395 (2010).
Integration site computational analysis 57. Afzal, S., Wilkening, S., von Kalle, C., Schmidt, M. & Fronza, R. GENE-IS: time-efficient and
accurate analysis of viral integration events in large-scale gene therapy data. Mol. Ther.
Raw sequence data were trimmed according to sequence quality Nucleic Acids 6, 133–139 (2017).
(Phred) and only sequences showing complete identity in both molecu- 58. Li, H. & Durbin, R. Fast and accurate short read alignment with Burrows–Wheeler transform.
lar barcodes (linker cassette barcode and sequencing barcodes) were Bioinformatics 25, 1754–1760 (2009).
59. Altschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. Basic local alignment search
further analysed. An in-house semi-automated bioinformatical data tool. J. Mol. Biol. 215, 403–410 (1990).
mining pipeline was used to analyse the data57. In brief, quality-filtered
sequences were trimmed (vector-specific and linker-cassette-specific
Acknowledgements We thank members of the Sadelain laboratory for helpful discussion and
parts removed) and only sequences that showed at least 18 nucleotides feedback; C. Zebley, B. Youngblood, K. Helin and the Sloan Kettering Institute Centre of
of expected, vector-specific sequence were analysed further to ensure Epigenetics Research for advice on epigenetic analysis; J. Boyer for western blot support; N.
Socci for advice on exome analysis; M. Schmidt for retroviral integration site analysis; animal studies. J.M.-S. contributed to gene targeting. G.G. contributed to vector construction,
S. Monette and A. Michel from the SKI/CUMC laboratory of Comparative Pathology for T cell transduction and animal studies. M.S. designed the study, analysed and interpreted data
conducting pathology analysis; and the following SKI core facilities for their support: Flow and wrote the manuscript.
Cytometry, Centre of Comparative Medicine and Pathology, Anti-tumour Assessment,
Molecular Cytology, Bioinformatics, Integrated Genomics Operation and Cell Therapy and Competing interests The authors declare no competing interests.
Cell Engineering. Illustrations in Figs. 1a, 2c and 5h and Extended Data Figs. 4a, 7a and 10a
were generated using Servier Medical Art. This work was supported by the Pasteur–Weizmann/ Additional information
Servier award, the Leopold Griffuel award, the Leukemia and Lymphoma society (LLS ID: Supplementary information The online version contains supplementary material available at
7014-17) and the MSKCC core grant (P30 CA008748). https://doi.org/10.1038/s41586-022-05692-z.
Correspondence and requests for materials should be addressed to Michel Sadelain.
Author contributions N.J. and Z.Z. designed the study, performed the experiments, analysed Peer review information Nature thanks Stephen Gottschalk and the other, anonymous,
and interpreted data and wrote the manuscript. A.I. and M.L. contributed to RNA-seq and reviewer(s) for their contribution to the peer review of this work.
exome analysis. R.K., J.Y. and Y.Z. contributed to ATAC-seq analysis. J.F. and A.D. contributed to Reprints and permissions information is available at http://www.nature.com/reprints.
Article
Extended Data Fig. 1 | Rv-1928z and Rv-19BBz pre-infusion and in vivo CAR T cells at week 3 post infusion. Data from another experiment included in
T cell phenotyping. a,b, Pre-infusion transduction efficiency and phenotyping supplementary information. i, CAR T cell inhibitory receptor expression
by flow cytometry of Rv-1928z (a) and Rv-19BBz (b) CAR T cells. c,d, Tumour at week 3 post infusion from mouse bone marrow (n = 3). p values were
monitoring of NALM6 bearing mice treated with Rv-1928z (c) and Rv-19BBz (d) determined by two-sided Mann–Whitney test (e,f) and two-sided χ2 test (h).
CAR T cells. e,f, Bone marrow (e) and Splenic (f) CAR T cell quantification at 3 p < 0.05 was considered statistically significant. p values are denoted: p > 0.05,
weeks post infusion. Data is represented as mean±SE [n = 5 (Rv-1928z), n = 6 not significant, NS; *, p < 0.05. Replicate information for g,i are available in
(Rv-19BBz)]. g,h Differentiation phenotyping of pooled bone marrow CAR Supplementary Table 3. Exact p values are available in Supplementary Table 4.
Extended Data Fig. 2 | Rv-1928z+41BBL and TRAC-1928z pre-infusion and experiment included in supplementary information. g, CAR T cell inhibitory
in vivo CAR T cell phenotyping. a,b, Pre-infusion transduction efficiency and receptor expression at week 3 post infusion from mouse bone marrow (n = 3).
phenotyping by flow cytometry of Rv-1928z+ 41BBL (a) and TRAC-1928z (b) CAR p values were determined by two-sided χ2 test (f). p < 0.05 was considered
T cells. c,d, Tumour monitoring of NALM6 bearing mice treated with Rv-1928z+ statistically significant. p values are denoted: p > 0.05, not significant, NS;
41BBL (c) and TRAC-1928z (d) CAR T cells. e,f, Differentiation phenotyping of *, p < 0.05. Replicate information for e,g are available in Supplementary Table 3.
pooled bone marrow CAR T cells at week 3 post infusion. Data from another
Article
Extended Data Fig. 3 | Long-term CAR T cell phenotypes upon CRISPR/Cas9 determined by two-sided χ2 test (b). p < 0.05 was considered statistically
editing of TET2 locus. a,b, Differentiation phenotyping of retrovirally encoded significant. p values are denoted: p > 0.05, not significant, NS; *, p < 0.05;
CAR T cells (day 90) and TRAC-1928z CAR T cells (day 75) isolated from the bone **, p < 0.01; ***, p < 0.001; ****, p < 0.0001. Replicate information for a,c are
marrow. c, Inhibitory receptor expression of bone marrow Rv-1928z, Rv-19BBz, available in Supplementary Table 3.
Rv-1928z+41BBL (day 90) and TRAC-1928z (day 75) CAR T cells. p values were
Extended Data Fig. 4 | Effect of TET2 editing on CAR T cell accumulation in a along with 5 scrambled gRNA treated PSMA28z+41BBL mice and their splenic
prostate cancer model. a, Schematics of the prostate cancer experimental CAR T cell numbers were quantified. p values were determined by two-sided
design. TET2 was edited with the previously discussed gRNA (g1) and an Mann-Whitney (b, c) [n = 5 (WT PSMA28z+41BBL), n = 8 (TET2 etd g1 PSMA29z+
alternative gRNA (g2). PSMA28z+41BBL (PSMA targeted, CD28 costimulated 41BBL), n = 11 (TET2 etd g2 PSMA29z+41BBL)]. p < 0.05 was considered statistically
CAR that expresses 41BBL ligand) was used in this study (Dose: 2e5). b, CAR significant. p values are denoted: *, p < 0.05; **, p < 0.01. Exact p values are
T cell counts in the peripheral blood 30 days post infusion of T cells. Bars show available in Supplementary Table 4. The mouse illustration in part a was
median values. c, Mice with the top 4 CAR T cell peripheral counts at day 30 generated using Servier Medical Art, CC BY 3.0.
across both TET2 targeting gRNA (g1, n = 2. g2, n = 2) were euthanized at day 45
Article
Extended Data Fig. 5 | Clonal expansion in all 4 hyper-proliferative CAR alleles of these clones is highlighted in the figures. e–g, Examples of hyper-
T cell populations. a, Gel image of PCR product for WT CAR T cells and hyper- proliferative Rv-1928z+41BBL CAR T cell populations that are oligoclonal (left
proliferative TET2-edited CAR T cells. The PCR is designed to amplify the site of panel) with biallelic TET2 editing (right panel). h, Western blot showing total
gRNA editing. b, Enrichment of TET2-editing from pre-infusion (day 0) in mice loss of TET2 at protein level in different hyper-proliferative populations.
to day 21 in Rv-1928z and Rv-1928z+41BBL CAR T cells. p values were determined i,j, Examples of oligoclonality in TET2bed TRAC-1928z (i) and Rv-19BBz ( j).
by two-sided χ2 test. c,d, TCRvβ sequencing reveals hyper-proliferative p < 0.05 was considered statistically significant. p values are denoted: p > 0.05,
populations that are dominant for a single clone in TET2bed Rv-1928z (c) and not significant, NS; *, p < 0.05; **, p < 0.01.
Rv-1928z+41BBL (d). Part of the retroviral vector that was inserted in the TET2
Extended Data Fig. 6 | TCR is dispensable for emergence of hyper- hyper-proliferative phenotype post CAR T cell infusion in mice for different
proliferative phenotype in TET2-edited Rv-1928z+41BBL CAR T cells. donors. Mice were monitored for 90 days. 2e5 CAR T cells were used for both
a,b, Differentiation phenotyping of TCR+TET2 etd RV-1928z+41BBL (a) and the groups.
TCR−TET2 etd RV-1928z+41BBL (b) CAR T cells. c, Summary of emergence of
Article
Extended Data Fig. 7 | Properties of the chimeric antigen receptor design day 90 for Rv-1928z CAR receptor (e). Representative pair-wise analysis (day 0
determine composition of TET2bed hyper-proliferative populations. vs day 90) of a Rv-1928z+41BBL hyper-proliferative population (f). g, Changes
a, Rv-1928z or Rv-1928z+41BBL CAR T cells were generated from the same in clonality index over time in Rv-1928z and Rv-1928z+41BBL CAR T cells.
donor to assess the effect of CAR design on clonal persistence. 5 Mice were h,i, Tracking the fate of the 100 most abundant pre-infusion clones in the
euthanized at day 21 to assess clonal diversity post tumour clearance. 15 mice hyper-proliferative populations of Rv-1928z (h) and Rv-1928z+41BBL (i).
were followed for emergence of a hyper-proliferative phenotype. b,c, Pair-wise ( j) Retro-tracking late-stage dominant clones in the infusion product (Day 0).
analysis of Rv-1928z (b) and Rv-1928z+41BBL (c) at day 0 and day 21. d, Top 100 All dominant clones were isolated at day 90 except for 2-00 which was isolated
Rv-1928z clones at infusion were mapped in the Rv-1928z+41BBL infusion at day 200. p < 0.05 was considered statistically significant. p values are
product. These clones were then assessed at day 21 for both the CAR receptors. denoted: p > 0.05, not significant, NS; *, p < 0.05; **, p < 0.01; ***, p < 0.001;
p values were determined by two-tailed Mann-Whitney test. e,f, Pair-wise ****, p < 0.0001. The human, mouse and lipid bilayer illustrations in part a
analysis (day 0 vs day 90) of the lone hyper-proliferative population found at were generated using Servier Medical Art, CC BY 3.0.
Extended Data Fig. 8 | In vitro and in vivo effector function assessment in vitro cytolytic activity assessment (f) and effector cytokine assessment (g).
of TET2-edited and hyper-proliferative TET2 bed CAR T cells. a,b, In vitro h,i, Day 8 in vitro cytolytic activity assessment (h) and effector cytokine
cytolytic activity assessment upon co-culture with NALM6 for 16-h as assessment (i). j,k, Day 15 in vitro cytolytic activity assessment ( j) and effector
determined by luciferase activity for pre-infusion TET2-edited Rv-1928z cytokine assessment (k). Data in f–k is represented as mean±SD (n = 3). l, TCF1
(n = 3) and hyper-proliferative TET2bed Rv-1928z (2-2) (n = 3) (a) and pre- staining of WT Rv-1928z+41BBL and TET2bed Rv-1928z+41BBL CAR T cells
infusion TET2-edited Rv-1928z+41BBL (n = 3) and hyper-proliferative TET2bed isolated from mice at day 90. WT samples were a pool of 5 mice. TCF1 staining of
Rv-1928z+41BBL (17-1) (n = 3) (b). Data is represented as mean±SD. c, NALM6 other hyper-proliferative TET2bed CAR T cells in Supplementary Table 3. p values
bearing NSG mice were treated with 2e6 hyper-proliferative TET2bed Rv-1928z in a,b,f,h,j were determined by two-sided Student’s unpaired t-test corrected
(n = 7) or TET2bed Rv-1928z+41BBL (n = 7) CAR T cells to assess their in vivo by BKY method. p values in c were determined by two-sided Mann-Whitney
anti-tumour efficacy. d, Normalized transcript counts of WT Rv-1928z+41BBL test. p values in d,g,i,k were determined by two-sided unpaired t-test.
and TET2bed Rv-1928z+41BBLCAR T cells isolated from mice at day 90. R=Rest p < 0.05 was considered statistically significant. p values are denoted: p > 0.1,
(Transcript counts at isolation). S= Stimulated (Transcript counts 24 h post not significant, ns. p < 0.1 are indicated. *, p < 0.05. **, p < 0.01. ***, p < 0.001.
CD3/28 stimulation). Data is represented as mean±SD (n = 3). e, Schematic of ****, p < 0.0001. Exact p values are available in Supplementary Table 4.
in vitro repeated rechallenge assay for effector function analysis. f,g, Day 1
Article
Extended Data Fig. 9 | No conserved secondary genetic mutation between T cell clonality as determined by vβ sequencing in TET2bed Rv-1928z+41BBL
different hyper-proliferative TET2bed CAR T populations dominant for a (17-1). b, Nonsynonymous acquired point mutations in TET2bed Rv-1928z+41BBL
single clone. a, (Right panel) Copy number changes in TET2bed Rv-1928z+41BBL (17-1). Mutations that occur at a frequency > ((dominant TCRvβ frequency/2)
(17-1). The top panel displays log (ratio) denoted by “(logR)” with chromosomes -0.1) or >0.3 whichever is lower is annotated. c, (Right panel) Copy number
alternating in the blue and gray. The middle panel displays log (odds-ratio) changes in TET2bed Rv-1928z (2-2). (Left panel) CAR T cell clonality as determined
denoted by “(logOR)”. Segment means are plotted in red lines. In the bottom by vβ sequencing in TET2bed Rv-1928z (2-2). d, Nonsynonymous acquired point
panel total (black) and minor (red) copy number are plotted for each segment. mutations in TET2bed Rv-1928z (2-2). e, (Right panel) Copy number changes in
The bottom bar shows the associated cellular fraction (cf). Dark blue indicates TET2bed TRAC-1928z (4-1). (Left panel) CAR T cell clonality as determined by vβ
high cf. Light blue indicates low cf. Beige indicates a normal segment (total=2, sequencing in TET2bed TRAC-1928z (4-1). f, Nonsynonymous acquired point
minor=1). The table shows genetic events occurring at >0.1 cf. (Left panel) CAR mutations in TET2bed TRAC-1928z (4-1).
Extended Data Fig. 10 | Hyper-proliferative TET2bed Rv-1928z+41BBL do not quantification in bone marrow and spleen at day 150 post CAR T cell infusion.
achieve uncontrolled proliferative state upon secondary transplant. Data is represented as mean±SD (n = 5 for no supplement, and IL2. n = 4 for
a, Schematics of secondary transplant of hyper-proliferative TET2bed Rv-1928z+ IL7/15). p values were determined by two-sided Mann–Whitney test (b). p < 0.05
41BBL cells. The exogenous cytokine supplement had to be stopped at day 60 was considered statistically significant. p values are denoted: p > 0.05, not
due to deteriorating mice condition in response to frequent injections. significant, NS; *, p < 0.05; **, p < 0.01. (b). Exact p values are available in
b, CAR T cell quantification in peripheral blood under different exogenous Supplementary Table 4. The mouse illustration in part a was generated using
supplementation at day 30, day 60 and day 75. Each dot represents a mouse. Servier Medical Art, CC BY 3.0.
UD: undetected. Data is represented as mean±SD (n = 5). c, CAR T cell
nature portfolio | reporting summary
Corresponding author(s): Michel Sadelain
Last updated by author(s): 12/8/2022
Reporting Summary
Nature Portfolio wishes to improve the reproducibility of the work that we publish. This form provides structure for consistency and transparency
in reporting. For further information on Nature Portfolio policies, see our Editorial Policies and the Editorial Policy Checklist.
Statistics
For all statistical analyses, confirm that the following items are present in the figure legend, table legend, main text, or Methods section.
n/a Confirmed
The exact sample size (n) for each experimental group/condition, given as a discrete number and unit of measurement
A statement on whether measurements were taken from distinct samples or whether the same sample was measured repeatedly
The statistical test(s) used AND whether they are one- or two-sided
Only common tests should be described solely by name; describe more complex techniques in the Methods section.
For null hypothesis testing, the test statistic (e.g. F, t, r) with confidence intervals, effect sizes, degrees of freedom and P value noted
Give P values as exact values whenever suitable.
For Bayesian analysis, information on the choice of priors and Markov chain Monte Carlo settings
For hierarchical and complex designs, identification of the appropriate level for tests and full reporting of outcomes
Estimates of effect sizes (e.g. Cohen's d, Pearson's r), indicating how they were calculated
Our web collection on statistics for biologists contains articles on many of the points above.
Data analysis FlowJo (10.1), Living image (V4.4), GraphPad Prism 9, DESeq2 (version1.32.0), Burrows- Wheeler Aligner (version 0.7.17)
For manuscripts utilizing custom algorithms or software that are central to the research but not yet described in published literature, software must be made available to editors and
reviewers. We strongly encourage code deposition in a community repository (e.g. GitHub). See the Nature Portfolio guidelines for submitting code & software for further information.
Data
Policy information about availability of data
All manuscripts must include a data availability statement. This statement should provide the following information, where applicable:
- Accession codes, unique identifiers, or web links for publicly available datasets
- A description of any restrictions on data availability
March 2021
- For clinical datasets or third party data, please ensure that the statement adheres to our policy
Data generated from RNAseq and ATACseq experiments has been deposited in GEO (Accession number:GSE220259). The publicly available datasets used in this
study are GSE23321 for central memory and effector memory phenotype comparison, AKL_HTLV1_UP (M7705), AKL_HTLV1_DN (M9815), AITL dataset (GSE6338),
HALLMARK_MYC_V1 (M5926).
1
nature portfolio | reporting summary
Field-specific reporting
Please select the one below that is the best fit for your research. If you are not sure, read the appropriate sections before making your selection.
Life sciences Behavioural & social sciences Ecological, evolutionary & environmental sciences
For a reference copy of the document with all sections, see nature.com/documents/nr-reporting-summary-flat.pdf
Data exclusions Two mice, one from blood quantification (Extended Fig. 4b) and another from splenic quantification (Extended Fig. 4c) were excluded due to
technical issue.
Replication All in vivo tumor efficacy assessments of CAR T cells were performed for at least 2 independent donors. No sample was excluded. The results
were consistent between different donors. Across different CAR designs, hyper-proliferative state was observed in all 4 donors that were
tested for long-duration (>50 days).
Randomization Tumor burden was determined by bio-luminescent imaging one day prior to CAR T cell transfer. Since tumour burdens are very even with the
NALM6 cell line, no mice were excluded prior to treatment and mice were randomly assigned into treatment groups.
For Prostate Cancer mouse model, no mice were excluded prior to treatment and mice were randomly assigned into treatment groups.
Buffy coats and human peripheral blood were obtained from anonymous donors to generate human CAR T cells.
For comparisons between pre-infusion and hyper-proliferative population, donors were matched to limit confounding variables arising out of
intrinsic donor differences. For other experiments, there were no variables to be randomised in this study.
Blinding Mouse tumour monitoring was performed by an operator who was blinded to treatment groups in addition to the main investigator who was
not blind to group allocation. Mouse condition was jointly monitored by the main investigator who was not blind to group allocation and an
operator who was blinded to different treatment groups. Exome analysis was performed by an operator who was blinded to different groups.
Other experiments could not be blinded due to personnel availability. Blinding is not applicable to data analyses as they are based on
objectively measurable data (fluorescence intensity, tumor burden, cell count, transcript and DNA reads).
Antibodies
Antibodies used For flow cytometry:
Mouse anti-human CD62L BV421, Dilution: 1:100, clone DREG-56, BD, Cat# 563862, Lot: 0016011
March 2021
Mouse anti-human LAG3 BV605,Dilution: 1:100, clone T47-530, BD, Cat# 745160, Lot: 0057013
Mouse anti-human CD45RA BV605, Dilution 1:100, clone Clone HI100, BD, Cat# 562886, Lot: 0021122
Mouse anti-human CD4 BUV395, Dilution 1:100, Clone SK3, BD, Cat# 563550,Lot: 0188099
Mouse anti-human CD45 BV711, Dilution 1:100, Clone HI30, BD, Cat# 564357, Lot: 9066872
Mouse anti-human CD8 BV510, Dilution 1:100, Clone SK1, BD, Cat# 563919, Lot: 1012142
Mouse anti-human CD3 BUV737, Dilution 1:100, BD, Clone UCHT1, Cat# 612750, Lot: 9212190
Mouse anti-human CD19 BUV496, Dilution 1:100, BD, Clone SJ25C1, CAT# 612938, Lot: 9269743
Mouse anti-human CD271 PE, Dilution 1:100, BD, Clone C40-1457, Cat# 557196,Lot: 8260795
Mouse anti-human CD271 AF647, Dilution 1:100, BD, Clone C40-1457, Cat# 560326, Lot: 7125843
2
Mouse anti-human PD1 PE, Dilution 1:100, Biolegend, Clone EH12.2H7, Cat# 329906, Lot: B283580
Mouse anti-human Tim3 BV785, Dilution 1:100, Biolegend, Clone F38-2E2, Cat# 345032, Lot: B265346
Validation Antibodies used in this study are commercially available and are validated by the manufacturers, related information are available
from their website:
Mouse anti-human CD62L BV421, Cat# 563862, https://www.bdbiosciences.com/en-us/products/reagents/flow-cytometry-reagents/
research-reagents/single-color-antibodies-ruo/bv421-mouse-anti-human-cd62l.563862
BATF3 (E3K5H) Rabbit mAb (Alexa Fluor® 647 Conjugate), Cell signaling, https://www.cellsignal.com/products/antibody-conjugates/
batf3-e3k5h-rabbit-mab-alexa-fluor-647-conjugate/29501?N=4294960176+4294956287&fromPage=plp
tcf1-tcf7-antibody-1552
3
Eukaryotic cell lines
Authentication COA were provided with cell lines from ATCC. Properties pertinent to the experiments (e.g., GFP or CD19 expression) were
confirmed by flow cytometry.
Mycoplasma contamination All cell lines were tested for mycoplasma contamination and found to be negative.
Field-collected samples This study did not involve samples collected from the field.
Ethics oversight Memorial Sloan Kettering Cancer Center (MSKCC) Institutional Animal Care and Use Committee.
Note that full information on the approval of the study protocol must also be provided in the manuscript.
Recruitment Buffy coats from anonymous healthy donors were purchased from the New York Blood Centre. New York Blood Centre
recruits healthy donors under a broad consent covering in vitro laboratory research. Peripheral blood was obtained from
healthy volunteers regardless of gender and age.
Ethics oversight All human blood samples were approved by MSKCC IRB and handled following the required safety procedures. Human buffy
coats obatined from New York Blood Centre were IRB-exempt.
Note that full information on the approval of the study protocol must also be provided in the manuscript.
Flow Cytometry
Plots
Confirm that:
The axis labels state the marker and fluorochrome used (e.g. CD4-FITC).
The axis scales are clearly visible. Include numbers along axes only for bottom left plot of group (a 'group' is an analysis of identical markers).
All plots are contour plots with outliers or pseudocolor plots.
A numerical value for number of cells or percentage (with statistics) is provided.
Methodology
Sample preparation Sample preparation is described in Material and Methods.
March 2021
Cell population abundance All CAR T cell phenotyping was restricted to CAR positive cells described in supplementary figure 4. RNAseq and ATACseq was
performed on sorted CAR positive cells.
4
Gating strategy Gating strategies are provided in supplementary figure 4.
March 2021
5
Article
Accepted: 11 January 2023 RNA silencing relies on specific and efficient processing of double-stranded RNA
Published online: 22 February 2023 by Dicer, which yields microRNAs (miRNAs) and small interfering RNAs (siRNAs)1,2.
However, our current knowledge of the specificity of Dicer is limited to the secondary
Check for updates
structures of its substrates: a double-stranded RNA of approximately 22 base pairs
with a 2-nucleotide 3′ overhang and a terminal loop3–11. Here we found evidence
pointing to an additional sequence-dependent determinant beyond these structural
properties. To systematically interrogate the features of precursor miRNAs
(pre-miRNAs), we carried out massively parallel assays with pre-miRNA variants and
human DICER (also known as DICER1). Our analyses revealed a deeply conserved
cis-acting element, termed the ‘GYM motif’ (paired G, paired pyrimidine and
mismatched C or A), near the cleavage site. The GYM motif promotes processing at a
specific position and can override the previously identified ‘ruler’-like counting
mechanisms from the 5′ and 3′ ends of pre-miRNA3–6. Consistently, integrating this
motif into short hairpin RNA or Dicer-substrate siRNA potentiates RNA interference.
Furthermore, we find that the C-terminal double-stranded RNA-binding domain
(dsRBD) of DICER recognizes the GYM motif. Alterations in the dsRBD reduce
processing and change cleavage sites in a motif-dependent fashion, affecting the
miRNA repertoire in cells. In particular, the cancer-associated R1855L substitution in
the dsRBD strongly impairs GYM motif recognition. This study uncovers an ancient
principle of substrate recognition by metazoan Dicer and implicates its potential in
the design of RNA therapeutics.
Dicer, a multidomain ribonuclease (RNase) III, serves as a key player to capture the 5′ end5,22,23. These pockets anchor the ends most effec-
in RNA silencing by cleaving double-stranded RNA (dsRNA) into small tively when the ends are in a 2-nt 3′-overhang arrangement3–5,24. As the
RNAs of 21–25 nucleotides (nt) in length1,2. Endogenous siRNAs and catalytic centre of DICER is separated by a fixed distance from these
miRNAs are produced from long RNA duplexes and RNA hairpins, pockets, DICER can measure a specified length (22 nt in human) from
respectively. The miRNA pathway in metazoan species involves another the 5′ end (‘5′ counting rule’) and the 3′ end (‘3′ counting rule’)3–6. The
RNase III, Drosha, that cleaves primary miRNA (pri-miRNA) transcript relative contribution of the 5′ and 3′ counting is influenced by thermo-
to release pre-miRNA, a hairpin of about 70 nt with a characteristic dynamic stability because an unstable 5′ end can be readily frayed and
2-nt 3′ overhang12–16. Dicer cleaves pre-miRNA to produce a duplex of inserted into the 5′ pocket, facilitating the 5′ counting mechanism5.
about 22 nt with a 2-nt 3′ overhang at both ends2. After loading onto As the termini of pre-miRNAs are created by DROSHA, DICER is con-
the Argonaute (Ago) protein, one strand of the duplex remains as a sidered to play a passive role when it comes to the determination of
mature miRNA that functions as a guide to base-pair with the cognate miRNA sequences (Extended Data Fig. 1a). For instance, pre-let-7a-1 is
target17,18. Targeting specificity relies on the precision of processing cleaved essentially at a single site counted from the 5′ end (Extended
because even a small change in the processing site can alter the ‘seed’ Data Fig. 1b)5. However, some pre-miRNAs do undergo alternative pro-
sequence (2–7-nt region relative to the 5′ end of the guide RNA) critical cessing at the DICER level25,26. Most notably, pre-miR-324 is uridylated
for target binding19–21. frequently at the 3′ end, which results in a shift of the DICER cleavage
In human, DICER is known to recognize its substrates by relying solely site27 (Extended Data Fig. 1b).
on their secondary structural features, such as the 2-nt 3′ overhang, a We noticed that the end counting rules cannot fully explain the
dsRNA stem of about 22 base pairs (bp) and a terminal loop3–11. Accord- processing pattern of pre-miR-324 or its variants (Extended Data
ing to the current model, DICER acts as a ‘molecular ruler’ that measures Fig. 1b,c), suggesting that there may be a yet-unknown mechanism
22 nt from the ends of pre-miRNA3–6 (Extended Data Fig. 1a). The 3′ end by which DICER engages in processing. For example, when we used
is recognized by a conserved ‘3′ pocket’ in the PAZ domain of DICER. a pre-miR-324-derived substrate with a symmetric stem and a 3-nt 3′
Some DICER homologues also have a ‘5′ pocket’ in the platform domain overhang, it was cleaved at three sites (Extended Data Fig. 1c, lane 3).
Center for RNA Research, Institute for Basic Science (IBS), Seoul, Republic of Korea. 2School of Biological Sciences, Seoul National University, Seoul, Republic of Korea. 3These authors
1
1
2
3
n−2
n−1
n
Input miRNA
DICER Adapters
Position
1
1 Wobble pair 1 C
2 A
3 2 Mismatch 2 U
3 3
A G A U A A C G 5p 3p 5p 3p
−1 1.5
0 C G
1 4 G C −1
log2[Cleavage score
for pre-miR-374b]
C C
Position
C G 1.0 0
Density
2 A U
C C
0.5 1
C G
0 G U
C C 0 1.6 0 1.6 0 1.6 0 1.6
rs = 0.41
0 log2[observed/expected]
0 2 4 weighted by cleavage score
log2[Cleavage score
for pre-let-7a-1]
g h
Pre-let-7a-1 Pre-miR-374b −1 to 1 Pre-let-7a-1 Pre-miR-374b
Cumulative fraction
1.00 ppm 5
Cleavage score
ppp
U A C G
U A C G
5
0.75 pmp 4
pmm 4
5p
5p
0.50 mpp 3
mpm 3
0.25 2
mmp
mmm G C A U G C A U
0
3p 3p
0 5 10 15 0 5 10 15
Cleavage score Cleavage score
Fig. 1 | Massively parallel assay identifies the GYM motif. a, Schematic measured from the second screening. Top five motifs in each backbone are
outline of the massively parallel assay. b, Substrate design for the first shown. Analyses were carried out using data from the condition for which
screening (n = 1,048,576 variants). Sequence variation was introduced to five about 20% of substrates were cleaved, which is true also for f–h. rs, Spearman
base pairs at the positions −1 to 3 relative to the starting position of 3p miRNA. correlation coefficient. f, Enrichment of sequences of the top 1% variants.
c, Massively parallel assay results from the first screening. Structural (left) and Expected proportions were calculated by assuming that the four bases have
sequence (middle and right) preferences of DICER substrates at the indicated equal contributions to the total cleavage score of the top 1% variants.
positions are shown. Proportions of the features within the top 0.1% of variants g, Structural impact on cleavage scores. G–U pair was considered as a mismatch
were weighted by their cleavage scores. Variants with more than 100 read only when it is in between mismatches. p, pair; m, mismatch. h, Impact of the
counts in the input were included in this analysis. d, Substrate design for the base combinations at position 1 on cleavage scores. Variants with base pairs at
second screening (n = 4,096 variants). Sequence variation was introduced to all but position 1 were included in this analysis.
three base pairs at the positions −1 to 1. e, Distribution of the cleavage scores
The 5′ and 3′ counting rules explained products A and B, respectively, the substrate pool was cleaved, the uncleaved RNAs were gel-purified
but not product C. Another variant with an alteration near the cleavage and sequenced by the accurate quantification by sequencing (AQ-seq)
site failed to generate product C (Extended Data Fig. 1c, lane 4), suggest- method that allows efficient ligation of structured RNAs25,28. The pro-
ing that there may be a critical element near the cleavage site. As previ- cessing efficiency was quantified by dividing the fraction of each variant
ous studies focused only on secondary structures outside this region in the input population by that of the uncleaved reads after reaction
and have not investigated the substrate specificity in a comprehensive (Fig. 1a). We refer to this metric as the ‘cleavage score’.
manner, it remains unknown whether and how DICER recognizes its To identify the determinants for processing, we examined the
substrates in a sequence-specific manner. pre-miRNA variants scoring within the top 0.1%. These top variants
showed an overall tendency for base-pairing as expected (Fig. 1c, left
panel). However, we found that a mismatch was enriched at position
Identification of a sequence motif 1. In addition to this structural feature, we found some sequence pref-
To comprehensively interrogate the upper stem region, we imple- erences (Fig. 1c, middle and right panels). At positions −1 and 0, the
mented a massively parallel assay that enables quantitative testing of 5′-C–G-3′ pair and 5′-G–C-3′ pair were strongly favoured, respectively.
a large number of variants (Fig. 1a). In brief, we synthesized 1,048,576 At position 1, G is depleted and C is enriched on both strands. Sequence
pre-let-7a-1 variants by randomizing the sequences within a 5-bp win- preference was less prominent at positions 2 and 3.
dow in the upper stem (−1 to +3 relative to the cleavage site in the 3p To increase the sequencing depth, we carried out a second round of
strand) that is predicted to contact DICER in our structural model massively parallel assays, with two 3-bp windows (randomizing posi-
(Fig. 1b and Extended Data Fig. 2a,b). After a brief incubation with puri- tions −1 to 1 and 1 to 3) to generate 4,096 variants per window (Fig. 1d
fied human DICER protein (Extended Data Fig. 2c,d), in which 5% of and Extended Data Fig. 2b). In addition, we used another pre-miRNA
Relative cleavage
* 1.00 $ 8 & & & & * & 2
GCm
UAm
GCp
UAp
WT
0.75
80 nt 0.50 ** ** ** * Human DICER d Fly Dcr-1
70 nt
60 nt Relocated Relocated
0.25 ***
50 nt 0
GCm
GCm
GCm
GCm
UAm
UAm
GCp
GCp
40 nt
p
Am
Ap
T
C
W
U
G
U
G
30 nt
c Fly Dcr-1
Relative cleavage
1.00
0.75
Cleaved 20 nt 0.50
*** *** *** 22 nt
products
1 2 3 4 5 0.25 ***
1 2 3 4 5 6 7 8
0
p
Am
Ap
T
C
W
U
G
U
e G f
UAp GCm
Duplex DICER
$ 8 & *
8 $ * &
* & & &
3′ over- dsRBD
RIIIDb R1898
hang (nt): 1 2 3 1 2 3
22 nt
22 nt RIIIDa R1855
dsRBD
E1859 –1
* 22 nt 0
3′ pocket 1
5′ pocket Pre-miRNA
1 2 3 4 5 6
GCm
GCm
UAm
UAm
GCp
GCp
Pre-let-7a-1 DICER ΔdsRBD
NS Relocated by 1 bp
Relative cleavage
1.00
GCm GCm UAm GCp Position
0.75
* & * & * & * & −2
0.50 & * $ 8 $ 8 $ 8 −1
0.25 *** *** * & & * $ 8 & * 0
& & * & 8 $ * & 1 22 nt
0 $ 8 & & & & * & 2
*
* 1 2 3 4 5 6 7 8
m
p
Am
Ap
C
C
U
G
U
G
Fig. 2 | The GYM motif recognized by the dsRBD enhances pre-miRNA resolved on a urea–polyacrylamide gel (right). The products from 5′ counting,
processing and determines the cleavage site. a, In vitro processing of pre- 3′ counting and the GYM motif are indicated with purple, green, and dark blue
let-7a-1 variants by human DICER. RNA substrates vary in their sequences at arrowheads, respectively. f, A structural model of human DICER in a dicing
positions −1 to 1 (top). Pre-let-7a-1 variants were processed by human DICER and state. The structures of human DICER with a pre-miRNA substrate in a
resolved on a urea–polyacrylamide gel (left). Relative cleavage was calculated pre-dicing state (PDB: 5ZAL)23 and Aquifex aeolicus RNase III with a dsRNA
by quantifying the band intensity (1 − uncleaved/input) (right). Bars indicate substrate (PDB: 2EZ6)39 were used for structural modelling (left). RNase III a
mean ± s.d. (n = 3, independent experiments). **P < 0.01, ***P < 0.001 by (RIIIDa) and RNase III b (RIIIDb) are shown in blue and green, respectively. The
two-sided Student’s t-test compared to GCm. WT, wild type. b, In vitro dsRBD (marked in red) is in the vicinity of the GYM motif (marked in yellow)
processing of duplex variants by human DICER. RNA substrates vary in their (right). g, In vitro processing of pre-let-7a-1 variants by DICER(ΔdsRBD). Bars
sequences at positions −1 to 2 (top). Duplex variants were processed by human indicate mean ± s.d. (n = 3, independent experiments). ***P < 0.001 by
DICER and resolved on a urea–polyacrylamide gel (bottom). Cleavage products two-sided Student’s t-test compared to GCm; NS, not significant. h, In vitro
and their corresponding cleavage sites are marked with arrowheads. c, In vitro processing of duplex variants by either the DICER(ΔdsRBD) or DICER(AA)
processing of pre-let-7a-1 variants by fly Dcr-1. Bars indicate mean ± s.d. (n = 3, mutant. RNA substrates vary in their sequences at positions −1 to 2 (left).
independent experiments). ***P < 0.001 by two-sided Student’s t-test compared Duplex variants were processed by human DICER and resolved on a urea–
to GCm. d, In vitro processing of duplex variants by fly Dcr-1. e, In vitro polyacrylamide gel (right). The cleavage product and its corresponding
processing of duplex variants by human DICER. The duplexes had a mismatch cleavage site marked with the arrowhead are largely unaffected by the GYM
at the terminus (marked in orange) so that the 5′ end can be incorporated into motif variations, which contrasts the result from WT DICER shown in b,d.
the 5′ pocket (left). Duplex variants were processed by human DICER and *, radiolabelled 5′ phosphate. For gel source data, see Supplementary Fig. 1.
leucine (R1855L) or alanine (R1855A) were both sufficient to reduce the that E1859 also contributes to the motif recognition (Fig. 2f and
site-specific recognition of the mismatch in the GYM motif (Extended Extended Data Fig. 6b,c). The R1855L mutant and the double mutant
Data Fig. 6c). We further interrogated the other two highly conserved (R1855A/E1859A, or ‘AA’) lost their ability to favour a mismatch at posi-
residues—E1859 and R1898—situated near the mismatch and found tion 1 (for efficiency, compare Fig. 2a with Extended Data Fig. 6d,e; for
log2[Fold change
log2[Fold change
let-7d-5p
in abundance]
in abundance]
let-7f-5p
3 let-7d-5p 2 let-7i-5p
let-7f-5p
0 let-7i-5p 0 miR-21-5p
Transfection
–3 miR-21-5p –2 miR-29b-3p
–6 miR-222-3p –4 miR-222-3p
miR-29b-3p miR-27b-3p
DICER-null cells –9 miR-27b-3p –6
0 5 10 15 20 0 5 10 15 20
log2[Abundance (RPM)] log2[Abundance (RPM)]
AQ-seq
c d 5p 3p
Pre-miR-27b miR-324-3p
log2[Fold change in
40
affected miRNAs
0
main 5′-isomiR]
WT Mutant 1 Mutant 2 Position
ΔdsRBD/WT
Number of
30
& * & * * & −1 miR-7-1-3p
–2 20
$ 8 $ 8 8 $ 0 miR-142-3p
$ 8 * 8 * 8 1 10
–4 let-7e-3p miR-330-3p
63 27 15 : GYM score miR-30c-1-3p miR-34a-3p 0
WT ΔdsRBD R1855L 0 5 10 15 5p 3p
NS NS
1.0 NS NS miR-324-3p 20
log2[Fold change in
1
Relative cleavage
affected miRNAs
main 5′-isomiR]
*** miR-7-1-3p
R1855L/WT
15
Number of
0
0.5 10
*** –1 let-7e-3p
miR-30c-1-3p 5
miR-331-3p
–2 miR-142-3p
0 miR-34a-3p 0
2 2 2 0 5 10 15 5p 3p
nt nt nt
t1
t1
t1
M WT
M WT
M WT
a a a
an
an
an
ut ut ut log2[Abundance in WT (RPM)]
ut
ut
ut
M M M
Alternative
10 20 30 −5 −4 −3 −2 −1 0 1 2 3 40
0
1
2
3
−5
−4
−3
−2
−1
Sea snail (n = 53)
Average Planarian (n = 105) Starting position of 3-bp window
Sea anemone (n = 28) (relative to the 5′ end of 3p)
Fig. 3 | Endogenous miRNAs are regulated by the dsRBD in a GYM-motif- accuracy. Grey, unannotated strand. Bar graphs show the number of miRNAs
dependent fashion. a, Schematic outline of the rescue experiment (n = 2, whose main 5′-isomiR was significantly affected by the mutation (P < 0.01 by
biological replicates). b, Comparison of miRNA abundance. Spike-ins were two-sided Student’s t-test) (right). e, Schematic outline of conservation
used for normalization. RPM, reads per million. c, In vitro processing of analysis of GYM motifs on pre-miRNAs (left). Distribution of the GYM motif at
pre-miR-27b variants by either DICER WT or dsRBD mutants. RNA substrates, the indicated positions in natural pre-miRNAs across species (right). C. elegans,
radiolabelled at their 5′ end, vary in their sequences at positions −1 to 1, having Caenorhabditis elegans; C. briggsae, Caenorhabditis briggsae; P. pacificus,
different GYM scores (top). Relative cleavage was calculated by quantifying the Pristionchus pacificus. f, The association between the GYM score and
band intensity (1 − uncleaved/input) (bottom). Bars indicate mean ± s.d. (n = 3, alternative processing. miRNAs registered in miRGeneDB were included in this
independent experiments). ***P < 0.001 by two-sided Student’s t-test analysis. For a given miRNA, if the proportion of the most abundant 5′-isomiR is
compared to the WT substrate. d, Comparison of cleavage accuracy (left). For a over 80%, it was classified into the homogeneous processing group (n = 203).
given miRNA, the most abundant 5′-isomiR was identified in the WT sample. Otherwise, it was classified into the alternative processing group (n = 76).
Then the fold change of its proportions was quantified to estimate cleavage
cleavage site choice, compare Fig. 2b with Fig. 2h and Extended Data The miRNA abundance was reduced when the dsRBD was deleted
Fig. 6f). Taken together, these findings indicate that DICER recognizes or when the R1855 and E1859 residues were mutated (Fig. 3b and
the mismatched M mainly using its highly conserved R1855 and E1859 Extended Data Fig. 7a,c). Some conserved and abundant miRNAs were
residues of the dsRBD to ensure efficient and precise processing. strongly affected, prompting us to investigate whether these miRNAs
are produced in a GYM-dependent manner. In vitro processing assays
showed that alterations in the dsRBD reduced the DICER activity on
Role of GYM motif in miRNA biogenesis pre-miR-27b, pre-miR-21, pre-let-7d, pre-let-7f-1 and pre-let-7i, thus
We next asked whether the GYM motif is biologically relevant in the requiring a longer incubation time (Fig. 3c and Extended Data Fig. 8).
context of endogenous miRNA maturation. The wild-type or mutant Weakening variations in the GYM motif of the pre-miRNAs decreased
DICER proteins were ectopically expressed in DICER-knockout HCT116 processing efficiency, and this GYM motif effect was diminished when
or HEK293T cells (Fig. 3a). Small RNAs were sequenced by the AQ-seq the dsRBD was mutated. Collectively, our data demonstrate that the
protocol for bias-minimized quantification that allows reliable com- interaction between the GYM motif and the DICER dsRBD promotes
parison between miRNA isoforms (isomiRs)25 (Extended Data Fig. 7). miRNA processing both in cells and in vitro.
(shRNA-3p/miR-1-3p)
& * & * * & −1 1.00
FLuc/RLuc relative
to control shRNA
$ 8 $ 8 $ 8 0 0.8 GUp
& & * & * & 1 0.75 *** GUm
0.6
91 50 21 : GYM score 0.50 *** 0.4
Variable region
0.25 0.2
shRNA-3p 5′ - UCACGCUGAACUUGUGGCCUn - 3′
(guide) 0 0
Un FLuc mRNA 3′ -A AGUGCGA CUUGA A CA CCGGUUG - 5′
6 9 12 24
GUm
GUp
CUp
(target)
Incubation time (h)
FLuc/RLuc relative
GUm GUp CUp Position
to control DsiRNA
0.8 GUp Motif
& * & * * & −1 Dicer Dicer
$ 8 $ 8 $ 8 0 0.6 GUm
dsRBD dsRBD
& & * & * & 1
0.4
Variable region 0.2
DsiRNA-3p 5′ - UCUACGUCAACUUGUAUUCCUU - 3′
(guide) 0
FLuc mRNA 3′ -A AGA UGCAGUUGA A CA UA AGG A A - 5′ 6 9 12 24
(target) Incubation time (h)
Alternative processing Efficient and accurate processing
f g
GCm GCp CCp Position Formation of RNA-induced silencing complex
1.0
& * & * * & −1 CCp
FLuc/RLuc relative
to control DsiRNA
Fig. 4 | The GYM motif enhances gene silencing potency. a, Design of two-sided Student’s t-test compared to GUm. c, Luciferase assay. FLuc signals
3p-dominant shRNAs with optimal (GUm), suboptimal (CUp) and poor (CUp) were normalized to Renilla luciferase (RLuc) signals. A control shRNA that does
GYM motifs. The sequence variation does not affect the mature siRNA not target FLuc was used to measure gene silencing activities. Points and bars
sequence. shRNA was encoded in a plasmid that also encoded pri-miR-1-1 under indicate mean ± s.d. (n = 3, biological replicates). d, Design of 3p-dominant
an independent promoter. ‘Un’ indicates a varying number of uridines that DsiRNAs with varying GYM motifs. e, Luciferase assay. Points and bars indicate
originate from the RNA polymerase III termination signal. FLuc, firefly luciferase. mean ± s.d. (n = 3, biological replicates). f, Design of 5p-dominant DsiRNAs with
b, shRNA levels at 12 h measured by quantitative real-time PCR. The TaqMan varying GYM motifs. g, Luciferase assay. Points and bars indicate mean ± s.d.
probe was designed to target the mature shRNA that is the same among the (n = 3, biological replicates). h, A proposed model of Dicer processing.
variants. Bars indicate mean ± s.d. (n = 3, biological replicates). ***P < 0.001 by
Extended Data Fig. 1 | A yet-unknown mechanism of DICER processing bulge27. A mismatch near the cleavage was replaced with a base-pair marked in
mediated by the upper stem region. a, Illustration of the mechanism of pink. Cleavage sites and their corresponding products are marked with
cleavage site choice by DICER. b, Cleavage site decision of pre-let-7a-1 and arrowheads. For gel source data, see Supplementary Fig. 1. *, radiolabeled 5′
pre-miR-324. c, In vitro processing of a pre-miR-324 variant by DICER. phosphate.
“No-bulge pre-miR-324” was used for this assay to avoid the influence of the
Extended Data Fig. 2 | Design of the massively parallel assay. a, A structural 1 to 3 relative to the starting position of 3p miRNA) were targeted for
model of human DICER in a dicing state. The dsRNA was modeled into the randomization based on the structural model. Secondary structures of
cryo-EM structure of human DICER 23, based on the crystal structure of dsRNA- pre-miRNAs were obtained using RNAstructure 52. c, SDS-PAGE of purified
bound Aa RNase III39. DICER dsRBD was then superimposed with that of Aa proteins. For gel source data, see Supplementary Fig. 1. d, Size-exclusion
RNase III to predict its position in a dicing state. b, Pre-miRNAs used in the chromatography of purified proteins.
massively parallel assay. The 5-bp and 3-bp windows (positions –1 to 3, –1 to 1,
Article
Extended Data Fig. 3 | Massively parallel assays performed with substrates cleavage scores of variants between different conditions of varying reaction
with −1-to-1 or 1-to-3 randomization. a–b, Distribution of read counts of time. i, Distribution of the cleavage scores measured from the 2nd screening
variants. c–d, Distribution of cleavage scores of variants. e–h, Correlation of with 1-to-3 randomization.
Extended Data Fig. 4 | Massively parallel assay reveals structural and mismatches. p, pair; m, mismatch. c–d, Impact of the base combinations at the
sequence preferences at position 1. a–b, Structural impact on cleavage 1 position on cleavage scores. Variants with base-pairs at all but position 1 were
scores. G–U pair was considered as a mismatch only when it is in between included in this analysis.
Article
Extended Data Fig. 6 | R1855 and E1859 of the DICER dsRBD are important indicated reaction time. Bars indicate mean (n = 2, independent experiments) (d)
for recognition of the mismatch. a, In vitro processing of pre-let-7a-1 variants or mean ± SD (n = 3, independent experiments) (e). *p < 0.05, ***p < 0.001 by
by human DICER ΔdsRBD with the indicated reaction time. b, Amino acid two-sided Student’s t test compared to GCm. †, nicked products at the 3p
sequence alignment of dsRBDs of metazoan DICERs. c, In vitro processing of positions. f, In vitro processing of duplex variants by DICER AA mutant. The
duplex variants by human DICER point mutants at the indicated position. cleavage product and its corresponding cleavage site marked with the
Cleavage products and their corresponding cleavage sites are marked with arrowhead are largely unaffected by the GYM motif variations, which contrasts
arrowheads. *, radiolabeled 5′ phosphate. d,e, In vitro processing of pre-let-7a-1 the result from WT DICER shown in Fig. 2b, d. For gel source data, see
variants by either DICER R1855L (d) or R1855A/E1859A (AA) (e) with the Supplementary Fig. 1.
Extended Data Fig. 7 | Mutating the DICER dsRBD reduces efficiency and the WT sample. Then the fold change of its proportions in each sample was
accuracy of DICER processing. a, c, Comparison of miRNA expressions in measured as cleavage accuracy. Grey, unannotated strand. Bar graphs show the
either HCT116 (a) or HEK293T (c). Spike-ins were used for normalization. RPM, number of miRNAs whose major 5′-isomiR was significantly affected by the
reads per million. b, d, Comparison of cleavage accuracy in either HCT116 (b) or mutation (p < 0.01 by two-sided Student’s t test).
HEK293T (d). For a given miRNA, the most abundant 5′-isomiR was identified in
Article
Extended Data Fig. 8 | Processing of pre-miRNAs are regulated by the GYM performed with different time points as indicated. For gel source data,
motit recognized by the DICER dsRBD. a–c, In vitro processing of variants of see Supplementary Fig. 1. Bars indicate mean ± SD (n = 3, independent
pre-miR-27b (a), pre-miR-21 (b), and pre-let-7d/f-1/i (c) by either DICER WT or experiments). *p < 0.05, **p < 0.01, ***p < 0.001 by two-sided Student’s t test
ΔdsRBD. Pre-miRNAs were radiolabeled at their 5′ end. Reactions were compared to the WT substrate. †, nicked products at the 3p positions.
Extended Data Fig. 9 | Examples of miRNAs whose DICER cleavage sites are The annotation in miRBase release 21 was used as a reference. Cleavage sites
affected by mutation of the DICER dsRBD. a–b, The usage of 5′ ends of and their corresponding positions are marked with arrowheads. RPM, reads
miRNAs in the DICER-knockout HCT116 cells rescued with indicated DICER. per million.
Article
Extended Data Fig. 10 | The DICER dsRBD-GYM motif interaction plays a scores at the position −1 of human pre-miRNAs. miRNAs registered in
critical role in cleavage site decision of endogenous miRNAs. a, c, The usage miRGeneDB (n = 383) were included in this analysis. The dashed line indicates
of 5′ ends of miR-34a-3p (a) or 3′ ends of let-7e-5p and 5′ ends of let-7e-3p (c) in the average of GYM scores of the surrounding positions (−2 and 0). f, Alternative
the DICER-knockout HCT116 cells rescued with indicated DICER. The processing of pre-miR-9. Cleavage sites were inferred from 5′ ends of miR-9-3p
annotations in miRBase release 21 were used as references. Corresponding in the DICER-knockout HCT116 cells rescued with DICER WT. Average
positions of the major cleavage sites are marked with arrowheads. RPM, reads proportions are indicated at the corresponding cleavage sites marked with
per million. b, d, In vitro processing of pre-miR-34a variants (b) or pre-let-7e arrowheads. g, In vitro processing of pre-miR-9-1 by DICER. The GYM score for
variants (d) by either DICER WT or ΔdsRBD. Pre-miRNAs were radiolabeled at each window (grey and colored boxes) is shown. Pre-miRNAs were radiolabeled
their 5′ end. Major cleavage products and their corresponding cleavage sites at their 5′ end. Major cleavage products and their corresponding cleavage sites
are marked with arrowheads. Reactions were performed with different time are marked with arrowheads. For gel source data, see Supplementary Fig. 1.
points as indicated because DICER ΔdsRBD has reduced activity. e, The GYM
Article
https://doi.org/10.1038/s41586-023-05723-3 Young-Yoon Lee1,2,4, Hansol Lee2,3,4, Haedong Kim1,2,4, V. Narry Kim1,2 ✉ & Soung-Hun Roh2,3 ✉
Accepted: 14 December 2022 Dicer has a key role in small RNA biogenesis, processing double-stranded RNAs
Published online: 22 February 2023 (dsRNAs)1,2. Human DICER (hDICER, also known as DICER1) is specialized for cleaving
small hairpin structures such as precursor microRNAs (pre-miRNAs) and has limited
Check for updates
activity towards long dsRNAs—unlike its homologues in lower eukaryotes and plants,
which cleave long dsRNAs. Although the mechanism by which long dsRNAs are
cleaved has been well documented, our understanding of pre-miRNA processing is
incomplete because structures of hDICER in a catalytic state are lacking. Here we
report the cryo-electron microscopy structure of hDICER bound to pre-miRNA in a
dicing state and uncover the structural basis of pre-miRNA processing. hDICER
undergoes large conformational changes to attain the active state. The helicase
domain becomes flexible, which allows the binding of pre-miRNA to the catalytic
valley. The double-stranded RNA-binding domain relocates and anchors pre-miRNA
in a specific position through both sequence-independent and sequence-specific
recognition of the newly identified ‘GYM motif’3. The DICER-specific PAZ helix is
also reoriented to accommodate the RNA. Furthermore, our structure identifies a
configuration of the 5′ end of pre-miRNA inserted into a basic pocket. In this pocket,
a group of arginine residues recognize the 5′ terminal base (disfavouring guanine)
and terminal monophosphate; this explains the specificity of hDICER and how it
determines the cleavage site. We identify cancer-associated mutations in the 5′ pocket
residues that impair miRNA biogenesis. Our study reveals how hDICER recognizes
pre-miRNAs with stringent specificity and enables a mechanistic understanding of
hDICER-related diseases.
Small regulatory RNAs serve as guide molecules in RNA interference away from the 5′ end (‘5′ counting rule’) and 3′ end (‘3′ counting rule’)
(RNAi) by inducing translational repression and destabilization of the of the substrate7,12,16,17. In addition, the GYM motif at the cleavage site
cognate mRNAs4–6. Central to the pathway is the ribonuclease (RNase) enables the cleavage site to be precisely determined (see the partner
III enzyme Dicer, which cleaves long dsRNAs or short hairpin RNAs to paper to this one3). However, the structural basis of the substrate
generate small RNAs of 21–25 nucleotides (nt) in length1,2. Dicer homo- specificity of hDICER remains largely unknown, owing to the lack of
logues are found throughout eukaryotes and show substantial diversity an active-state structure.
in their substrate specificity and mechanism of action. Some Dicer Early electron microscopy (EM) analyses of hDICER revealed its over-
proteins are specific to long dsRNAs, as observed in structural and bio- all L-shape21–23. Crystal structures of a partial fragment containing the
chemical studies on Giardia Dicer, fly Dicer-2 (Dcr-2) and plant Dicer-like platform–PAZ domain showed the 5′ and 3′ pockets, which recognize
proteins7–12. By contrast, other homologues, such as fly Dicer-1 (Dcr-1), the respective ends of a small RNA duplex20. A more recent cryo-electron
are highly selective to hairpin-shaped pre-miRNAs13. hDICER can cleave microscopy (cryo-EM) study showed the overall topology of full-length
both types of substrate, with a clear preference for short hairpins over hDICER in the apo and RNA-bound states24. However, in this structure,
long dsRNAs14,15. the pre-miRNA is situated distant from the catalytic valley, probably
hDICER recognizes several features of its substrates: a dsRNA stem representing a ‘pre-dicing’ state. Thus, we still lack a structural under-
of approximately 22 bp; a 2-nt 3′ overhang; and a flexible loop next to standing of how hDICER recognizes pre-miRNAs in an active state.
the cleavage site7,12,13,16–19. The flexible loop is known to be sensed by Here we aimed to determine the cryo-EM structure of hDICER with
the helicase domain13,14, whereas the 5′ phosphorylated end and the 3′ pre-miRNA in a cleavage-competent state. The structure reveals
overhang are recognized by basic pockets in the platform and the PAZ dynamic spatial rearrangements of several domains of hDICER dur-
(Piwi–Argonaute–Zwille) domains, respectively16,17,20. By anchoring the ing the transition to a catalytic state, and explains how hDICER selects
termini, hDICER can act as a ‘molecular ruler’ to measure around 22 nt its substrates with specificity.
Center for RNA Research, Institute for Basic Science (IBS), Seoul, Republic of Korea. 2School of Biological Sciences, Seoul National University, Seoul, Republic of Korea. 3Institute of Molecular
1
Biology and Genetics, Seoul National University, Seoul, Republic of Korea. 4These authors contributed equally: Young-Yoon Lee, Hansol Lee, Haedong Kim. ✉e-mail: narrykim@snu.ac.kr;
shroh@snu.ac.kr
Overall structure in a dicing state Stem recognition by the dsRBD and RIIID
The structure of the hDICER–pre-let-7a-1GYM complex shows that the Near the catalytic sites in the upper stem of pre-miRNA, we observed a
pre-miRNA is fully docked and poised for cleavage within the catalytic pronounced movement of the C-terminal dsRBD (Fig. 2a), mediated
centre that is formed by intramolecular dimerization of RIIIDa and by the flexible linker that connects to the RIIIDb. This RNA-induced
RIIIDb (Fig. 1d). The catalytic centre has two clusters of conserved acidic conformational switching orients the dsRBD away from the inner core
U U U C U G U C A U C U A A C A U A C C G A U A
U C G A
3′ 70 60 PAZ
50
GYM motif
d e f
RIIIDb RIIIDb
26G dsRBD D1810
46A E1813
Ca2+
Ca2+ 22U
ut
23U C
RIIIDa E1705
D1709
D-linker
180°
D1320
t
Cu
Connector E1316
52C 51G
Ca2+
E1564
Pre-miRNA D1561 RIIIDa
5′-1U
Negative Positive
Platform 3′-73U
PAZ
Fig. 1 | Cryo-EM structure of hDICER in complex with a pre-miRNA in a interactions in the dicing state at the domain level. Sequences of pre-let-7a-1GYM
dicing state. a, Domain organization of hDICER. Schematics for the apo and that are not included in the model are not shown. d, Overall structure of the
dicing states indicate amino acid residues that are included (solid lines) or not hDICER with a pre-miRNA in a cleavage-competent state. Black arrowheads
included (dashed lines) in the model. C-linker, connector linker; DUF, domain of point to the DICER cleavage sites. e, Magnified views of the catalytic sites in the
unknown function. b, Cryo-EM map of hDICER in a dicing state (colour, 3.0 Å) RIIIDa and RIIIDb domains. f, Electrostatic potential surface model of the
overlaying that of hDICER in an apo state (grey, 4.0 Å). c, Protein–RNA catalytic valley along the protein–RNA interface.
of the catalytic valley and relieves the steric clash between the dsRBD by protein–RNA interactions that are unique to a certain group of Dicer
and dsRNA (Extended Data Fig. 6a) so as to permit dsRNA recognition. homologues.
With respect to its original position in the apo and pre-dicing states, In addition to the dsRBD, the RIIIDa and RIIIDb domains wrap around
the dsRBD swings about 12.6 Å and 16.5 Å, respectively (Fig. 2a and the RNA, forming extensive electrostatic interactions with the upper
Extended Data Fig. 6a). stem region of the pre-miRNA. As well as the contacts at the catalytic
Of note, close to the dsRBD–dsRNA interface, we observed a large core of the DICER cleavage sites, the RIIIDa, situated on the opposite
change in the helical structure of dsRNA, which deviates from the face to the dsRBD-binding site, makes tight interactions with the RNA
ideal A-form dsRNA structure (Fig. 2b). This conformational distor- in the minor groove (Fig. 2c). We observed that α-helices 2 and 3 of
tion expands the width of the major groove of pre-let-7a-1GYM to 15.6 Å, RIIIDa potentially interact with the ribose sugars and internucleotide
compared with 8.0 Å in the ideal A-form RNA. The successive major and phosphate groups (Fig. 2d). The symmetrically located α-helices 2
minor grooves across the region are sandwiched between dsRBD and and 3 in the RIIIDb may also participate in dsRNA recognition (Fig. 2e).
RIIIDa, and form extensive interactions with both domains (Fig. 2c), Interacting with the distorted dsRNA, the dsRBD adopts a canoni-
suggesting a possible basis for the local distortion in the dsRNA struc- cal αβββα topology to cover the dsRNA across the minor and major
ture. Similar observations were made in the high-resolution cryo-EM grooves (Fig. 2c). Basically, the reoriented dsRBD interacts with the
structure of Arabidopsis DCL-3 (AtDCL3), in complex with a pre-siRNA9 RNA backbone through its mostly basic patch on the surface (Extended
(Extended Data Fig. 6b), implying that the conformational distortion in Data Fig. 6c). For instance, in the major groove, the positively charged
the dsRNA helix is not specific to the pre-let-7a-1 sequence, but induced residues contact the RNA backbone near 19C (Fig. 2f and Extended Data
90°
8.0 Å
15.6 Å
12.6 Å
3′
Apo state 5′
c d e
S1352 α2 N1742
Major Major α2
RIIIDb
groove groove
Minor
groove f g
α2 GYM
R1898 α2
R1855 19C
α3 α1 53C
K1901
α2 α1
α5 19C
α4
α1 K1866
E1859
α6 RIIIDa
Fig. 2 | Sequence-specific and non-specific binding to RNA by the dsRBD electrostatic interactions with the RNA backbone are displayed as balls.
and RIIID domains. a, Conformational change in the dsRBD during the e, Protein–RNA interactions in the interface between RIIIDb and the RNA
transition from an apo state to a dicing state. Black arrowheads near RNA backbone. Residues that may engage in electrostatic interactions with the
backbones indicate cleavage sites. b, Comparison between the structures of RNA backbone are displayed as balls. f, Non-sequence-specific interactions
ideal A-form dsRNA helix and pre-let-7a-1GYM. c, Protein–RNA interactions near between the dsRBD and the RNA phosphate backbone. g, Sequence-specific
the cleavage sites in the minor groove. d, Protein–RNA interactions in the interactions between the dsRBD and the C–C mismatch of the GYM motif.
interface between RIIIDa and the RNA backbone. Residues that may engage in
Fig. 6d). In the minor groove, however, we observed a sequence-specific This ‘PAZ helix’ (also known as hDICER-specific helix) separates the 5′
interaction between the dsRBD and the RNA. The α-helix 1 of the dsRBD and 3′ pockets and orients the bound RNA away from the surface of
is situated in the vicinity of the GYM motif (Fig. 2c,g), the cis-acting hDICER, which is thought to occur in a product-release state and/or
element that markedly improves the fidelity of processing (see the pre-dicing state20 (Extended Data Fig. 7a, middle). This helix, however,
partner paper3). An arginine residue (R1855) in α-helix 1 protrudes may be dynamic given that an additional ‘melted’ conformation of
into the minor groove and may form hydrogen bonds with the C–C the PAZ helix was observed in the platform–PAZ–small RNA duplex
mismatch (Fig. 2g and Supplementary Video 1). This is consistent with complex20 (Extended Data Fig. 7a, right). Indeed, we found a large con-
the observation that mutating this arginine residue abolishes the effect formational change in the PAZ helix resulting in a tilt angle of around
exerted by the mismatch3. Thus, in contrast to previous papers that 54° from its position in the pre-dicing state (Fig. 3a). The PAZ helix is
suggest an auxiliary function of the hDICER dsRBD31,32, our structure consequently located near the lower stem region of pre-miRNA (Fig. 3a
provides the structural basis for its predominant role in the selection of and Supplementary Video 2). Together, our findings show that the spa-
the cleavage site, which can even override the effects of 5′ and 3′ count- tial rearrangement of the PAZ helix is necessary to allow the pre-miRNA
ing mechanisms3. Together, our data indicate that the dsRBD and RIIID to be aligned parallel to the catalytic valley for subsequent cleavage
domains anchor the upper region of the pre-miRNA and induce local (Extended Data Fig. 7b).
distortion of the RNA, which facilitates the recognition of not only the In addition, this conformational change puts the short stretch of
RNA backbone but also the GYM motif. positively charged amino acids (1019KRKAK1023) in the vicinity of the
negatively charged backbone of the 3p strand (Fig. 3b). To assess
the importance of the observed interaction between the PAZ helix
Role of the PAZ helix in a dicing state and the dsRNA, we introduced mutations by replacing the positively
A previous structural study on a hDICER fragment containing the plat- charged residues with five glutamate (E5) or alanine (A5) residues, or by
form–PAZ domain showed a knob-like protrusion with a small α-helical deleting the helix (ΔPAZh) (Fig. 3c). The PAZ-helix-mutant proteins were
segment within the PAZ domain, which is specifically found in Dicer20. purified (Extended Data Fig. 1b,c) and incubated with pre-let-7a-1 to
Pre-dicing state
PAZ helix
65U
90° 66G
~54°
67U
Dicing state
3′
c d
ΔPAZh
Pre-let-7a-1 + U
WT
A5
E5
DICER:
−
(2-nt 3′ overhang)
PAZ helix WT
70 nt 0.4
Fraction diced
60 nt ΔPAZh
50 nt 0.3
1014-/66$(.5.$.:(6/41-1029 A5
40 nt E5
0.2
E5: /66$((((((:(6/41
A5: /66$($$$$$:(6/41 30 nt 0.1
ΔPAZh: /6*6661
Cleaved 0
products 0 10 20 40 60 80 100 120
* U 20 nt
1 2 3 4 5 Reaction time (min)
e f
E5/ WT A5/WT ΔPAZh/WT
WT PAZ-helix mutants 3 3 3
log2[Fold change
log2[Fold change
log2[Fold change
Spike-in Spike-in Spike-in
2 2 2
in abundance]
in abundance]
in abundance]
Transfection 1 1 1
0 0 0
–1 –1 –1
DICER-null HCT116 –2 –2 –2
–3 –3 –3
5 10 15 20 5 10 15 20 5 10 15 20
AQ-seq log2[Abundance (RPM)] log2[Abundance (RPM)] log2[Abundance (RPM)]
Fig. 3 | The PAZ helix reorganizes to accommodate pre-miRNA in a dicing band intensity (1 − uncleaved/input). Squares indicate mean (n = 2, independent
state. a, Conformational change of the PAZ helix between a dicing state (this experiments). Asterisk indicates radiolabelled 5′ phosphate. For gel source
study) and a pre-dicing state24. b, Electrostatic interactions between the data, see Supplementary Fig. 1. e, Schematic outline of the rescue experiment
positively charged PAZ helix and the negatively charged RNA phosphate (n = 2, biological replicates). f, Comparison of miRNA abundance. Spike-ins
backbone. c, Sequences of DICER mutants. d, In vitro processing of mono- were used for normalization. RPM, reads per million.
uridylated pre-let-7a-1. Relative cleavage was calculated by quantifying the
quantitatively measure their effects on the cleavage efficiency in vitro. and Extended Data Fig. 8a,b). In the 3′ pocket, the last phosphodies-
The mutant proteins showed reduced cleavage efficiencies, regardless ter linkage makes close interactions with a cluster of four conserved
of the length of the 3′ overhang (Fig. 3d and Extended Data Fig. 7c,d). tyrosine residues (Y936, Y971, Y972 and Y976) and an arginine residue
PAZ helixE5 showed a more severe effect than PAZ helixA5, presumably (R937) through potential hydrogen bonding, which is in line with previ-
owing to the electrostatic repulsive forces created between the PAZ ous reports20,24 (Fig. 4c).
helix and the RNA backbone. Notably, the deletion of the PAZ helix led The 5′ end of pre-miRNA is in a unique kinked conformation (Fig. 4a),
to a modest but consistent reduction in cleavage efficiency. This result, which is very different from the previous structures of hDICER with
together with the structural observations, implies that the PAZ helix has a small RNA duplex or a pre-miRNA in the pre-dicing state and other
an autoinhibitory effect on the transition to a dicing state besides its Dicer homologues in the dicing state9,20,24 (Extended Data Fig. 8c–g).
contribution to RNA-binding affinity, once the dicing state is achieved. The conformation in our structure allows the 5′ monophosphate to
We next sought to investigate the role of the PAZ helix in miRNA bio- be inserted into the 5′ pocket and possibly interact through hydrogen
genesis by transiently expressing the mutant DICER in DICER-knockout bonds with the main-chain amide and the amine group of two arginine
HCT116 cells, and then performed Accurate Quantification by Sequenc- residues, R996 and R1003, respectively (Fig. 4b and Extended Data
ing (AQ-seq), which reliably profiles cellular miRNAs33 (Fig. 3e). The Fig. 8a). In addition, the 5′ base unexpectedly flips out to interact with
mutations resulted in a global reduction in the abundance of miRNAs a cluster of three arginine residues—R788, R790 and R821—that make
(Fig. 3f), corroborating the in vitro results. Our data collectively suggest hydrogen bonds with the base (Fig. 4b). These results collectively sug-
that the conformational change in the PAZ helix and its subsequent inter- gest that the 3′ pocket is conserved whereas the 5′ pocket may have
action with the RNA backbone are important for pre-miRNA processing. emerged more recently to meet the needs of individual Dicer homo-
logues with different substrate types.
5′-1U
S962
d h
2-nt 3′ overhang
DICER: WT R790Q R821H R1003Q 40 U
Proportion (%)
5′ base: U A G C U A G C U A G C U A G C
30
A
22 nt 20 C
22 nt 30 nt 30 nt
30 nt 30 nt
G
10
5′ counting
*
(2-nt 3′ overhang) 3′ counting 0
20 nt 20 nt 1 2 3 4 5
20 nt 20 nt
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Position relative to the 5′ end
e
3-nt 3′ overhang i
U A CG
DICER: WT R790Q R821H R1003Q Affected
in main 5′-isomiR]
log2[Fold change
log2[Fold change
1
1 miR-324-5p 1
0
let-7a-3p miR-29a-3p 0 0
miR-140-3p 0
–1 let-7i-3p let-7i-3p miR-92a-3p –1 miR-27a-3p –1 let-7g-5p
miR-324-3p miR-17-3p miR-29a-3p
let-7a-5p let-7a-5p
miR-98-3p let-7d-3p miR-140-3p –2 let-7d-5p let-7i-5p –2 let-7i-5p
–2 let-7e-3p miR-203a-3p –1 miR-324-3p let-7e-5p let-7d-5p
miR-142-3p miR-203a-3p miR-98-5p let-7e-5p let-7f-5p miR-98-5p let-7f-5p
miR-98-3p let-7f-1-3p miR-142-3p –3 –3
5 10 15 5 10 15 5 10 15 20 5 10 15 20
log2[Abundance (RPM)] log2[Abundance (RPM)] log2[Abundance (RPM)] log2[Abundance (RPM)]
Fig. 4 | Cancer-associated mutations of the 5′ pocket affect miRNA 5′-isomiR was identified in the wild-type (WT) sample. Grey, unannotated
biogenesis. a, The 5′ and 3′ ends of pre-miRNA anchored in the basic 5′ and 3′ strand. g, Change in abundance of endogenous miRNAs. Spike-ins were used
pockets in the platform and PAZ domains, respectively. b, The 5′-end recognition for normalization. h, Nucleotide composition of human pre-miRNAs. The
by the 5′ pocket through hydrogen bonding. c, The 3′-end recognition by the 3′ proportion of each base at the indicated position relative to the 5′ end of
pocket through hydrogen bonding. d,e, Cancer-associated mutations in the 5′ pre-miRNAs is shown. miRNAs whose 5p is registered in MirGeneDB (https://
pocket impair 5′ counting. In vitro processing of duplex RNAs with either a 2-nt mirgenedb.org/) (n = 502) were included in this analysis. i, The 5′ terminal base
(d) or a 3-nt (e) 3′ overhang and a varying sequence at the 5′ end. The nucleotide identity of pre-miRNAs. Compare the miRNA groups whose major 5′-isomiRs
in the 3p strand opposite to the varying sequence is A. Asterisk indicates are affected by the R821 mutation with those that are unaffected. Affected
radiolabelled 5′ phosphate. For gel source data, see Supplementary Fig. 1. miRNAs (P < 0.05, log 2-transformed fold change > 0.6 or < −0.6); unaffected
f, Changes in cleavage accuracy, estimated with the fold change of the miRNAs (P > 0.05); P value by two-sided Student’s t-test compared to wild type.
proportion of the major 5′-isomiR. For a given miRNA, the most abundant
3′ end trimming and tailing in cells16. Of note, three amino acids in the reduction in the 5′ counting capability, validating our structural obser-
5′ pocket are mutated in diverse cancer types, according to cancer vation that these residues are in close contact with the 5′ end of RNA.
databases including The Cancer Genome Atlas: R790Q (in colon ade- The R821H mutation as well as two other mutations of R821 (R821E and
nocarcinoma); R821H (in colorectal adenocarcinoma); and R1003Q R821A) resulted in a complete loss of 5′ counting (Fig. 4e and Extended
(in uterine endometrioid carcinoma and rectal adenocarcinoma)34,35. Data Fig. 8h).
In vitro, the R821H and R1003Q mutants show defects in cleavage-site To interrogate the effects on miRNA biogenesis, we performed res-
selection; they produced multiple products (21–23 nt) from dsRNA with cue experiments with wild-type and mutant hDICER (Extended Data
a canonical 2-nt 3′ overhang (Fig. 4d, lanes 9–16). Note that wild-type Fig. 8i). We observed marked alterations in the DICER cleavage sites of
hDICER cleaves this substrate homogeneously because the 5′ and 3′ many miRNAs (Fig. 4f and Extended Data Fig. 8j), as indicated by the 5′
counting mechanisms corroborate to ensure the generation of a 22-nt end of 3p miRNAs, which is determined at the DICER processing step
product (Fig. 4d, lanes 1–4). To differentiate the 5′ counting and 3′ (Extended Data Fig. 8k). The DROSHA processing sites (5′ ends of 5p
counting mechanisms more clearly, we next used dsRNA with a 3-nt 3′ mature miRNAs) were largely unaffected, as expected. The most notable
overhang (Fig. 4e). In this assay, all three mutants showed a considerable examples are let-7-3p and miR-324-3p, which are dependent on the 5′
Extended Data Fig. 1 | Purification of hDICER and the hDICER–RNA Coomassie blue staining. Protein concentration for each fraction was
complex. a, The sequence of pre-let-7a-1GYM used for structural determination. estimated by Bradford protein assay, and the same amount of protein was
b, SDS–PAGE of wild-type and mutant hDICER proteins. c, Size-exclusion loaded for each fraction. g, Urea-PAGE of the hDICER–pre-let-7a-1GYM complex
chromatography of purified proteins. d, In vitro processing of pre-let-7a-1 by visualized by SYBR gold staining. RNA concentration for each fraction was
purified hDICER. e, Size-exclusion chromatography of the hDICER–pre-let-7a-1GYM estimated by absorbance at 260 nm, and the same amount of RNA was loaded
complex. f, SDS–PAGE of the hDICER–pre-let-7a-1GYM complex visualized by for each fraction. For gel source data, see Supplementary Fig. 1.
Extended Data Fig. 2 | Cryo-EM image processing procedure for apo-hDICER. colour. f, Local-resolution analysis shown in rainbow scale. g, Domain
a, Overview of the image processing procedure (see Methods). b, Representative organization of hDICER with colour code for each domain. Schematics for the
micrograph and 2D class averages of the apo-hDICER (scale bar, 50 nm). c, Gold- apo state shows amino acid residues included (solid lines) or not included
standard FSC at 0.143 of the apo-hDICER. d, Angular particle distribution heat (dashed lines) in the model. h, Atomic model fitting to the map of apo-hDICER.
map. e, Consensus map of apo-hDICER. Each domain is indicated in a different
Article
Extended Data Fig. 3 | Cryo-EM image processing procedure for hDICER– analysis shown in rainbow scale. g, Domain organization of hDICER with colour
pre-let-7a-1GYM . a, Overview of the image processing procedure (see Methods). code for each domain. Schematics for the dicing state shows amino acid
b, Representative micrograph and 2D class averages of hDICER–pre-let-7a-1GYM residues included (solid lines) or not included (dashed lines) in the model.
(scale bar, 50 nm). c, Gold-standard FSC at 0.143 of the hDICER–pre-let-7a-1GYM. h, Sequence of pre-let-7a-1GYM in the model. i, Atomic model fitting to the map
d, Angular particle distribution heat map. e, Consensus map of hDICER–pre- of hDICER–pre-let-7a-1GYM.
let-7a-1GYM. Each domain is indicated in a different colour. f, Local-resolution
Extended Data Fig. 4 | Overall structure of hDICER in a dicing state. d, Superposition of RIIID domains of hDICER (this study) and Aa RNase III
a, Cryo-EM map of the catalytic site created by RIIIDa. b, Cryo-EM map of the (PDB: 2EZ6, grey)30. e, Active sites of hDICER and Aa RNase III (PDB:2EZ6,
catalytic site created by RIIIDb. c, B-factor and Q-score plots for active site grey)30. f, Buried surface area of hDICER in a pre-dicing state (PDB: 5ZAL)24 and
residues in the hDICER–let-7a-1GYM complex structure. Q-scores for each residue a dicing state. g, RMSD of hDICER–pre-let-7a-1GYM (this study) compared to
were derived from MapQ of Segger tool plugged in Chimera v.1.15. B-factor hDICER–TRBP-pre-let-7a-1mutant (PDB: 5ZAL)24. Residues not resolved in the
values were derived from real space refinement in Phenix ISOLDE v.1.1.0. dicing state are coloured in grey.
Article
Extended Data Fig. 5 | The structure of the helicase domain. a, Interdomain domain in 2D averages. Bound RNA density is indicated in orange. e, Urea-PAGE
interactions in apo-hDICER. b, Steric clash between pre-let-7a-1GYM and of hDICER–pre-let-7a-1GYM complex incubated with or without MgCl2 for 10 min
apo-hDICER. c, Cryo-EM map of the hDICER–pre-miR-3121GYM complex in a at room temperature, visualized by SYBR gold staining. For gel source data, see
dicing state. d, Selected 2D class averages and 3D maps showing heterogeneity Supplementary Fig. 1. f, Selected 2D class averages and 3D maps showing
in the helicase domain. White arrowhead indicates the location of the helicase heterogeneity of the helicase domain of hDICER–pre-let-7a-1GYM complex.
Extended Data Fig. 6 | The structure of dsRBD in different states. a, and AtDCL3 (PDB: 7VG2)9. c, Surface charge of the dsRBD, with the dsRNA–
Conformational changes of the dsRBD in the apo (this study), dicing (this study) dsRBD interface in dicing and pre-dicing states (PDB: 5ZAL)24. d, Cryo-EM map
and pre-dicing states (PDB: 5ZAL)24. b, Superposition of the dsRBDs of hDICER and model of the hDICER dsRBD with dsRNA.
Article
Extended Data Fig. 7 | The PAZ helix rearranges to interact with pre-miRNA pre-let-7a-1 with a 2-nt 3′ overhang. *, radiolabelled 5′ phosphate. d, In vitro
in a cleavage-competent position. a, Superposition of hDICER PAZ–platform processing of pre-let-7a-1 with a 1-nt 3′ overhang (lanes 1–5) or a 3-nt 3′ overhang
domain in the cryo-EM structure (this study) and in the crystal structure (lanes 6–10). Relative cleavage was calculated by quantifying the band intensity
(PDB: 4NHA, grey)20. b, Changes in the position of the pre-miRNA in a dicing (1 − uncleaved/input). Squares indicate mean (n = 2, independent experiments).
state (this study) and a pre-dicing state (PDB: 5ZAL)24. c, In vitro processing of *, radiolabelled 5′ phosphate. For gel source data, see Supplementary Fig. 1.
Extended Data Fig. 8 | End recognition mechanism of hDICER. a, Cryo-EM hDICER. h, In vitro DICER processing of pre-miRNA-like duplex with a 2-nt or
map of the 5′ pocket. b, Cryo-EM map of the 3′ pocket. c, Superposition of 3-nt 3′ overhang. The base opposite to the varying sequence is A on the 3p
hDICER–pre-let-7a-1GYM and Platform–PAZ–Connector Helix (PDB: 4NHA, 4NGD strand. For gel source data, see Supplementary Fig. 1. *, radiolabelled 5′
and 4NH6)20. d, Superposition of dsRNAs complexed with hDICER and AtDCL3 phosphate. i, Schematic outline of the rescue experiment (n = 2, biological
(PDB: 7VG2)9. e, Close-up view of the ends of the dsRNAs complexed with replicates). j, Changes in cleavage accuracy, estimated with the fold change of
hDICER and AtDCL3 (PDB: 7VG2, grey)9. f, Superposition of hDICER in a dicing the proportion of the major 5′-isomiR. For a given miRNA, the most abundant
state and AtDCL3-pre-siRNA complex (PDB: 7VG3, magenta)9. g, 5′ terminal 5′-isomiR was identified in the wild-type sample. Grey, unannotated strand.
base recognition by AtDCL3 via PAZ region corresponding to the PAZ helix of k, DROSHA/DICER cleavage sites dictated by 5′ ends of mature miRNAs.
Article
Extended Data Fig. 9 | Rescue experiments with DICER 5′ pocket mutants. the 5′ end of 3p miRNAs. miRNA isoforms beginning at the indicated position
a, Predicted structural effect of the 5′ end base substitutions on the interaction are plotted with circles, with the size of the circle reflecting the proportion of
with the 5′ pocket. b, Examples of altered processing sites observed in the the cleavage-site usage at the given position.
rescue experiments. Note that the DICER cleavage sites can be inferred from
Extended Data Fig. 10 | Distinct functions and evolution of Dicer proteins siRNA pathway, a long dsRNA comes into DICER by passing through the
in two small RNA pathways. a, Comparison of the substrate RNA movement helicase domain. The ATP-dependent translocation by the helicase domain
during DICER processing between two small RNA pathways. In the miRNA leads to processive cleavage of long dsRNAs. b, A phylogenetic tree of Dicer
pathway, a hairpin-shaped small RNA (pre-miRNA) is bound to DICER by the homologues. The scale bar indicates the length for the indicated frequency of
helicase and PAZ domains. For cleavage, the helicase domain becomes flexible amino acid variation.
to accommodate the pre-miRNA into the catalytic centre. By contrast, in the
Article
Extended Data Table 1 | Cryo-EM data collection, refinement and validation statistics
#1 apo-hDICER #2 hDICER-let7a-1GYM
(EMDB-33490) (EMDB-33489)
(PDB 7XW3) (PDB 7XW2)
Data collection and processing
Magnification 120,000 105,000
Voltage (kV) 200 300
Electron exposure (e–/Å2) 44.163 40
Defocus range (μm) -1.0 ~ -2.75 -0.9 ~ -2.2
Pixel size (Å) 1.102 0.849
Symmetry imposed C1 C1
Initial particle images (no.) 189,908 1,386,301
Final particle images (no.) 128,635 1,210,874
Map resolution (Å) 4.04 3.04
FSC threshold 0.143 0.143
Map resolution range (Å) 3.0-10.0 2.5-7.5
Refinement
Initial model used (PDB code) 5ZAK 7XW3
Model resolution (Å) 4.04 4.03
FSC threshold 0.143 0.143
Model resolution range (Å) 3.0-10.0 2.5-7.5
Map sharpening B factor (Å2) -120.8 -157.2
Model composition
Non-hydrogen atoms 12087 6997
Protein residues 1502 725
Nucleotides - 54 (RNA)
Ligands -- 2 (Ca)
B factors (Å2)
Protein 98.43 74.38
Nucleotides -- 83.33 (RNA)
Ligands -- 30.00 (Ca)
R.m.s. deviations
Bond lengths (Å) 0.009 0.007
Bond angles (°) 1.238 1.058
Validation
MolProbity score 2.49 1.77
Clashscore 15.50 7.50
Poor rotamers (%) 2.44 0.92
Ramachandran plot
Favored (%) 91.54 95.10
Allowed (%) 8.39 4.90
Disallowed (%) 0.07 0.00
The top part of the table provides conditions and parameters for the data collection process. The bottom part contains statistic values related to the refinement of density maps and molecular
models.
Article
Washout
Washout
a mAID FKBP b c
+Auxin (h) 0 1 2 3 4 8 24 48 (kDa) +dTAG-13 (h) 0 1 2 3 4 8 24 48 (kDa)
RBBP5–FKBP degron
DPY30–mAID degron
SS RBBP5 H 3C DPY30 OsTir1 or RBBP5
PA 16
M DPY30
CO ASH2L
H3C H3C H3K4me1 16 H3K4me1
LL NH N+
1/
M
H3K4me2 16 H3K4me2 16
WDR5 ET +Auxin +dTAG-13
S 16
H3K4 H3K4me3 16 H3K4me3
36 98
DPY30 RBBP5
H3 16 H3 16
50 50
TSS Actin Actin
10
50 10 20
5 10
DPY30–mAID
0 5
120 20 40
14
6 5
0 0
–5
5
–5
5
–5
5
–5
5
–5
–5
5
–5
5
–5
5
–5
5
–5
5
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
–5
5
–5
5
–5
5
–5
–5
5
–5
5
–5
5
–5
5
TSS
TSS
TSS
TSS
TSS
TSS
TSS
TSS
Position (kb) Position (kb) Position (kb) Position (kb)
e RBBP5 H3K4me3 H3K4me1 H3K4me2
+dTAG-13: 0h 2h 8h 24 h 0h 2h 8h 24 h 0h 2h 8h 24 h 48 h 0h 2h 8h 24 h 48 h
300 25 50
8
ChIP–seq enrichment
6 200 30
15
4 100
RBBP5–FKBP
5 10
2 0 25 50
10 300
7.5 5
1 0
–5
5
–5
5
–5
5
–5
5
–5
–5
5
–5
5
–5
5
–5
5
–5
5
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
Centre
–5
5
–5
5
–5
5
–5
–5
5
–5
5
–5
5
–5
5
TSS
TSS
TSS
TSS
TSS
TSS
TSS
TSS
dKO 0 24 1 2 (kDa) 16 16
H3K4me3
(kDa) 16 H3K4me3 16
WT 1 2 H3K4me3 H3K4me2 16
250
KDM5A 16 16
H3K4me2 H3K4me1
H3K4me1 16
KDM5B 180 250
16 KDM5A
50 H3K4me1
Actin H3 16 KDM5B
H3 16 180
H3 16
50 50
Actin Actin
250
ChIP–seq enrichment
200
150
100
50
0
5
–5
TSS
5
–5
TSS
5
–5
TSS
5
–5
TSS
5
–5
TSS
5
–5
TSS
5
–5
TSS
5
–5
TSS
Position (kb) Position (kb) Position (kb) Position (kb) Position (kb) Position (kb) Position (kb) Position (kb)
Fig. 1 | Acute depletion of SET1/COMPASS core subunits reveals rapid f, Immunoblot analysis of KDM5A and KDM5B in DPY30–mAID cells and two
turnover of H3K4me3. a, Schematic of the degron systems for the targeted independently isolated dKO cell lines. β-Actin was used as the loading control.
degradation of DPY30 and RBBP5. b,c, Immunoblot analysis of DPY30, RBBP5 g, Immunoblot analysis of H3K4me3 and H3K4me1 levels in DPY30–mAID,
and H3K4me1–3 levels at the indicated times after treatment with 500 nM auxin control and Kdm5a/b-dKO cells. Histone H3 was used as the loading control.
(b) or 500 nM dTAG-13 (c). Washout, degron ligand was washed out for 48 h. h, Immunoblot analysis of DPY30, H3K4me1–3, KDM5A and KDM5B at the
d,e, ChIP–seq heat maps and profiles were generated from control and auxin- indicated times after auxin treatment. Out, degron ligand was washed out
treated DPY30–mAID cells (d) and dTAG-13-treated RBBP5–FKBP cells (e). For for 48 h; P, parental cells. i, H3K4me3 ChIP–seq heat maps in DPY30–mAID
DPY30, RBBP5 and H3K4me3 ChIP–seq, the signal was plotted over the TSSs Kdm5a/b-dKO cells. The signal was plotted over the TSSs (TSS ± 5 kb) of
(TSS ± 5 kb) of protein-coding genes. For H3K4me1 and H3K4me2 ChIP–seq, the protein-coding genes. Rows are sorted by decreasing ChIP–seq occupancy
signal was plotted over their centre peaks (peak centre ± 5 kb), which are called in the auxin 0 h cells.
from steady-state mES cells. Sites were sorted by the ChIP–seq signals at 0 h.
3 3 5 5 5
3
log2[FC]
log2[FC]
0 0 0 0 0 0
–3 −3 −3
–5 –5 –5
–6 −6 −6
0 1 2 3 0 1 2 3 0 1 2 3 0 1 2 3 0 1 2 3 0 1 2 3
log10[CPM] log10[CPM] log10[CPM] log10[CPM] log10[CPM] log10[CPM]
Nascent RNA: Downregulated (P < 0.05, log2[FC] < –1)
3 3 3 3 3
log2[FC]
0 0 0 0 0
−3 −3 −3 −3 −3
−6 −6 −6 −6 −6
0 1 2 3 0 1 2 3 0 1 2 3 0 1 2 3 0 1 2 3
log10[CPM] log10[CPM] log10[CPM] log10[CPM] log10[CPM]
Nascent RNA: Downregulated (P < 0.05, log2[FC] < –1)
d +Auxin 2 h versus 0 h e DPY30–mAID + f
DPY30–mAID RBBP5–FKBP Downregulated gene number
0.6 DPY30–mAID Kdm5a/b dKO (compared with 0 h)
3,000
4
0
1.2 DPY30–mAID
log2[FC] (SLAM-seq)
0
Density
–4 –2 0 2 4 0
+ Auxin 8 h versus 0 h 1,000
0.7
DPY30–mAID –2
0
0 0 2 4 8 24 48
–4
0.8 DPY30–mAID +Auxin (h)
+ Kdm5a/b dKO
2h 8 h 24 h 2h 8 h 24 h 2h 8 h 24 h 8 h 48 h DPY30–mAID
0 DPY30–mAID
–4 –2 0 2 4 + Kdm5a/b dKO
+Auxin +dTAG-13 +Auxin
log2[FC](SLAM-seq)
Fig. 2 | H3K4me3 is required for nascent transcription. a, MA plots depicting using Wald tests in DESeq2. d, The log 2-transformed fold change in nascent
changes in nascent transcription (SLAM-seq) at the indicated times after auxin gene expression in the depicted cell lines on the basis of the data shown in a
treatment in DPY30–mAID cells. n = 3 biological replicates. CPM, counts per and c. e, The nascent transcriptional changes (log 2-transformed) for genes
million mapped reads; FC, fold change. Adjusted P values were calculated using in indicated samples across timepoints with DPY30 or RBBP5 degradation
Wald tests in DESeq2. b, MA plots depicting changes in nascent transcription kinetics. The box plots indicate the median (centre line), the third and first
(SLAM-seq) at the indicated times after dTAG-13 treatment in RBBP5–FKBP quartiles (box limits) and 1.5 × interquartile range (IQR) above and below the
cells. n = 3 biological replicates. Adjusted P values were calculated using Wald box (whiskers). n = 3 (DPY30–mAID or RBBP5–FKBP degron cells) and n = 2 (dKO
tests in DESeq2. c, MA plots depicting changes in nascent transcription cells) biological replicates. f, Comparison of the number of downregulated
(SLAM-seq) at the indicated times after auxin treatment in DPY30–mAID genes after auxin treatment for the indicated cell lines, based on the data
Kdm5a/b-dKO cells. n = 2 biological replicates. Adjusted P values were calculated presented in a and c.
n D
xi ID
AG FK
xi AI
AG FK
au A
3
3
au m
+ 0–m
dT 5–
dT –
+ 30–
n
a b c
+ P5
+ P B
Y3
DPY30–mAID
RB
RB
DP
DP
1.00 DPY30–mAID RBBP5–FKBP
0 h 8 h 0 h 8 h (kDa) 0h 8h 0h 8h +Auxin
H3K4me3 reader 0h P < 2.2 × 10–16 P < 2.2 × 10–16
(kDa) 4
Fraction of genes
H3 16 (PHD domain) 0.75
36 130 2h
DPY30 (anti-mAID) TAF3
36 36 8h
SPIN1 0.50
DPY30 300 3
100 BPTF
RBBP5 (anti-HA) 0.25
CHD1 250
98 More pausing
RBBP5
log[pausing index]
CHD4 250 2
H3K4me1 16
Histone chaperone –2 0 2 4
H3K4me2 16 SSRP1 130 RBBP5–FKBP
H3K4me3 16 1.00 1
SPT16 +dTAG-13
H3.3 16 130
250 0h
Fraction of genes
SPT6
Negative elongation factor 0.75 2h
64 TBP machinery 0
NEFLA 8h
55 CDK7 36
NELFE 0.50
TBP 36
PAF1 complex
–1
P-TEFb 0.25 More pausing
BRD4 130 0h 2h 8h 0h 2h 8h
PAF1
64 CDK9 36 –2 0 2 4
log[pausing index] +Auxin +dTAG-13
e 1.00
d KDM5A KDM5B H3K4me3
DPY30–mAID
0.75 +dKO
DPY30–mAID +dKO DPY30–mAID +dKO DPY30–mAID +dKO log2
2.0 0.50
1.5 Less pausing
0.25
Fraction of genes
1.0 P < 2.2 × 10–16
0.5 0
0 1.00
dKO + auxin 0 h
–0.5
0.75 dKO + auxin 2 h
–1.0
dKO + auxin 8 h
–1.5 0.50
–2.0 More pausing
0.25
kb
–2 kb
kb
kb
kb
–2 kb
kb
–2 b
kb
–2 kb
kb
–2 b
kb
kb
S
S
k
k
TS
TS
TS
TS
TS
TS
TS
–2
2
–2
5 (single-nucleotide
(Initiation) resolution)
RNA
0.10
Density
IP with RNAPII
0
DMSO/auxin
0.05
+Triptolide
–5
2h
0h 2h 8h 0h 2h 8h
+Auxin Sample point 0
(0 min, 5 min, 10 min, 20 min, 40 min)
0 5 10 15 20
DPY30–mAID DPY30–mAID
+ Kdm5a/b dKO Promoter proximal RNAPII half-life (min)
Fig. 3 | Acute loss of H3K4me3 increases the residence time of paused Kdm5a/b-dKO cells. e, The RNAPII pausing index in DPY30–mAID (black),
RNAPII. a, Immunoblot analysis of the indicated transcriptional core proteins DPY30–mAID Kdm5a/b-dKO (blue) and auxin-treated cells. Higher index
and H3K4me3 readers in the indicated cell lines treated with or without auxin values indicate a higher degree of RNAPII pausing on promoter region of genes.
or dTAG-13 as shown. b, The RNAPII pausing index in control (0 h, black) and P values were calculated using two-sided Wilcoxon tests. f, The RNAPII pausing
auxin-treated or dTAG-13-treated degron cells. Higher index values indicate a index determined using mNET–seq in DPY30–mAID, DPY30–mAID Kdm5a/b-dKO
higher degree of RNAPII pausing. Cumulative index plots of the pausing index and auxin-treated cells. The box plots indicate the median (centre line), the
were calculated from total RNAPII ChIP–seq signals. c, The RNAPII pausing third and first quartiles (box limits) and 1.5 × IQR above and below the box
index was determined using ChIP–seq in the indicated samples with DPY30 or (whiskers). P values were calculated using two-sided Wilcoxon tests. n = 10,332
RBBP5 degradation kinetics. The box plots indicate the median (centre line), genes. g, The experimental strategy of the mNET–seq approach to measure the
the third and first quartiles (box limits) and 1.5 × IQR above and below the box promoter-proximal RNAPII half-life after treatment with triptolide. h, Density
(whiskers). P values were calculated using two-sided Wilcoxon rank-sum tests. plot showing increased paused RNAPII half-life of n = 4,007 genes after acute
n = 12,621 genes. d, Comparison of the occupancy of KDM5A, KDM5B and loss of H3K4me3. The average of paused RNAPII half-life is shown as a dashed
H3K4me3 around the TSS region (TSS ± 2 kb) in DPY30–mAID and DPY30–mAID line. n = 2 biological replicates.
To estimate the change in elongation velocity, we used the ratio of in elongation velocity (Fig. 4c). Consistent with this observation, the
nascent RNA synthesis measured using TTchem-seq and RNAPII RNA occu- well-known epigenetic mark for transcription elongation H3K36me3
pancy measured using mNET–seq (TTchem-seq/mNET–seq) as a proxy also showed a global decrease in the auxin-treated cells (Fig. 4d and
for elongation velocity, which is a measurement of the amount of ongo- Extended Data Fig. 6g).
ing RNA synthesis per RNAPII molecule33,34. This analysis showed that As an orthogonal assay to investigate how H3K4me3 loss affects
acute loss of H3K4me3 caused a general transcriptome-wide decrease transcription elongation, we determined productive RNAPII elongation
0h 8h 24 h 0h 8h 24 h
Normalized reads
Normalized reads
2.0 1.5
1.5 1.0
1.0
0.5
0.5
–3
TSS
TES
5
–3
TSS
TES
5
–3
TSS
TES
–3
TSS
TES
5
–3
TSS
TES
5
–3
TSS
TES
5
Position (kb) Position (kb) Position (kb) Position (kb) Position (kb) Position (kb)
c d H3K36me3
e g
+DMSO +DRB DRB After DRB/TTchem-seq
Normalized reads
RNAPII elongation velocity /auxin washout washout DMSO Auxin
6
(TTchem-seq/mNET–seq) + 10 min 4SU pulse = DRB 0 min P = 1.3 × 10–6
4.5 h 3.5 h
4 0 min + 10 min 4SU pulse = DRB 10 min
+Auxin 0h 8h 4.0
Relative signal
TES
5
f 0.008 Release: 3.0
0.2
Position (kb)
0 min
0.006 10 min
Average signal
20 min
2.0
1.0 25 0.004 30 min
0.002
0 0 1.0
0
TSS 40 80 120 DMSO Auxin
Position relative to TSS (kb)
–5
–5
50
50
TSS
TSS
–3 TSS TES 5
Position (kb)
h +DMSO +Auxin
i RA upregulated genes: DMSO: RA 0 h RA 8 h Auxin: RA 0 h RA 8 h j mNET–seq signal (TSS ± 2 kb)
3
0h8h0h8h r2 = 0.82;
H3K4me3 RNAPII RNA-seq
P < 2.2 × 10–16
P < 2.2 × 10–16
400 200 P < 2.2 × 10–16
600
300 150
RA upregulated
Expression level
Auxin
P < 2.2 × 10–16 1
P < 2.2 × 10–16
400 P < 2.2 × 10–16 Counts
200 100 >40
P < 2.2 × 10–16 P < 2.2 × 10–16 30
P < 2.2 × 10–16 200 0
100 50 20
10
0 0 0 0
−1
Strong Moderate Weak Strong Moderate Weak Strong Moderate Weak −1 0 1 2 3
log2[FC] (+RA 8 h/0 h)
–3 0 3 Steady-state levels of RNAPII Steady-state levels of RNAPII Steady-state levels of RNAPII DMSO
Fig. 4 | H3K4me3 regulates transcriptional elongation. a,b, Metagene line), the third and first quartiles (box limits) and 1.5 × IQR above and below
profiles for transient transcriptome sequencing (TTchem-seq) in control and the box (whiskers). h, The upregulated genes response to RA treatment in
auxin-treated (a) or dTAG-13-treated (b) cells in the indicated cell lines. TES, auxin-treated and DMSO-treated cells (n = 2). Gene expression is shown as
transcription end site. c, Heat maps and profiles showing changes in elongation relative Z-scores across the samples. i, The changes in H3K4me3 and RNAPII
velocities (TTchem-seq/mNET–seq) after acute loss of H3K4me3. d, H3K36me3 ChIP–seq at TSSs (±2 kb), and RNA-sequencing analysis of RA-response genes
ChIP–seq profiles and heat maps in control and auxin-treated DPY30–mAID (upregulated genes) in the indicated samples. The box plots indicate the
cells. e, Outline of the DRB/TTchem-seq experiment to measure RNAPII elongation median (centre line), the third and first quartiles (box limits) and 1.5 × IQR
rates. 4SU, 4-thiouridine. DRB 0 min, no release of DRB. f, DRB/TTchem-seq above and below the box (whiskers). P values were calculated using two-sided
metagene profiles of protein-coding genes (60–300 kb length) with non- Wilcoxon tests. n = 77 genes for each group. j, The correlation of mNET–seq
overlapping transcriptional units (n = 3,566) in the depicted cells. Lines are signal around the TSS region (TSS ± 2 kb) at 8 h after RA treatment with or
computationally fitted splines. g, Box plot showing decreased RNAPII elongation without H3K4me3. Pearson correlation and P values are reported at the top.
rates after H3K4me3 loss. P values were calculated using two-sided Wilcoxon P values were calculated using two-sided Wilcoxon tests.
tests. n = 855 genes with RPM > 100. The box plots indicate the median (centre
ChIP–seq enrichment
Proteins Puro Flag APEX2 RPB1
H3K4me3 2 15
15
APEX Endogenous proteins B 98 1 5
in live cells B OH 4.0
B OH B INTS11 35
Biotin-phenol
RPB1
H2O2 B O B H3 15
0 0
e g h
–2 kb
TSS
2 kb
–2 kb
TSS
2 kb
–2 kb
TSS
2 kb
–2 kb
TSS
2 kb
mNET–seq
TTchem-seq
6
5
INTS11–FKBP 0 h INTS11–FKBP + dTAG-13: INTS11–FKBP + dTAG-13: i
+dTAG-13: 2 h 0h 2h 1.50 INTS11–FKBP + dTAG-13:
Enrichnent
4 0h 2h 8h
3 Sense 0h 2h
1.25
2
mNET–seq
Relative signal
1 5 1.00
Normalized reads
0
–3 TSS TES 5 kb 4 0.75 0.5
16 0.4
3 0.50 0.3
0.2
–50 0 50 100 150 200 250 0.1
2 0.25 0
0
50
0
0
0
0
0
10
15
20
25
1
TSS 1 2 3 4 5
TTchem-seq
–5 kb TSS 33% 66% TES 5 kb
Genomic region (5′ to 3′) Distance to TSS (kb)
0 j DPY30–mAID INTS11–FKBP
Coverage around TSS + auxin
–3 TSS TES 5 + dTAG-13
P < 2.2 × 10–16 5 –50 0 50 100 150 200 250
f 0h 2h8h 0 h 2 h 8 h (kDa)
Normalized reads
(kDa)
4 DPY30 INTS11 75
5 22
log[pausing index]
MNase-seq
INTS11
0 3
INTS11 enrichment
−2 −1
2 0.2
−4 0
300
H3K4me3
−6 −2
1
0.1
−8
0.5 h 1 h 2h 4h 8h 24 h 48 h 0 0 −1.0 −0.5 0 0.5 1.0
–2 2
INTS11–FKBP + dTAG-13 H3K4me3 level Distance to TSS (kb) DPY30–mAID (+auxin 2 h/0 h)
Fig. 5 | INTS11 regulates pause-release and transcription dependent on elongation velocities (TTchem-seq/mNET–seq) after acute loss of INTS11.
H3K4me3. a, The strategy for CRISPR-based Flag–APEX2–RPB1 (RNAPII– j, Immunoblot analysis of integrator subunits in the indicated cell lines treated
APEX2) tagging. b, Validation of H3K4me3-dependent INTS11 chromatin with or without auxin or dTAG-13 as shown. k, Box plot comparing the log 2-
interaction in DPY30–mAID cells. c, Western blot analysis of HA-tagged INTS11 transformed fold change in SLAM-seq at the indicated timepoints. The box
and actin in INTS11–FKBP cells. d, HA-tagged INTS11 and total RNAPII ChIP–seq plots indicate the median (centre line), the third and first quartiles (box limits)
profiles and heat maps in INTS11–FKBP cells. e, mNET–seq profiles and heat and 1.5 × IQR above and below the box (whiskers). n = 13,776 genes. l, The INTS11
maps in INTS11–FKBP degron cells. f, The RNAPII pausing index was determined signal at TSSs (± 2 kb) in the indicated groups. The box plots indicate the
using mNET–seq in INTS11–FKBP cells. The box plots indicate the median median (centre line), the third and first quartiles (box limits) and 1.5 × IQR
(centre line), the third and first quartiles (box limits) and 1.5 × IQR above and above and below the box (whiskers). n = 4,700 genes. m, The average distribution
below the box (whiskers). P values were calculated using two-sided Wilcoxon of INTS11 and H3K4me3 ChIP–seq signals at INTS11-bound genes (n = 8,712)
tests. n = 10,332 genes. g, Metagene transcriptional profiles were acquired versus INTS11-unbound genes (n = 14,955) in mES cells. n, 2D kernel density plot
using TTchem-seq in INTS11–FKBP degron cells. h, Metagene analyses of mNET– showing the relationship between SLAM-seq changes in INTS11–FKBP and
seq and TTchem-seq signals at single-nucleotide resolution acquired in INTS11– DPY30–mAID degron cells. The colour bar reflects the intensity.
FKBP cells. MNase-seq, micrococcal nuclease sequencing. i, Analysis of
these human cell lines (Supplementary Fig. 2b). Moreover, heat maps between INTS11-binding sites and sites of H3K4me3 enrichment across
also demonstrated a significant colocalization of the peak binding the genome. Taken together, these results show that H3K4me3 regu-
sites for INTS11 and RNAPII with the peak sites of H3K4me3 enrich- lates promotor-proximal pausing through a mechanism involving the
ment on active promoters (Supplementary Fig. 2b). Thus, these pub- recruitment of the INTS11, which is essential for the eviction of paused
lished ChIP–seq results from different cells validated a correlation RNAPII and transcriptional elongation.
Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in
published maps and institutional affiliations. © The Author(s) 2023
Extended Data Fig. 2 | DPY30 and RBBP5 are required for cell proliferation. plots are represented as mean and n = 2 replicates. (d) Cell proliferation assays
(a) Cell proliferation assays of DPY30–mAID and RBBP5–FKBP cells grown of DPY30–mAID cells after treatment with Auxin at the indicated times with or
either with or without Auxin/dTAG-13. The line graph represents the mean ± SD without Kdm5ab dKO. (e) RT-qPCR analyses of mRNA expression of DPY30–
of the numbers of cells counted at each time point. Parental represents the mAID cells with or without Kdm5ab dKO. Two independent dKO clones were
parental E14 ES cells without CRISPR editing. Ectopic expression (EE) of DPY30 chosen for downstream analysis. The values are normalized to 18S rRNA. Graph
or RBBP5 rescues the proliferation of defect observed by degrading endogenous shows mean values from technical triplicates (n = 3), from one representative
DPY30 and RBBP5, respectively. Data are from three biological replicates (n = 3) out of two independent experiments. (f) ChIP-qPCR enrichment for WDR5,
and were analysed using Two-way ANOVA (n = 3) and represented as mean ± s.d., SETD1B and MLL1 in DPY30–mAID cells system after treatment with Auxin at
***P < 0.001. (b) Colony formation assay for DPY30–mAID and RBBP5–FKBP the indicated points. Graph shows mean values from technical triplicates
cells grown either with or without Auxin/dTAG-13 for two weeks. (c) Quantification (n = 3), from one representative out of two independent experiments.
of colony formation assays from two independent experiments. Data in bar
Extended Data Fig. 3 | See next page for caption.
Article
Extended Data Fig. 3 | Outline and controls for SLAM-seq experiments. transcription per gene measured by SLAM-seq. THZ1 treatment confirmed that
(a) Experimental design. To validate the SLAM-seq protocol, we performed a transcripts containing T>C conversions of protein-coding genes were broadly
pilot experiment for mapping responses to short-term THZ1 (2h) treatment by repressed, which captured the prominent immediate responses, while the total
SLAM-seq in mES cells. SLAM-seq utilizes thymine-to-cytosine (T>C) conversion mRNA level showed fewer changes. P-adjusted value by Wald test in DESeq2.
from 4-thiouridine (4sU)-labelled mRNAs to quantify the abundance of nascent (e) H3K4me3 levels on TSS before Auxin treatment of downregulated genes
RNA transcripts using 3′ end mRNA-sequencing (Quant-seq). To monitor the (n = 1,111) and unchanged genes (n = 10,107) measured by SLAM-seq (in response
consistency and reproducibility of different SLAM-seq data, we inhibited to Auxin treatment for 2h in DPY30–mAID cells). The p value was calculated
transcription with THZ1 (reduces RNAPII-mediated gene transcription by with a two-sided Wilcoxon test. The boxplot indicates the median (middle line)
inhibiting cyclin-dependent kinase 7 (CDK7)). (b) Conversion rates for each and the third and first quartiles (box); the whiskers show the 1.5× IQR above
position of 4-thioU-containing SLAM-seq reads (≥ 2 T>C conversions) before and below the box. (f) H3K4me3 peak width of downregulated genes and
or after Auxin or THZ1 treatment for 2 h. Changes in the abundance of newly unchanged genes measured by ChIP–seq at steady-state. n= for downregulated
synthesized mRNAs (detected in SLAM-seq based on T>C conversions). and n= for unchanged genes. The p value was calculated with a two-sided
Average conversion rates (centre line) ± s.d. (whiskers) of two independent Wilcoxon test. The boxplot indicates the median (middle line) and the third
experiments (points) are shown. P value (Two-sided Mann-Whitney test) is and first quartiles (box); the whiskers show the 1.5× IQR above and below
indicated (***P < 0.001, n.s., not significant.). n = 20,428 transcripts. The boxplot the box. (g) Box plot showing log2-transformed fold change of nascent
indicates the median (middle line) and the third and first quartiles (box); the transcription (SLAM-seq, 2 h vs. 0 h) of genes containing CGI (n = 11,386) and
whiskers show the 1.5× IQR above and below the box. (c,d) Transcriptional non-CGI (n = 3,262) promoters. The p value was calculated with a two-sided
response of the cells treated with THZ1/DMSO for 2h followed by 4sU labelling Wilcoxon test. The boxplot indicates the median (middle line) and the third and
over 60 min. (c) MA plots comparing total gene expression level with log first quartiles (box); the whiskers show the 1.5× IQR above and below the box.
change in transcription per gene measured by 4-thioU RNA-seq (SLAM-seq). (h) Gene set enrichment analysis (GSEA) of downregulated genes in DPY30–
(d) MA plots comparing nascent gene expression levels with log change in mAID cells in response to 2 h Auxin treatment.
Extended Data Fig. 4 | See next page for caption.
Article
Extended Data Fig. 4 | H3K4me3 loss does not have detectable effects on (Q value ≤ 0.05, limma test, with P values adjusted by the Storey method).
binding of TAF3, CDK7 and TBP to transcription start sites and to PIC (e) RNAPII occupancy based on ChIP–seq in the indicated cell lines. Metagene
formation. (a) ChIP–seq profiles of the indicated proteins using DPY30–mAID analysis showing the genome-wide enrichment averages on protein-coding
and RBBP5–FKBP cells treated with or without Auxin/dTAG-13, respectively for genes, data are shown along with 3 kb upstream of the transcriptional start site
8 h. The enrichments were plotted over the transcription start sites (TSS ± 5 kb) to 5 kb downstream of the end of each annotated gene. TSS, transcription start
of protein-coding genes. TSS, transcription start site. (b) Outline of the mass site, TES, transcription end site. (f) Estimation of a gene’s “pausing index” (PI)
spectroscopy proteome profiling strategy for mapping the interaction networks from RNAPII ChIP–seq data. The promoter is defined as the region covering
of RNAPII in DPY30–mAID cells treated with or without Auxin. (c) String network 200 bp upstream to 200 bp downstream of the TSS; the gene body is defined
of protein complexes (k-means clustering) showing RNAPII interactors in as the region from 400 bp downstream of the TSS to TES, genes with gene
control cells compared with IgG mock IP. (d) Volcano plot showing proteins length less than 400 bp are removed for pausing index analysis. (g) Violin
changing their association with RNAPII in response to acute loss of H3K4me3. plots showing changes of gene expression in the indicated samples. Genes
The x axis displays the enrichment (log2 fold change) of proteins in Auxin- were separated into three equal parts based on their accumulation change of
treated cells (Auxin 8 h) compared to DMSO-treated control cells (Auxin 0 h). RNAPII in promoter-proximal region. (h) An IGV snapshot comparing RNAPII,
The y axis shows the significance (-log10 P value) of enrichment calculated from RNAPII Ser 2p and Ser 5p ChIP–seq signals in control and Auxin-treated DPY30–
three biological replicate experiments. A protein was considered an interactor mAID cells at the indicated times. (i) Average metagene ChIP–seq profiles for
if in one or both comparisons its levels were statistically significantly different the indicated factors in control and dTAG-13-treated RBBP5–FKBP cells.
Extended Data Fig. 5 | The fast turnover of H3K4me3 is dependent on KDM5 mAID cells following treatment with Auxin at the indicated times with or
demethylases. (a) RNAPII pausing index in DPY30–mAID (black), DPY30– without Kdm5a/b dKO. For ChIP-qPCR, the target sites around promoter of the
mAID: Kdm5a/b dKO (blue, clone #2) and Auxin-treated cells. Higher index indicated genes and control region (intragenic chr8: 72,806,101- 72,806,240)
values indicate a higher degree of RNAPII pausing. (b) ChIP-qPCR enrichment were used. Graph shows mean values from technical triplicates (n = 3), from one
of H3K4me3 in DPY30–mAID cells after treatment with Auxin at the indicated representative out of two independent experiments.
times with or without Kdm5a/b dKO. (c) ChIP-qPCR signals for RNAPII in DPY30–
Article
Extended Data Fig. 7 | Loss of H3K4me3 does not have detectable effects on were analysed using Two-way ANOVA (n = 2) and represented as mean ± s.d.,
transcriptional initiation. (a) Experimental strategy for retinoic acid (RA) **P < 0.01, ***P < 0.001. (e) Gene set enrichment analysis (GSEA) analysis of RA
differentiation in control and Auxin-treated degron cells. (b) Principal induced genes (RA upregulated gene list from previously published data,
component (PC) analysis of RA-induced mRNA expression changes in DPY30– n = 227). The curve represents the evolution of the density of the genes
mAID cells prior to treatment with Auxin (circles) or DMSO (triangles) for 2 h at identified in the RNA-seq. The False Discovery Rate (FDR) is calculated by
the indicated differentiation points: 0h, 8h, d1, d2, d4, d6. Developmental comparing the actual data with 1000 Monte-Carlo simulations. The NES
trajectory is shown by the dashed arrow. (c) Spearman correlation heat map of (Normalized Enrichment Score) computes the density of modified genes in
retinoic acid (RA) time course RNA-seq replicates of Auxin-treated and DMSO- the dataset with the random expectancies, normalized by the number of genes
treated cells. (d) Short- and long-term effects of DPY30 degradation on the found in the given gene cluster, considering the size of the cluster. (f,g) H3K4me3
expression of RA-induced genes. DPY30–mAID cells were treated with DMSO, and RNAPII occupancy before or after RA treatment in control and Auxin-
Auxin and RA as indicated. The stable RA induced genes were identified from treated degron cells. The enrichments were plotted over the transcription
upregulated genes at day 6 in control cells (DMSO). The early RA induced genes start sites (TSS ± 2 kb) of protein-coding genes. Rows are sorted by decreasing
were identified from upregulated genes at 8 h in control cells (DMSO). Data H3K4me3 ChIP–seq occupancy in the control (DMSO RA 0h) cells.
Extended Data Fig. 8 | See next page for caption.
Article
Extended Data Fig. 8 | APEX2-based proteomic mapping scheme and experiment. The RNAPII-APEX2-bait (BP+H2O2) population has a right-shifted
characterization of endogenous RNAPII in vivo interactions. (a) Genomic distribution compared with the no agonist negative control population, which
confirmation of the APEX-modified Rpb1 loci in DPY30–mAID and RBBP5–FKBP indicates that the log2(SILAC) ratio allows us to distinguish bona fide RNAPII
degron cells. (b) Sanger sequencing of the wild type and Flag-APEX2-RPB1 interactions from non-RNAPII interactions. (k) GO network showing
knock-ins. (c) Western blot showing the expression of APEX-modified RPB1 in significantly (q value < 0.001) enriched terms for positive RNAPII interaction
DPY30–mAID and RBBP5–FKBP degron cells. (d) Representative brightfield neighbourhoods from RNAPII-APEX2 experiment. The most prominent
images of mES cell colonies. (e) RT-qPCR analysis of the expression of pluripotency pathways are indicated. Connecting lines show interaction of protein nodes.
and differentiation genes in the knock-in cells. Data are from three biological (l) KEGG enrichment and GO network showing significantly (q value < 0.001)
replicates (n = 3) and are analysed using Two-way ANOVA and represented as enriched terms for positive RNAPII interaction neighbourhoods from RNAPII-
mean ± s.d. (f) Titration of biotin phenol (BP). Cells stably expressing Flag- APEX2 experiment. (m) Principal component analysis (PCA) of SILAC signal in
APEX2-RPB1 were pre-incubated for 30 min with the indicated concentrations the RNAPII-APEX2 DPY30–mAID cells with or without Auxin treatment. Time
of BP, followed by the addition of 1 mM H2O2 for 1 min. Cell lysates were probed trajectory is shown by the dashed arrow. (n) Venn diagram indicating overlap
with Streptavidin-HRP. Proximity biotinylation is optimal at a BP concentration between up or downregulated targets in the indicated samples. (o) Heatmap
of 4 mM. (g) Confirmation of the APEX2 functionality by protein biotinylation representing relative protein abundance of DPY30 and selected targets in
in the APEX2-engineered DPY30–mAID and RBBP5–FKBP degron cells. The Auxin treated DPY30–mAID cells. n = 3 independently samples. (p) Scatterplot
discrete bands, denoted with asterisks, show APEX2-independent biotinylation analysis of proteins identified by SILAC in RNAPII-APEX2 DPY30–mAID cells
by native enzymes. The Connexin-APEX2 overexpressed cell was severed as following Auxin treatment for 2 and 8 h. (q) Gene ontology-based functional
positive control for the APEX2 system. (h) SILAC-based chromatin proteomic classification of 228 downregulated proteins in RNAPII-APEX2 DPY30–mAID
strategy for mapping the neighbourhood interaction networks of APEX2- cells following Auxin treatment for 2 and 8 h. The dot size is proportional to the
tagged RNAPII. (i) Principal component analysis (PCA) of SILAC signal in the number of members in an enrichment set, and colour intensity reflects the p value.
RNAPII-APEX2 cells with or without agonist. ( j) Distribution of SILAC ratio of Significance based on clusterProfiler analysis with Benjamini-Hochberg-
RNAPII interactions quantified in the chromatin proteomic analyses. Mean adjusted P values.
log2 SILAC ratio is shown. In total, 1,901 proteins were identified in this
Extended Data Fig. 9 | See next page for caption.
Article
Extended Data Fig. 9 | INTS11 is required for nascent transcription. (a) Venn replicates (n = 3) and are analysed using Two-way ANOVA and represented as
diagram indicating overlap of H3K4me3 interactors and RNAPII-APEX2 mean ± s.d. (g) Growth curve analysis of parental and INTS11–FKBP E14 cells
dependent interactors from ChIP-MS (chromatin proteomic profiling) data. treated with or without dTAG-13. (h) INTS11 enrichment profiles and heat maps
(b) Relative enrichments of selected targets in various ChIP preparations based as determined by using the HA-tag in control (0 h) and Auxin-treated (2 h)
on ChIP-MS. (c) Validation of INTS11 interaction with H3K4me3 in RBBP5–FKBP DPY30–mAID; INTS11–FKBP degron cells. Genome-wide binding averages
degron cells at different times after dTAG-13 addition. Biotinylated proteins showed enrichments at the TSS regions (TSS ± 2 kb) of protein coding genes.
within lysates were enriched using Streptavidin-coated magnetic beads and TSS, transcription start site. Rows were sorted by decreasing ChIP–seq
analysed by Western blot. In parallel, sample in which H2O2 was omitted was occupancy in the control (0 h) cells. (i) Correlations between TTchem-seq
prepared as negative control. (d) Schematic representation of the dTAG INTS11 replicate experiments in INTS11–FKBP degron cells treated with or without
targeting strategy for the INTS11–FKBP degron mES cells. (e) Western blot dTAG-13 for the indicated times. ( j) Average profiles for TTchem-seq for the
showing the expression of INTS11 and INTS11–FKBP–HA, using antibodies upstream anti-sense RNAs of each annotated protein-coding gene in INTS11
recognizing INTS11 or the HA in parental and knock-in degron cells. The arrow degron cells. TSS, transcription start site. (k) RNAPII profiles of various
indicates the specific HA-tagged INTS11–FKBP–HA protein. (f) RT-qPCR analysis subclasses of annotations in INTS11–FKBP degron cells with or without dTAG-13
showing the expression of selected pluripotency and differentiation genes in treatment. TSS, transcription start site. mRNA, messenger RNA. snRNA, small
the parental and INTS11–FKBP knock-in cells. Data are from three biological nuclear RNA. ncRNA, non-coding RNA. eRNA, enhancer RNA.
Extended Data Fig. 10 | Loss of INTS11 causes reduced transcriptional (SLAM-seq) at the indicated times after dTAG-13 treatment in INTS11–FKBP
output of protein-coding genes. (a) Experimental design of SLAM-seq for cells. n = 3 biological replicates. CPM, counts per million mapped reads.
INTS11–FKBP degron cells. Conversion rates for each position of a 4-thioU- (c) H3K4me3 and INTS11 occupancy in mES cells. The enrichments were plotted
containing SLAM-seq reads (≥ 2 T>C conversions) before or after dTAG-13 over the transcription start sites (TSS ± 2 kb) of protein-coding genes. Rows
treatment. Average conversion rates (centre line) ± s.d. (whiskers) are shown. are sorted by decreasing H3K4me3 ChIP–seq occupancy in the WT mES cells.
n = 3 biological replicates. The boxplot indicates the median (middle line) and (d) An IGV snapshot comparing ChIP–seq signals in control and dTAG-13-treated
the third and first quartiles (box); the whiskers show the 1.5× IQR above and INTS11–FKBP cells.
below the box. (b) MA plots depicting changes in nascent transcription
Article
Extended Data Fig. 11 | A Model for the roles of H3K4me3 in transcription The rapid turnover of H3K4me3 ensures that the pausing step is a highly
regulation. H3K4me3 facilitates the recruitment of factors regulating the regulated process by Integrator Complex Subunit 11 (INTS11), where an
release of paused RNAPII at the +1 nucleosome. The H3K4me3 at promoter increase in H3K4me3 leads to a decrease in RNAPII pausing and acute depletion
regions is highly dynamic, and it is maintained by an equilibrium between SET1/ leads to an increase RNAPII pausing.
COMPASS complexes and KDM5 demethylases at highly transcribed genes.
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
μ
α
Article
Accepted: 19 January 2023 Chloroplasts rely on the translocon complexes in the outer and inner envelope
Published online: 26 January 2023 membranes (the TOC and TIC complexes, respectively) to import thousands of
different nuclear-encoded proteins from the cytosol1–4. Although previous studies
Check for updates
indicated that the TOC and TIC complexes may assemble into larger supercomplexes5–7,
the overall architectures of the TOC–TIC supercomplexes and the mechanism of
preprotein translocation are unclear. Here we report the cryo-electron microscopy
structure of the TOC–TIC supercomplex from Chlamydomonas reinhardtii. The major
subunits of the TOC complex (Toc75, Toc90 and Toc34) and TIC complex (Tic214, Tic20,
Tic100 and Tic56), three chloroplast translocon-associated proteins (Ctap3, Ctap4
and Ctap5) and three newly identified small inner-membrane proteins (Simp1–3)
have been located in the supercomplex. As the largest protein, Tic214 traverses the
inner membrane, the intermembrane space and the outer membrane, connecting
the TOC complex with the TIC proteins. An inositol hexaphosphate molecule is located
at the Tic214–Toc90 interface and stabilizes their assembly. Four lipid molecules are
located within or above an inner-membrane funnel formed by Tic214, Tic20, Simp1
and Ctap5. Multiple potential pathways found in the TOC–TIC supercomplex may
support translocation of different substrate preproteins into chloroplasts.
As the organelles involved in photosynthesis, chloroplasts contain cranberry15. Although the protein-import function and components of
2,000−3,000 nuclear-encoded proteins imported from the cytosol the TOC–TIC supercomplex have been investigated extensively, little
through the TOC and TIC complexes8. In the past decades, many dif- is known about the assembly mechanism of the different subunits of
ferent components of the TOC and TIC machineries have been identi- the supercomplex, and the translocation pathway for the preproteins
fied using biochemical and genetic approaches4,8. The TOC complex remains unclear.
mainly comprises three core subunits named Toc159, Toc34 and Toc75,
whereas the TIC complex consists of four major subunits named Tic20,
Tic214 (also known as Ycf1), Tic100 and Tic56 (ref. 9). Whereas Toc159 Overall architecture
and Toc34 function as the primary receptors for preproteins2, Toc75 The TOC–TIC supercomplex sample, purified from a C. reinhardtii
forms a translocation channel of the outer envelope by itself10 or along strain expressing a Tic20–Venus–3×Flag fusion protein16, was used for
with Toc159 and Toc3411. Tic20 serves as a central component of the structural analysis using the single-particle cryo-electron microscopy
TIC translocon12, and Tic214 is essential for the import of various chlo- (cryo-EM) method. As shown in Fig. 1a, the TOC–TIC supercomplex (at a
roplast proteins involved in photosynthesis, amino acid synthesis and resolution of 2.8 Å) from C. reinhardtii has an overall shape resembling
ribosome biogenesis7. Tic100 and Tic56 are important for the assembly a torch, and it is composed of three complexes, namely TOC, TIC and
of a TIC translocon complex, as their absence led to a substantial reduc- the intermembrane space complex (ISC) connecting TOC and TIC. TOC
tion in the remaining TIC components5. Several other proteins, such as mainly contains Toc75, Toc34, Toc90 (a homologue of plant Toc159)
Tic236, Tic110, Tic62, Tic55, Tic40, Tic32, Tic22 and Tic21, have been and a small unidentified chain (chain X) embedded in the outer mem-
reported as components of the TIC complex2–4. brane. Flanking on the Toc90 side, a β-barrel protein named Ctap4 is
The TIC complex assembles with the TOC complex to form a large located at a closest distance of around 12 Å from TOC (Fig. 1b). For TIC,
translocon supercomplex with a molecular mass of over 1 MDa (refs. 5–7,13). the transmembrane domains of Tic214 and Tic20 form the core region
The TOC–TIC supercomplexes have been found in both land plants surrounded by the transmembrane helices (TMHs) of Ctap5, Simp1,
(Arabidopsis thaliana and Pisum sativum)5,6 and a green alga (C. rein- Simp2 and Simp3 (Fig. 1c). In the intermembrane space, Tic100, Tic56
hardtii)7. Notably, the major components of the TIC (Tic20, Tic21, Tic32 and the soluble domains of Ctap3, Ctap5, Simp1 and Simp2 intertwine
and Tic110) and TOC (Toc75, Toc34 and Toc159) complexes are present with the intermembrane space domains of Tic214 to form the ISC, pro-
in both green and red lineages4,14, whereas Tic214 is conserved in most viding an extended surface to accommodate the intermembrane space
green-lineage species except for grasses, some parasitic plants and domains of Toc90, Toc75, Toc34 and Ctap4. The results of purification,
1
National Laboratory of Biomacromolecules, CAS Centre for Excellence in Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing, China. 2College of Life Sciences,
University of Chinese Academy of Sciences, Beijing, China. 3Department of Molecular Biology, University of Geneva, Geneva, Switzerland. 4Department of Plant Biology, University of Geneva,
Geneva, Switzerland. ✉e-mail: liuzf@ibp.ac.cn
35 Å
InsP6 OM
Toc34 Toc34
Ctap3 Ctap3
180°
90 Å
180 Å
Tic100 Toc75
Tic100 IMS
Ctap5
Simp2 Simp1
Ctap5 Simp2
Tic56 Tic56
35 Å
Tic20 IM Tic214 Tic20
Tic214
Simp3
Simp1
90°
b c Simp3
Toc75
Ctap4
Tic20
100 Å
105 Å
Toc34
Ctap5 Tic56
180°
Ctap3
Toc90 Tic214
Simp2 Simp1
Tic100
Tic214
100 Å
160 Å
Fig. 1 | The overall architecture of the TOC–TIC supercomplex. a, Side views of the supercomplex from the cytosolic side. c, Bottom view of the
of the supercomplex model along the membrane planes. The protein subunits supercomplex from the chloroplast stromal side. The InsP6 molecule at the
are shown as cartoon models. OM, the outer membrane of chloroplast interface between Toc90 and Tic214 is highlighted as a sphere model.
envelope; IM, the inner membrane; IMS, the intermembrane space. b, Top view
characterization and protein identification of the supercomplex sam- as an α-helical domain of Tic214 fills in their gap and binds the two
ple are summarized in Extended Data Fig. 1, Supplementary Data 1 outer-membrane units together (Supplementary Video 1). According
and Supplementary Tables 1 and 2. Previously, incubation of Chla- to the results of the multibody analysis (Supplementary Video 2), the
mydomonas chloroplasts with pre-ferredoxin (pre-Fdx1) and 0.3 mM Toc75–Toc90–Toc34 complex and Ctap4 exhibit at least nine different
ATP led to an affinity-purified translocation intermediate complex motion components. They can either move together in a synchronized
containing most of the proteins found in the structure except Simp37 way or separately as independent bodies. The flexibility of the TOC–TIC
(Supplementary Table 3). The cryo-EM data collection, processing and supercomplex may enable it to adjust the gap between the TOC and TIC
structure refinement results are presented in Extended Data Fig. 2 and complexes so as to facilitate the translocation of preproteins across
Extended Data Table 1. the intermembrane space.
Notably, the three-dimensional (3D) variability and multibody analy-
sis results indicate that the Toc75–Toc90–Toc34 complex and Ctap4
are mobile relative to the ISC and TIC regions (Supplementary Videos 1 The translocon in the outer membrane
and 2). For example, they may rotate slightly as rigid bodies by about Although previous studies suggested that Toc75 can form a channel
3° around a pivot point in the upper side of the ISC region. Ctap4 has by itself10 or in a complex with Toc159 and Toc34 (ref. 11), the cryo-EM
a concerted movement along with the Toc75–Toc90–Toc34 complex, structure shows that Toc75 assembles closely with Toc90 at a 1:1 ratio
Chain X
InsP6 NH2
POTRA3
Tic214 POTRA1
Toc34 POTRA2
NH2
COOH 90°
NH2
Tic100
d Toc75
e COOH
mβ16 Toc75 Toc90
Toc90 mβ2 mβ1
f g
90°
26.0
26
6.0
.0 Å
Lateral Lateral gate
H bond 180°
gate
mβ16 h i j
90° OM
L1224
mβ2
Toc90 Tic214 Y1284
K1412 G1454
NH2 COOH NH2 COOH
Fig. 2 | Structure of the Toc75–Toc90–Toc34 complex associated with lower half of the lateral gate. f,g, Sectional side view (f) and top view (g) of the
Tic214. a, Cartoon model of the Toc75–Toc90–Toc34–Tic214 complex. b, Side surface presentation of the Toc75–Toc90–Toc34–Tic214 complex. The colour
view and top view of Toc75 structure. c, Side view and top view of Toc90 code is the same as in a. h,i, The proteins inside the pore lumen are presented as
structure. d,e, A potential lateral gate located between mβ16 of Toc75 and mβ2 surface models and coloured in gradient modes (Toc90, white to blue; Tic214,
of Toc90. The views are from the external (d) and internal (e) sides of the white to green). h, side view; i, top view. j, Two motifs of Tic214 located inside
β-barrel. The hydrogen bonds (H bonds) between the backbones of adjacent the TOC channel formed by Toc75 and Toc90. The dashed lines indicate the
β-strands are indicated by the dotted lines. The pink dashed triangle labels the approximate locations of the membrane surfaces.
to form the channel in the outer membrane (Fig. 2a). Toc34 binds a heterodimeric TOC channel within the outer membrane. On one side,
to the peripheral region of Toc75 instead of participating directly in the last membrane-embedded β-strand (mβ14) of Toc90 interacts
channel formation. The amino-terminal region of Toc75 contains three closely with the first membrane-embedded β-strand (mβ1) of Toc75
polypeptide-transport-associated domains (POTRA1−3) which are through backbone hydrogen bonds, forming an antiparallel β-sheet
followed by a membrane-embedded open β-barrel domain with 16 (Fig. 2a). On the other side, the first and second membrane-embedded
antiparallel β-strands (Fig. 2b). POTRA2 is tilted by approximately 58° β-strand (mβ1 and mβ2) of Toc90 form weak van der Waals interactions
relative to POTRA1, whereas POTRA2 forms a smaller angle (around with the last membrane-embedded β-strand (mβ16) of Toc75 (Fig. 2d,e).
35°) with POTRA3. The relationship between POTRA1 and POTRA2 Such a weak contact site may potentially function as a flexible lateral
differs largely from the crystal structure of POTRA domains from A. gate, opening for transport of preproteins targeted to the outer mem-
thaliana Toc75 (ref. 17), whereas the POTRA2−POTRA3 domains of the brane, or when the preprotein is too large to fit in the central pore. A
two structures superpose well (Extended Data Fig. 3). In the TOC–TIC recent study demonstrated that an extra-superfolded green fluorescent
supercomplex, POTRA1 is stabilized by nearby proteins (Toc90, Tic214 protein (esGFP) might be translocated through TOC–TIC translocons
and Tic100) and forms specific interactions with them, whereas, in the without unfolding21. As the size of folded GFP (about 30 Å wide and
crystal structure, it is surrounded by symmetry-related molecules. Such 40–50 Å tall) is much larger than the central pore of the TOC channel,
a difference may also suggest that the hinge between the POTRA1 and a transient opening of the lateral gate may be necessary for the channel
POTRA2 domains is flexible and could allow for domain rearrangements to accommodate esGFP and enable it to pass through.
at different stages of preprotein translocation. The transmembrane The amino-proximal regions of Toc159 and Toc34 contain a
domain (TMD) of Toc75 is curved (Fig. 2b) and assembles with the TMD GTP-binding domain (G domain) forming a heterodimer or homodi-
of Toc90 to form an enclosed channel (Fig. 2a and Extended Data Fig. 4). mer in vitro and in vivo22,23 (Extended Data Fig. 5a,b).
As one of the four members (Toc159, Toc132, Toc120 and Toc90) of Notably, the Toc75–Toc90 channel contains a hollow pore in the
the Toc159 family4, plant Toc90 has a protein-import function similar middle (Fig. 2f,g), extending from the cytosolic side to the intermem-
to that of Toc15918,19 and may prefer photosynthetic proteins, such brane space side. The pore lumen surface is mainly lined by amino acid
as the light-harvesting proteins (LHCP)20. The TMD of C. reinhardtii residues from Toc75 (mβ1–mβ5) and Toc90 (α3–mβ1 loop, mβ1–mβ4,
Toc90 contains 14 antiparallel β-strands (Fig. 2c) and forms a C-shaped mβ13–mβ14) (Extended Data Fig. 4c,f). The α3–mβ1 loop and mβ1–mβ2
structure to enclose the adjacent one of Toc75. The β-barrel domain of loop of Toc90 insert into the cavity of Toc75, and fill the pore lumen
Toc90 assembles specifically with Toc75 on two different sides, forming of the TOC complex on the Toc75 side (Fig. 2h,i (blue)). Moreover, it is
OM
Ctap3
Tic214 c 180°
POTRA2 COOH
Tic100 POTRA1 ISD
IS
Ctap5
IM
Tic214
TMD –10 0 10
kCal (mol e–)–1 TMD Tic214
e MAHD
BJD
BJ
f Simp2
U
Lipids T Toc34
Ctap5 G
NTAD
D
5 9 X
CTAD
CT
COOH
OH Tic20 B Toc90 Chain X
NH2 Tic100 A 7
D Tic214
Toc75
Simp3
E
C Tic100
NH2 Simp1
BJD
F 3 4
MORN motif
Tic56 Ctap4
Ctap3
G418 COOH
Fig. 3 | Structural role and components of the ISC. a, The ISC provides glycine residue that is crucial for the in vivo function of Tic100 as reported
binding sites on the surface for the outer-membrane and inner-membrane previously. OMD, outer-membrane domain of Tic214; ISD, ISD of Tic214; TMD,
proteins. The proteins involved in forming the ISC are shown as sphere models, TMD of Tic214 embedded in the inner membrane. MORN motif, the membrane
and the outer-membrane and inner-membrane proteins are shown as cartoon occupation and recognition nexus motif found in Tic100 and potentially
models. b,c, Top view (b) and bottom view (c) of the ISC from the outer- involved in binding to lipids from the membrane. f, The central role of the
membrane and inner-membrane sides, respectively. The proteins are Tic214–Tic100 complex in forming close interactions with the other proteins
presented as surface models, coloured by the level of coulombic electrostatic of the supercomplex. Each protein is indicated as a circle and the single-letter
potential (blue, electropositive; red, electronegative; white, neutral). d,e, The codes on the circles are the chain codes for the structural models of the
overall structure of Tic214 (d) and Tic100 (e). The proteins are coloured in the corresponding proteins. The interactions between adjacent proteins are
rainbow mode. Blue, the amino-terminal region; cyan, green and yellow, middle indicated by the dotted lines.
region; red, the carboxy-terminal region. The red sphere in e highlights a
a substrate protein inside the funnel, three lipid molecules are located Moreover, TMH1 of Simp2 is located at the edge of the lateral gate,
inside the pore and a fourth one is found in a pocket above the funnel defining the peripheral boundary of the exit gate (Fig. 4b). Moreover,
(Fig. 4h and Extended Data Fig. 9a). The lipid molecules form hydro- numerous other lipid (and detergent) molecules are located at the
gen bonds and hydrophobic interactions with amino acid residues peripheral region of the TIC complex (Extended Data Fig. 9d).
from Tic20, Ctap5, Tic214 and Simp1 (Extended Data Fig. 9b,c). At
the bottom side facing the stroma, a lipid molecule (PG604) serves
as a plug to occlude the bottleneck and prevent leakage of the fun- Putative protein translocation pathways
nel (Fig. 4h). Moreover, the funnel has a lateral gate opened towards TOC contains a straight open pore running from the cytosolic side to the
the lipid bilayer (Fig. 4f). A similar lateral gate was also found in SecY, intermembrane space (Fig. 5a). The pore appears to have a bottleneck
functioning as an exit for the hydrophobic signal peptide segment and/ near the cytoplasmic entrance, measuring 11.7 Å wide in the shortest
or the membrane-spanning domains of substrate proteins32 (Fig. 4g). dimension and 20.5 Å wide in the longest dimension (Fig. 5b). It is sur-
The lateral gate in the TIC complex is located between TMH3 of Tic214 rounded by amino acid residues from the mβ1–mβ2 loop region of
and TMH1 of Ctap5, whereas the one in SecY lies between TMH2 and Toc90 as well as the mβ3–mβ4 loop and mβ7–mβ8 of Toc75 (Fig. 5a). The
TMH7 from the same chain. While the two pairs of gate-lining helices surface of the pore lumen is electropositive on one side and electron-
intertwine in different ways (right-handed for the TIC channel versus egative on the other side (Extended Data Fig. 10a,b). While the entrance
left-handed for SecY), they both form V-shaped lateral gates connected appears to be wide enough to accommodate an extended polypeptide
with lipid bilayers. The lateral gate of SecY provides a hydrophobic of the substrate preprotein, the flexible loops around the entrance may
surface groove for binding of a hydrophobic α-helix of the signal adjust dynamically according to different parts of the translocated
sequence32. Similarly, the lateral gate of the TIC channel also forms a preprotein. Below the entrance, the pore diameter increases to 14−22 Å,
surface groove that is mainly lined by hydrophobic residues (such as wider than the entrance (Fig. 5b). There are two exit portals on differ-
Leu159 from Ctap5, Phe186 from Tic214), potentially functioning to ent sides of the bottom (Fig. 5c,d (exits 1 and 2)). Whereas exit 1 is open
bind to the hydrophobic segments of some transit peptides or other directly to the intermembrane space, exit 2 is connected to the exit 3
regions of preproteins transiently during the translocation process. route in a slide-like groove formed by POTRA2−POTRA3 of Toc75 and
Simp1 H bond
Tic20
d e NH2 h
NH2
COOH MGD603
COOH α4 MGD602
TMH1
α4 TMH3 IM PG604
α3
α3 α1 TMH1
IM
α5
Tic20 Tic214 TMD
Fig. 4 | Arrangement of protein subunits and lipid molecules in the densities shown in transparent mode. d,e, The structures of Tic20 (d) and the
inner-membrane complex. a, Side view (a) and bottom view (b) of the Tic214 TMD (e). f, The central funnel-like region of the Tic20–Tic214–Ctap5–
translocon complex in the inner membrane. For a, the area in the purple dashed Simp1 complex. The view is from the intermembrane space side. g, The
box contains the loops from Tic20 and Tic214 covering the funnel entrance protein-conducting channel of SecY with substrate bound. The TMHs
underneath. The view in b is from the stromal side and the area in the dark encircling the central pore are coloured in blue, and the other parts are shown
dashed box contains a central funnel filled with lipid molecules (omitted for in silver. The polypeptide substrate of SecY is shown in yellow (Protein Data
clarity). The red dashed triangle indicates the entrance formed by the α1 and α2 Bank (PDB): 5EUL). h, Binding sites of four lipid molecules at the subunit
of Ctap5 on the intermembrane space side. c, The interface between Tic20 and interfaces. MGD, monogalactosyl-diacylglycerol; PG, phosphatidyl glycerol.
Tic214. The structural models are superposed with corresponding cryo-EM
the nearby parts of Tic100, Tic214 and Ctap3 (Fig. 5c,e and Extended Toc75–Toc90 channel first. Either guided by the surface groove on ISC
Data Fig. 10c,d). Such a groove may help to guide the preproteins to the or facilitated by Tic236 (with a large ISD)33, they may efficiently traverse
cavity above the central funnel of the TIC complex or to the adjacent the intermembrane space and are further translocated across the inner
portal through the triangular entrance by Ctap5. membrane, presumably through the central funnel within the Tic20–
The pore in the central funnel between Tic214 and Tic20 is overall Tic214–Ctap5–Simp1 complex (Fig. 5e (exit 3-1)). As the central funnel of
much narrower than the one in the TOC complex (Fig. 5f), indicating the Tic20–Tic214–Ctap5–Simp1 complex is covered by the flexible loops
that the TIC channel may be in a closed state. The upper half of the from Tic214 and Tic20 (Fig. 4a), opening of the entrance will probably
pore is 7.0−12.1 Å wide, whereas the lower half is only 5.2−6.6 Å wide require rearrangement of the cover loop for the preproteins to enter. The
(Fig. 5g). The constriction site is located near to the exit at the stromal molecular dynamics simulations of the TIC complex embedded in a lipid
surface and surrounded by amino acid residues from Tic214, Ctap5 and bilayer suggest that the cover loop from Tic214 is fairly flexible and may
Tic20 (Fig. 5f). Thus, the TIC pore will need to expand by adjusting local be involved in binding to the transit peptide region of the preprotein,
protein conformations substantially for the preprotein to enter and whereas its spontaneous movement is not large enough to open the
go through. As the TMHs of Ctap5 and Simp1 are not tightly restrained entrance (Supplementary Videos 3 and 4). The central pore may still
by nearby subunits, they might be able to move outwards and adjust need to expand to accommodate the translocated preproteins, so that
flexibly in response to the preprotein being translocated. they can pass through the pore and reach the stroma. Alternatively, the
The TOC and TIC complexes are responsible for translocation of preproteins might bypass the central funnel and use a side portal con-
various nucleus-encoded proteins into different chloroplast subcom- nected with the central funnel (Fig. 5e (exit 3-2)), after going through a
partments1,3. As different substrate preproteins have distinct surface triangle-shaped entrance outlined by two amphipathic helices (α1 and
properties and target locations, they might be translocated through α2) of Ctap5 (Fig. 4b and Extended Data Fig. 10d,e). Such a side portal
different pathways. For soluble proteins targeted to the stroma, such along the surface of TMH1 of Ctap5 might support translocation of pho-
as the small subunit of ribulose 1,5-bisphosphate carboxylase or tosynthetic membrane proteins (such as LHCP) and others, by provid-
ferredoxin13,30, they will need to pass through the central pore of the ing transitional docking sites for their transmembrane/hydrophobic
Toc90 8
Tic214 2
Toc75
A:R1253
mβ7–mβ8 loop 0
7:S467 0 10 20 30 40 50
mβ3–mβ4 loop
Length (Å)
c d e
OM
Exit 2
Exit 1
Exit 2 Exit 3
(to IMS)
Exit 1 –20 0 20
(to IMS) kCal (mol e–)–1
POTRA3
POTRA1
IM
Exit 3 POTRA2
(to groove)
Exit 3-2 Exit 3-1
Tic214
B:W236 Simp1 A:W194 A:K191
f g
Ctap5
10
Tic20 Simp2 8
4
Simp3
90° 5:K143
Ctap5 2
Simp2
Simp1 Tic214 0
0 10 20 30 40 50
Tic20
Length (Å)
Fig. 5 | The intrinsic pores found in the TOC and TIC complexes. a, The approximate locations of the translocation pathways. The TOC and TIC
presence of a continuous wide pore running through the TOC complex. The proteins are presented as surface models coloured by the level of Coulombic
putative pore is presented as a transparent blue tube model. b, The distribution electrostatic potential (blue, electropositive; white, neutral; red electronegative),
of the pore radius along the central axis of the TOC pore. The red arrow and lipid molecules are shown as yellow spheres. f, The central pore of the TIC
indicates the constriction site of the pore with the smallest pore radius. c, The complex shown as a transparent orange tube model. The region in red is the
presence of two exit portals at the bottom of the TOC complex. The two exit constriction site. The key amino acid residues at the constriction site near to
portals are indicated by the dashed elliptical rings. Note that exit 2 and exit 3 the stromal surface (f) or at the cytoplasmic entrance of TOC (a) are presented
share the same portal at the bottom of TOC complex on the opposite side of in sphere models and labelled by chain name:residue name and number. A,
exit 1 portal. d,e, The potential translocation pathways for proteins targeted to Tic214; B, Tic20; 5, Ctap5; 7, Toc75; 9, Toc90. g, The distribution of pore radius
the intermembrane space (d) and the soluble proteins or LHCP proteins along the central axis of the TIC pore. The red arrow indicates the constriction
targeted to stroma (e). The cyan and green dotted lines indicate the site of the pore with the smallest pore radius.
domains. For the preproteins targeted to the intermembrane space, such Previously, it was reported that Toc75 or Tic20 alone can form chan-
as the Tic22 protein34, they may exit the Toc75−Toc90 channel through a nels by itself when reconstituted in liposomes37,38, whereas our research
side portal (exit 1) outlined by the POTRA1−POTRA2 of Toc75 and α3 of demonstrates that Toc75 assembles with Toc90 to form the heteromeric
Toc90, or through the adjacent one (exit 2) between POTRA2−POTRA3 TOC channel and is further connected with the TIC complex. Neverthe-
of Toc75 and the bowl-like structure of the Tic214−Tic100 complex less, it cannot be ruled out that Toc75 or Tic20 may still form channels
(Fig. 5d). Tic236 might also participate in the import of Tic22 preprotein alone, in case of free Toc75 or Tic20 proteins in the membrane.
into chloroplasts according to a recent functional study35. Although the cryo-EM structure of TOC–TIC supercomplex from
C. reinhardtii includes three Toc proteins, four Tic proteins, three
Ctap proteins and three Simp proteins, several other TIC components
Discussion identified previously are still absent in the structure (Supplementary
The cryo-EM map reveals a TOC complex from C. reinhardtii com- Table 3). It was reported that Tic236 functions as a large protein linking
posed of Toc90, Toc75 and Toc34 with a stoichiometry of 1:1:1, whereas the TOC and TIC complexes33, whereas no density corresponding to
previous studies on plant TOC complexes suggested that the stoi- Tic236 can be found in the map. Notably, Tic214 spans both envelope
chiometry of Toc159:Toc75:Toc34 is 1:4:4–5 or 1:3:3 (ref. 11,36). Thus, membranes and, together with Tic100, instead of Tic236, forms the ISC
much larger TOC complexes may exist in plants. Alternatively, the core to link the TOC and TIC complexes (Fig. 3a,f). Tic214 is the only
Toc159–Toc75–Toc34 complexes with a 1:1:1 ratio might coexist with chloroplast-encoded protein of the TOC–TIC supercomplex and may
the Toc75–Toc34 complexes with no Toc159 bound, accounting function as a scaffolding protein.
for the excess molar ratio of Toc75 and Toc34 relative to Toc159. It is also Previous research suggested that Tic110 may form a channel that is
possible that additional Toc75 and Toc34 subunits are associated with sensitive to transit peptides and function as a translocation pore for
the TOC–TIC supercomplex and were lost during the sample prepara- the preproteins at the inner membrane39. Another biochemical study
tion process for the cryo-EM study. on plant TIC complex indicated that Tic21 is loosely associated with
Extended Data Fig. 1 | Purification and characterization of the TOC-TIC from the size exclusion chromatography. Silver staining of the gel was applied
supercomplex from C. reinhardtii. a, A schematic diagram illustrating the for visualization of the proteins. The identities of the protein bands are labelled
overall flowchart of the protein purification and cryo-EM grid preparation on the right side according to the identification results obtained through mass
protocol. b, The profiles of size exclusion chromatography loaded with the spectrometry on the in-gel tryptic digestion products. Note that one of the
sample eluted from the Anti-DYKDDDDK beads. The peak 1 fractions marked in FtsH-like AAA proteins named Ctap1 is present in the sample (d) and might be
the cyan area were pooled, concentrated and used for cryo-EM grid loosely associated with the TIC complex, but became separated from the
preparation. The blue solid line and green solid lines indicate the absorbance TOC-TIC supercomplex during the purification process. For gel source data,
measured with the UV-Vis detector at 280 nm or 488 nm (the values and units see Supplemental Data 1. The SDS-PAGE and blue-native PAGE experiments
are labelled on the Y axes on left and right sides) respectively. The grey dashed were independently repeated three times and twice respectively with similar
line is the size exclusion chromatography of the Gel Filtration Cal Kit High results. e, A representative cryo-EM micrograph of the TOC-TIC supercomplex.
Molecular Weight sample (28-4038-42, Cytiva) loaded as a reference. c and Scale bar, 20 nm. A total of 9,939 independent images of similar quality were
d, The SDS-PAGE (c) and blue-native PAGE (d) analyses on the peak 1 fraction collected from one cryo-EM grid and processed further.
Extended Data Fig. 2 | See next page for caption.
Article
Extended Data Fig. 2 | Cryo-EM data processing of the TOC-TIC densities around the TOC complex by applying the particle subtraction and
supercomplex. a, Flowchart of the cryo-EM data processing and analysis of the local refinement procedure. f, The local resolutions for different regions of the
TOC-TIC supercomplex. (Please refer to the ‘Cryo-EM data processing and final overall reconstruction of the TOC-TIC supercomplex. The local
refinement’ section in Methods for more technical details). The two datasets resolutions were estimated by cryoSPARC and visualized in ChimeraX. g, The
were collected at different spots of the same grid sample. b and d The gold- densities of the detergent micelles surrounding the transmembrane domains
standard Fourier shell correlation (GSFSC) curves of the TOC-TIC of the TOC complex, Ctap4 and the TIC complex. The protein subunits are
supercomplex map (b) and the local map around the TOC complex. c, The coloured in the same way as in Fig. 1, while the detergent micelles are in
posterior precision directional distribution plot of the particles of the final transparent white.
reconstruction generated by cryoSPARC. e, The scheme for improving the
Extended Data Fig. 3 | Comparison of the POTRA domains of C. reinhardtii Arabidopsis thaliana, Spinacea oleracea and Pisum sativum. The sequence
Toc75 with the corresponding ones from plant Toc75. a and b, Superposition alignment was carried out by using the CLC Sequence Viewer 8. The β strands
of the cryo-EM structure of CrToc75 POTRA domains with the crystal structure and α helices are represented by the arrows and cylinders respectively. Note
of Arabidopsis Toc75 POTRA domains (PDB: 5UAY). The superposition was that AtToc75 has an α-helix (marked in purple dotted circle in a and the purple
generated by using Chimera X matchmaker. c, Alignment of the amino acid cylinder in c) after the first β sheet of POTRA 2, which is not found in CrToc75
sequences of the POTRA domains of Toc75 from Chlamydomonas reinhardtii, and has a sequence largely different from the corresponding region in CrToc75.
Article
Extended Data Fig. 4 | Domain organization, secondary structure topology Toc90. Chain 9 in the structural model corresponds to Toc90 (labelled as 9).
and cryo-EM densities of Toc75, Toc90 and Toc34. a, Domain organization of The pore-lining α3-mβ1 loop, mβ1-mβ4, mβ13-mβ14 regions are highlighted in
Toc75 protein. b, Topology of the secondary structures in Toc75. c, Cryo-EM magenta, orange and green. g, Domain organization of Toc34 protein.
densities of various parts in Toc75. The protein is built as chain 7 in the h, Topology of the secondary structures in Toc34. i, Cryo-EM densities of
structural model and labelled as 7. The pore-lining mβ1-mβ5 region is various parts in Toc34. Chain G in the structural model corresponds to Toc34
highlighted in blue. d, Domain organization of Toc90 protein. e, Topology of (labelled as G).
the secondary structures in Toc90. f, Cryo-EM densities of various parts in
Extended Data Fig. 5 | See next page for caption.
Article
Extended Data Fig. 5 | The cryo-EM densities in the cytoplasmic region barely visible in the map. b, Fitting of the cytosolic domain densities with a
above the TOC complex and the structure of Ctap4. a, The cryo-EM map of heterodimeric model of the G domains from Toc34 and Toc90. The model was
TOC-TIC supercomplex filtered through the Gaussian filter. The contour level constructed by referring to the homodimeric structure of Toc34 G domain
is at 0.011 (Chimera). Apparently, there are some weak cryo-EM densities above (PDB code: 3BB1). The map contour level is at 0.0125. Colour codes: red,
the TMDs of the Toc75-Toc90-Toc34 complex, potentially belonging to the G G-domain of Toc34; blue, G-domain and the N-terminal domain (NTD) of Toc90.
domains of Toc90 and Toc34. The densities inside the elliptical dashed ring c, Domain organization of the Ctap4 protein. d, Topological arrangement of
may contain the putative G-domains of Toc90 and Toc34. The G domains are the secondary structures in Ctap4 as predicted by Alphafold2. e, Cryo-EM
likely very mobile as the densities are much weaker than the transmembrane densities of Ctap4 (chain 4). f and g, Side view and top view of Ctap4 structure.
domains and the loops connecting them to the transmembrane domains are HM1 and HM2, hydrophilic motifs 1&2.
Extended Data Fig. 6 | See next page for caption.
Article
Extended Data Fig. 6 | Location and identification of an InsP6 molecule in d and e, The 2D interaction map of InsP6 in the TOC-TIC supercomplex (d) or
the TOC-TIC supercomplex from C. reinhardtii. a, Electrostatic surface RsPopP2 (PDB:5W3X, e) calculated by using the MOE program. RsPopP2 is a
representation of the TOC complex hosting an InsP6-binding site. The zoom-in bacterial effector protein produced by the plant pathogen Ralstonia
view on the right side shows an InsP6 molecule accommodated in a positive solanacearum and hosts an InsP6-binding site similar to the one found in the
charge-rich cavity. The electropositive surface of the cavity is complementary TOC complex. The phosphate groups of InsP6 molecules are surrounded by
to the negative charges carried by the phosphate groups of InsP6 . b, The cryo- positively-charged residues in both cases. f and g, Mass spectrometry analysis
EM density of the InsP6 molecule with the stick model superposed. The cryo-EM of the extract from the TOC-TIC supercomplex sample (f) or the standard
map is contoured at 0.25 V. c, Interactions of InsP6 with adjacent amino acid sample of phytic acid (sodium salt, g).
residues from Tic214 (green) and Toc90 (blue) in the TOC-TIC supercomplex.
Extended Data Fig. 7 | See next page for caption.
Article
Extended Data Fig. 7 | The assembly and components of the intermembrane into the bottom of the bowl-like structure formed by Tic214 and Tic100. The
space complex in the TOC-TIC supercomplex. a, The assembly interfaces last three α-helices (α7-9) of Ctap3 bind to the amino-terminal helix of Tic56
between ISC and the TOC/TIC complex. b, Domain organization and cryo-EM and the carboxy-terminal helix of Tic100. On the opposite side, Ctap5 attaches
density of the intermembrane space domain of Tic214. c, Domain organization its carboxy-proximal α-helical domain (Glu215-Ala329) to a surface groove of
and cryo-EM density of Tic100. d, Domain organization, density and cartoon the Tic100-Tic214 complex below the POTRA1 and POTRA2 domains of Toc75.
model of Tic56. e, Domain organization, densities and cartoon models of Ctap3 It interacts closely with the BJD of Tic100 and Tic214 (Gln1621-Phe1645 and
and Ctap5. Ctap3 has an extended α-helical domain (Arg295-Ser472) at the Tyr1917-Ile1949) and provides binding sites for the POTRA1 and POTRA2
carboxy-proximal region, intertwining with the bowl-like region of Tic214- domains of Toc75. Thereby, Ctap5 may help to stabilize the Tic214-Tic100
Tic100 complex. It docks two short α-helices (α1 and α2) on the outer surface of complex and serves as a bridge to connect Toc75 with the inner-membrane
the upper half of ISC, inserts a long α-helix (α3) and two short ones (α4 and α5) complex.
Extended Data Fig. 8 | Topology and cryo-EM densities of the six proteins (chain B), Simp3 (chain D) and Simp1 (chain C) proteins. b-g, Cryo-EM densities
involved in forming the TIC complex. a, Topological arrangement of of various parts in the six proteins. h-j, Cartoon models of Simp1, Simp2 and
secondary structures in Ctap5 (chain 5), Simp2 (chain U), Tic214 (chain A), Tic20 Simp3.
Article
Extended Data Fig. 9 | The lipid and detergent molecules associated with hydrogen bonds and hydrophobic interactions formed between the four lipid
the TOC-TIC supercomplex. a, The cryo-EM densities of four central lipid molecules and nearby amino acid residues. d, The cryo-EM densities of other
molecules located in or above the putative pore of the TIC complex. peripheral lipid molecules associated with Tic214(A), Tic20(B), Simp3(D),
b, Interactions of the four lipid molecules with adjacent amino acid residues. Ctap5(5) and Toc75(7).
Green, Tic214; Pink, Tic20; brown, Ctap5. c, LigPlot analyses showing the
Extended Data Fig. 10 | The surface presentations of the TOC complex, the connecting the channels of the TOC and TIC complexes. The local regions
intermembrane space domain connecting the TOC channel with the TIC labelled by “C” and “Δ” are the cavity above the central funnel of the TIC
channel, and the TIC complex. a and b, The electrostatic potential surface of complex and the triangular entrance formed by Ctap5, Simp2 and Tic214,
the TOC complex viewed from the cytoplasmic and intermembrane space respectively. e and f, The electrostatic potential surface of the TIC complex
sides, respectively. c, The electrostatic potential surface of the ISC connecting viewed from the intermembrane space and stromal sides, respectively.
the TOC complex with the TIC complex. d, The presence of a surface groove
Article
Extended Data Table 1 | Cryo-EM data collection, refinement and validation statistics
See also Extended Data Fig. 2 for more details on cryo-EM data processing, refinement and evaluation.
Matters arising
Open access
Brain-wide association studies (BWAS)—which correlate individual and comparing the in-sample effect sizes (prediction–outcome corre
differences in phenotypic traits with measures of brain structure and lation, r) estimated from the training sample to the performance in
function—have become a dominant method for linking mind and brain an independent replication sample. On the basis of a bootstrap analy-
over the past 30 years. Univariate BWAS typically test tens to hundreds sis, with variously sized pairs of samples drawn randomly from the
of thousands of brain voxels individually, whereas multivariate BWAS Adolescent Brain Cognitive Development study, the authors report a
integrate signals across brain regions into a predictive model. Numerous severe effect-size inflation of Δr = −0.29 (average difference between
problems have been raised with univariate BWAS, including a lack the in-sample effect sizes in the discovery sample and the out-of-sample
of power and reliability and an inability to account for pattern-level effect sizes in the replication sample) and conclude that “[e]ven at the
information embedded in distributed neural circuits1–4. Multivariate largest sample sizes (n ≈ 2,000), multivariate in-sample associations
predictive models address many of these concerns, and offer substan- remained inflated on average”.
tial promise for delivering brain-based measures of behavioural and The issue with claims of inflation is that the in-sample effect size
clinical states and traits2,3. estimates of Marek et al.4 were based on training multivariate mod-
In their recent paper4, Marek et al. evaluated the effects of sample size els on the entire discovery sample, without cross-validation or other
on univariate and multivariate BWAS in three large-scale neuroimaging internal validation (as confirmed by inspection of the code and dis-
datasets and came to the general conclusion that “BWAS reproducibil- cussion with the authors). Such in-sample correlations are not valid
ity requires samples with thousands of individuals”. We applaud their effect-size estimates, as they produce a well-known overfitting bias
comprehensive analysis, and we agree that (1) large samples are needed that increases with model complexity5. Standard practice in machine
when conducting univariate BWAS and (2) multivariate BWAS reveal learning is to evaluate model accuracy (and other performance metrics)
substantially larger effects and are therefore more highly powered. on data independent of those used for training. In line with current
Marek et al.4 find that multivariate BWAS provide inflated in-sample recommendations for multivariate brain–behaviour analyses6,7, this
associations that often cannot be replicated (that is, are underpow- is typically performed using internal cross-validation (for example,
ered) unless thousands of participants are included. This implies that k-fold) to estimate unbiased effect sizes in a discovery sample, and
effect-size estimates from the discovery sample are necessarily inflated. (less commonly) further validating significant cross-validated effects
However, we distinguish between the effect-size estimation method in held-out or subsequently acquired replication samples2,5.
(in-sample versus cross-validated) and the sample (discovery versus Using cross-validation to estimate discovery-sample effects impacts
replication), and show that, with appropriate cross-validation, the the pool of studies selected for replication attempts, the degree of
in-sample inflation that Marek et al.4 report in the discovery sample can effect-size attenuation in replication samples, and the sample size
be entirely eliminated. With additional analyses, we demonstrate that needed for effective replication and mitigation of publication bias.
multivariate BWAS effects in high-quality datasets can be replicable To demonstrate this and provide quantitative estimates of sample size
with substantially smaller sample sizes in some cases. Specifically, requirements in multivariate BWAS, we analysed functional connec-
applying a standard multivariate prediction algorithm to functional tivity data from the Human Connectome Project8 (one of the datasets
connectivity in the Human Connectome Project yielded replicable in Marek et al.4) using cross-validation to estimate discovery-sample
effects with sample sizes of 75–500 for 5 of 6 phenotypes tested (Fig. 1). effect sizes. As shown in Fig. 1a–d, cross-validated discovery effect-
These analyses are limited to a selected number of phenotypes in a size estimates are unbiased (that is, not inflated on average), irrespec-
relatively high-quality dataset (measured in a young adult population tive of the sample size and the magnitude of the effect. As expected,
with a single scanner) and should not be overgeneralized. However, even with cross-validation, smaller sample sizes resulted in lower power
they highlight that the key determinant of sample size requirements (Fig. 1e) and increased variability in effect-size estimates across sam-
is the true effect size of the brain–phenotype relationship and that, ples (Fig. 1c). Such variability is undesirable because it reduces the
with proper internal validation, appropriate effect-size estimates and probability of independent replication (Fig. 1f). Moreover, selection
sufficiently large effects for moderately sized studies are possible. biases—most notably, publication bias—can capitalize on such variabil-
Marek et al.4 evaluate in-sample effect-size inflation in multivariate ity to inflate effect sizes in the literature (Fig. 1g). Although these effects
BWAS by training various multivariate models in a ‘discovery sample’ of using small sample sizes are undesirable, they do not invalidate
Institute of Diagnostic and Interventional Radiology and Neuroradiology, University Medicine Essen, Essen, Germany. 2Center for Translational Neuro- and Behavioral Sciences, Department of
1
Neurology, University Medicine Essen, Essen, Germany. 3Department of Psychological and Brain Sciences, Dartmouth College, Hanover, NH, USA. ✉e-mail: tamas.spisak@uk-essen.de
a b c
0.8
Inflation (Δr)
Overestimated
0.6 0.5
Discovery sample r
0.4 0
0.2 Underestimated
0 Without CV With CV
–0.2 d
–0.4
In-sample r
0.5
–0.6
–0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 0
Replication sample r Replication sample r 0 200 400
Sample size: 50 100 200 300 495 Sample size
With cross-validation
Power Replication Publication bias
e Number in Number in f Number in Number in g
Δr( )
100 1
PC + Ridge PCA + SVR
100
PC + Ridge PCA + SVR
Inflation
375 350 400
Power
400
Prep
325 375
0 0 0
100 100 100 75 1 100
125 75 75
Inflation
Power
Fig. 1 | Examples of multivariate BWAS providing unbiased effect sizes and (coloured bars) using the prediction algorithm of Marek et al.4 (e and f (top),
high replicability with low to moderate sample sizes. a, Discovery sample the sample size required for 80% power or Prep is shown). The remaining three
effects in multivariate BWAS are inflated only if estimates are obtained without phenotypes require sample sizes of >500 (bars with arrows). Power and Prep can
cross-validation (CV). b, Cross-validation fully eliminates in-sample effect-size be substantially improved with a ridge regression-based model recommended
inflation and, as a consequence, provides higher replicability. Data are from in some comparison studies10,11 (e and f (bottom), with 80% power and Prep with
the Human Connectome Project (HCP1200, PTN release, n = 1,003). Each point sample sizes as low as n = 100 and n = 75, respectively, when predicting cognitive
in a and b corresponds to one bootstrap subsample, as in figure 4b of Marek ability, and sample sizes between 75 and 375 for other investigated variables
et al.4. The dotted lines denote the threshold for P = 0.05 with n = 495. Mean (fluid intelligence, episodic memory and cognitive flexibility), except inhibition
multivariate brain–behavioural phenotype associations across 100 bootstrap assessed with the flanker task, which replicated with n = 375 but did not reach
samples at n = 200 and for the full sample are denoted by red and purple dots. 80% power with n = 500. g, We estimated interactions between sample size and
c, The inflation of in-sample effect size obtained without cross-validation (red) publication bias by computing effect size inflation (rdiscovery − rreplication) only for
is reduced, but does not disappear, at higher sample sizes. Conversely, cross- those bootstrap cases in which prediction performance was significant (P > 0.05)
validated estimates (blue) are slightly pessimistic with low sample sizes in the replication sample. Our analysis shows that the effect-size inflation due
and become quickly unbiased as sample size is increased. d, Without cross- to publication bias is modest (<10%) with fewer than 500 participants for half of
validation, in-sample effect-size estimates are non-zero (r ≈ 0.5, red), even when the phenotypes using the model from Marek et al.4 and all phenotypes but the
predicting permuted outcome data. Cross-validation eliminates systematic bias flanker using the ridge model. The blue squares show conditional relationships
across all sample sizes (blue). The dashed lines in c and d denote 95% parametric assessed to derive metrics in e,f and g with reference to b. The top and bottom
confidence intervals, and the shaded areas denote bootstrap- and permutation- squares indicate positive and negative results in the discovery sample,
based confidence intervals. e,f, Cross-validated analysis reveals that sufficient respectively. The left and right squares indicate negative and positive results in
in-sample power (e) and out-of-sample replication probability (Prep) (f) can be the replication sample. The blue squares indicate how these conditions were
achieved for a variety of phenotypes at low or moderate sample sizes. applied to derive the metrics.
80% power and Prep are achievable in <500 participants for 3 out of 6 phenotypes
the use of multivariate BWAS in small samples, and publication biases size of the effects linking them, the algorithm and model-selection steps
can be mitigated by practices that, like internal cross-validation, are used and the use cases for the resulting brain measures. For example,
quickly becoming standards in the field2,5. These include preregistra- multivariate models trained on as few as 20 participants9 can have high
tion, registered reports, reporting confidence intervals and the use reliability (ICC = 0.84)10, broad external validity and large effect sizes
of hold-out samples tested only once on a single, optimized model to (Hedges g = 2.3)11 in independent samples (for example, more than 600
avoid overfitting. participants from 20 independent studies in ref. 11) when predicting
Given these considerations, we wondered how many participants are behavioural states within-person rather than traits. In this case, the
generally required for multivariate BWAS. The answer to this question benefit of large samples is primarily in accurately estimating local brain
depends on the reliability of both phenotypic and brain measures, the weights (model parameters)12 rather than increasing out-of-sample
Competing interests The authors declare no competing interests. © The Author(s) 2023
In our previous study1, we documented the effect of sample size on the false-negative rate), therefore restricting BWAS scope, and (2) inflation
reproducibility of brain-wide association studies (BWAS) that aim to of reported effects3,10–12. Thus, regardless of the method, associations
cross-sectionally relate individual differences in human brain structure based on small samples can remain distorted and lack generalizability
(cortical thickness) or function (resting-state functional connectivity until confirmed in large, diverse, independent samples.
(RSFC)) to cognitive or mental health phenotypes. Applying univariate We always test for BWAS replication with null models (using permu-
and multivariate methods (for example, support vector regression tation tests) of out-of-sample estimates to ensure that our reported
(SVR)) to three large-scale neuroimaging datasets (total n ≈ 50,000), reproducibility is unaffected by in-sample overfitting. Nonetheless,
we found that overall BWAS reproducibility was low for n < 1,000, due Spisak et al.8 argue against plotting inflated in-sample estimates1,10
to smaller than expected effect sizes. When samples and true effects are on the y axis, and out-of-sample values on the x axis, as we did
small, sampling variability, and/or overfitting can generate ‘statistically (Fig. 1a). Instead, they propose plotting cross-validated associations
significant’ associations that are likely to be reported due to publication from an initial, discovery sample (Fig. 1b ( y axis)) against split-half
bias, but are not reproducible2–5, and we therefore suggested that BWAS out-of-sample associations (x axis). However, cross-validation—just
should build on recent precedents6,7 and continue to aim for samples like split-half validation—estimates out-of-sample, and not in-sample,
in the thousands. In the accompanying Comment, Spisak et al.8 agree effect sizes13. The in-sample associations1,10 for the method of Spisak
that larger BWAS are better5,9, but argue that “multivariate BWAS effects et al.8 (Fig. 1b), that is, from data in the sample used to develop the
in high-quality datasets can be replicable with substantially smaller model, show the same degree of overfitting (Fig. 1a versus Fig. 1b). The
sample sizes in some cases” (n = 75–500); this suggestion is made on plot of Spisak et al.8 (Fig. 1c) simply adds an additional out-of-sample
the basis of analyses of a selected subset of multivariate cognition/RSFC test (cross-validation before split half), and therefore demonstrates
associations with larger effect sizes, using their preferred method (ridge the close correspondence between two different methods for
regression with partial correlations) in a demographically more homo- out-of-sample effect estimation14. Analogously, we can replace the
geneous, single-site/scanner sample (Human Connectome Project cross-validation step in the code of Spisak et al.8 with split-half valida-
(HCP), n = 1,200, aged 22–35 years). tion (our original out-of-sample test), obtaining split-half effects in
There is no disagreement that a minority of BWAS effects can the first half of the sample, and then comparing them to the split-half
replicate in smaller samples, as shown with our original methods1). estimates from the full sample (Fig. 1d). The strong correspondences
Using the exact methodology (including cross-validation) and code between cross-validation followed by split-half (Spisak et al. method8;
of Spisak et al.8 to repeat 64 multivariate BWAS in the 21-site, larger Fig. 1c) and repeated split-half validation (Fig. 1d) are guaranteed by
and more diverse Adolescent Brain Cognitive Development Study plotting out-of-sample estimates (from the same dataset) against one
(ABCD, n = 11,874, aged 9–11 years), we found that 31% replicated at another. Here, plotting cross-validated discovery sample estimates on
n = 1,000, dropping to 14% at n = 500 and none at n = 75. Contrary to the y axis (Fig. 1c,d) provides no additional information beyond the x
the claims of Spisak et al.8, replication failure was the outcome in most axis out-of-sample values. The critically important out-of-sample pre-
cases when applied to this larger, more diverse dataset. Basing general dictions, required for reporting multivariate results1, generated using
BWAS sample size recommendations on the largest effects has at least the method of Spisak et al.8 and our method are nearly identical (Fig. 1e).
two fundamental flaws: (1) failing to detect other true effects (for exam- As Spisak et al.8 highlight, cross-validation of some type is considered
ple, reducing the sample size from n = 1,000 to n = 500 leads to a 55% to be standard practice10, and yet the distribution of out-of-sample
1
Department of Psychiatry, Massachusetts General Hospital, Harvard Medical School, Boston, MA, USA. 2Department of Radiology, Washington University School of Medicine, St Louis, MO,
USA. 3Department of Psychiatry, Washington University School of Medicine, St Louis, MO, USA. 4Department of Neurology, Washington University School of Medicine, St Louis, MO, USA.
5
Department of Biomedical Engineering, Washington University in St Louis, St Louis, MO, USA. 6Division of Biostatistics, University of California San Diego, La Jolla, CA, USA. 7Oxford Big Data
Institute, Li Ka Shing Centre for Health Information and Discovery, Nuffield Department of Population Health, University of Oxford, Oxford, UK. 8Department of Electrical and Computer
Engineering, National University of Singapore, Singapore, Singapore. 9Centre for Sleep and Cognition, National University of Singapore, Singapore, Singapore. 10Centre for Translational MR
Research, National University of Singapore, Singapore, Singapore. 11N.1 Institute for Health, Institute for Digital Medicine, National University of Singapore, Singapore, Singapore. 12Integrative
Sciences and Engineering Programme, National University of Singapore, Singapore, Singapore. 13Martinos Center for Biomedical Imaging, Massachusetts General Hospital, Charlestown, MA,
USA. 14Department of Psychological and Brain Sciences, Washington University in St Louis, St Louis, MO, USA. 15Department of Psychology, University of Pittsburgh, Pittsburgh, PA, USA.
16
Department of Psychiatry, University of Pittsburgh, Pittsburgh, PA, USA. 17Masonic Institute for the Developing Brain, University of Minnesota Medical School, Minneapolis, MN, USA.
18
Department of Pediatrics, University of Minnesota Medical School, Minneapolis, MN, USA. 19Institute of Child Development, University of Minnesota Medical School, Minneapolis, MN, USA.
20
Program in Occupational Therapy, Washington University School of Medicine, St Louis, MO, USA. 21Department of Pediatrics, Washington University School of Medicine, St Louis, MO, USA.
22
These authors contributed equally: Brenden Tervo-Clemmens, Scott Marek. 23These authors jointly supervised this work: Damien A. Fair, Nico U. F. Dosenbach. ✉e-mail: btervo-clemmens@
mgh.harvard.edu; smarek@wustl.edu; faird@umn.edu; ndosenbach@wustl.edu
Out-of-sample r (cross-validation)
0.8 0.8 0.8 0.8
Out-of-sample r (split-half)
0.6 0.6 0.6 0.6
0.4 0.4 0.4 0.4
In-sample r
In-sample r
0.2 0.2 0.2 0.2
0 0 0 0
–0.2 Sample size –0.2 –0.2 –0.2
–0.4 50 495 –0.4 –0.4 –0.4
-0.6 –0.6 –0.6 –0.6
–0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25
Out-of-sample r Out-of-sample r Out-of-sample r Out-of-sample r
Multivariate r
Multivariate r
Multivariate r
0.2
0.6 0.6 0.6
0
0.4 0.4 0.4
–0.2
0.2 0.2 0.2
–0.4
–0.6 0 0 0
–0.6 –0.4 –0.2 0 0.2 0.4 0.6 30 100 300 1,000 30 100 300 1,000 30 100 300 1,000
Cross-validation Sample size Sample size Sample size
out-of-sample r
Fig. 1 | In-sample versus out-of-sample effect estimates in multivariate validation provides a different (compared with c) out-of-sample association
BWAS. a–e, Methods comparison between our previous study1 (split-half) and of the first half of the total data (that is, each of the first stage split halves is
Spisak et al.8 (cross-validation followed by split-half). ‘Marek, Tervo-Clemmens’ one-quarter of the total data; y axis). The appropriate and direct comparison
and ‘Spisak’ refer to the methodolgies described in ref. 1 and ref. 8, respectively. of in-sample associations between Spisak et al.8 and our previous study1 is
For a–e, HCP 1200 Release (full correlation) data were used to predict age- comparing b to a, rather than c to a. The Spisak et al. method8 (cross-validation
adjusted total cognitive ability. Analysis code and visualizations (x,y scaling; followed by split-half validation) does not reduce in-sample overfitting (b) but,
colours) are the same as in Spisak et al.8. The x axes in a–e always display the instead, adds an additional out-of-sample evaluation (c), which is nearly
split-half out-of-sample effect estimates from the second (replication) half of identical to split-half validation twice in a row (d), and makes it clear why the
the data (correlation between true scores and predicted scores; as in Spisak out-of-sample performance of these two methods is likewise nearly identical.
et al.8 and in our previous study1; Supplementary Methods). a, In-sample e, Correspondence between out-of-sample associations (to the left-out half)
(training correlation; y axis) as a function of out-of-sample associations from the additional cross-validation step proposed by Spisak et al.8 (mean
(plot convention in our previous study1). b, Matched comparison of the true across folds; y axis) and the original split-half validation from our previous
in-sample association (training correlations, mean across folds; y axis) in the study1 (x axis). The identity line is shown in black. f, In-sample (r; light blue) and
method proposed by Spisak et al.8. c, The proposed correction by Spisak et al.8 out-of-sample (r; dark blue) associations as a function of sample size. Data are
that inserts an additional cross-validation step to evaluate the first half from figure 4a–d of ref. 1. g, Published literature review of multivariate r (y axis)
of data, which by definition makes this an out-of-sample association (y axis). as a function of sample size (data from ref. 15) displayed with permission.
d, Replacing the cross-validation step from Spisak et al.8 with a split-half For f and g, best fit lines are displayed in log10 space. h, Overlap of f and g.
associations (Fig. 1f (dark blue)) does not match published multivariate r = 0.37; compare with the correlation strength for height versus weight
BWAS results (Fig. 1g), which have largely ranged from r = 0.25 to 0.9, r = 0.44)20 and age (not a complex behavioural phenotype), unrepresent-
decreasing with increasing sample size10,15,16. Instead, published effects ative of BWAS as a whole (Fig. 2b (colour versus grey lines)). As the HCP is
more closely follow the distribution of in-sample associations (Fig. 1h). the relatively smallest and most homogeneous dataset, we applied the
This observation suggests that, in addition to small samples, struc- exact method and code of Spisak et al.8 to the ABCD data (Fig. 2c and Sup-
tural problems in academic research (for example, non-representative plementary Table 2). At n = 1,000 (training; n = 2,000 total), only 31% of
samples, publication bias, misuse of cross-validation and unintended BWAS (44% RSFC, 19% cortical thickness) were replicable (Fig. 2d; defined
overfitting) have contributed to the publication of inflated effects12,17,18. as in Spisak et al.8; Supplementary Information). Expanding BWAS scope
A recent biomarker challenge5 showed that cross-validation results beyond broad cognitive abilities towards complex mental health out-
continued to improve with the amount of time researchers spent with comes therefore requires n > 1,000 (Fig. 2b–d). The absolute largest
the data, and the models with the best cross-validation results per- BWAS (cognitive ability: RSFC, green) reached replicability only using
formed worse on never-seen held-back data. Thus, cross-validation n = 400 (n = 200 train; n = 200 test) with an approximate 40% decrease in
alone has proven to be insufficient and must be combined with the out-of-sample prediction accuracies from HCP to ABCD (Fig. 2e (lighter
increased generalizability of large, diverse datasets and independent green, left versus right)). The methods of Spisak et al.8 and our previ-
out-of-sample evaluation in new, never before seen data5,10. ous study1 returned equivalent out-of-sample reproducibility for this
The use of additional cross-validation in the discovery sample by BWAS (cognitive ability: RSFC) in the larger, more diverse ABCD data
Spisak et al.8 does not affect out-of-sample prediction accuracies (Fig. 1e). (Fig. 2e (right, dark versus light green)). Thus, the smaller sample sizes
However, by using partial correlations and ridge regression on HCP data, (Fig. 2b,c) that are required for out-of-sample reproducibility (Fig. 2e)
they were able to generate higher out-of-sample prediction accuracies reported by Spisak et al.8 in the HCP data did not generalize to the larger
than our original results in ABCD (Fig. 2a). The five variables they selected ABCD dataset. See also our previous study1 for a broader discussion of
are strongly correlated19 cognitive measures from the NIH Toolbox (mean convergent evidence across HCP and ABCD datasets.
Out-of-sample r
Out-of-sample r
intelligence
Cognitive
0.3 0.3 flexibility 0.3
Episodic
0.2 0.2 memory 0.2
Inhibition
0.1 0.1 (flanker) 0.1
Additional
0 0 BWAS 0
Bivariate correlation r
75
Out-of-sample r 0.4 0.50 0.50
Out-of-sample r
ABCD
0.3
0.25 0.25
50
0.2
0 0
25 0.1
SVR –0.25 –0.25
0 Ridge
0 –0.50 –0.50
30 100 300 1,000 50 200 1,000 50 200 1,000
HCP ABCD
Training sample size Total sample size
Fig. 2 | BWAS reproducibility, scope and prediction accuracy using the of our original method in our previous study1 and the method proposed by
method of Spisak et al. a, Example bootstrapped BWAS of total cognitive Spisak et al.8 at the full split-half sample size of HCP (left) and ABCD (right).
ability (green) and null distribution (black) (y axis), as a function of sample size Out-of-sample correlations (RSFC with total cognitive ability, y axis) for the
(x axis) from the suggested method of Spisak et al.8 (RSFC by partial correlation; method used in our previous study1 (dark green; RSFC by correlation, PCA, SVR)
prediction by ridge regression) in the HCP dataset (n = 1,200, 1 site, 1 scanner, and by Spisak et al.8 (light green; RSFC by partial correlation, ridge regression).
60 min RSFC/participant, 76% white). Sample sizes were log10 -transformed for Repeating the method proposed by Spisak et al.8 in ABCD (right) and comparing
visualization. b, Out-of-sample correlation (between true scores and predicted this to the method used in our previous study1 results in a very similar out-of-
scores) from ridge regression (y axis; code from Spisak et al.8) as a function of sample r. f, Simulated individual studies (light green circles; n = 1,000 per
training sample size (x axis, log10 scaling) for 33 cognitive and mental health sample size) and meta-analytic estimates (black dot, ±1 s.d.) using the method
phenotypes (Supplementary Information) in the HCP dataset. Each line displays of Spisak et al.8 (partial correlations in the HCP dataset) for the largest univariate
a smoothed fit estimate (through penalized splines in general additive models) association (left; y axis, bivariate correlation) and multivariate association
for a brain (RSFC (partial correlations, as proposed by Spisak et al.8), cortical (right; y axis, out-of-sample correlation) for total cognitive ability versus RSFC,
thickness) phenotype pair (66 total) that has 100 bootstrapped iterations as a function of total sample size (x axis; bivariate correlation for sample sizes
from sample sizes of 25 to 500 (inclusive) in increments of 25 (20 total bins). of 50, 200 and 1,000, and multivariate sum of train and test samples, each 25,
Sample sizes were log10 -transformed (for visualization) before general additive 100 and 500). For univariate approaches, studies of any sample size, when
model fitting. c, The same as in b, but in the ABCD dataset (n = 11,874, 21 sites, appropriately aggregated to a large total sample size, can correctly estimate
3 scanner manufacturers, 20 min RSFC/participant, 56% white) using 32 the true effect size. However, for multivariate approaches, even when
cognitive and mental health phenotypes at sample sizes of 25, 50, 75 and from aggregating across 1,000 independent studies, studies with a small sample
100 to 1,900 (inclusive) in increments of 100 (22 total bins). d, The percentage size produce prediction accuracies that are downwardly biased relative to
of brain–phenotype pairs (BWAS) from b and c with significant replication on the large sample studies, highlighting the need for large samples in multivariate
basis of the method of Spisak et al.8 (Supplementary Information). e, Comparison analyses.
Notably, the objections of Spisak et al.8 raise additional reasons to white Americans transferred poorly to African Americans and vice versa
stop the use of smaller samples in BWAS that were not highlighted in (within dataset)24. Historically, BWAS samples have lacked diversity,
our original article. Multivariate BWAS prediction accuracies—absent neglecting marginalized and under-represented minorities25. Large
overfitting—are systematically suppressed in smaller samples5,9,21, as studies with more diverse samples and data aggregation efforts can
prediction accuracy scales with increasing sample size1,9. Thus, the improve BWAS generalizability and reduce scientific biases contribut-
claim that “cross-validated discovery effect-size estimates are unbi- ing to massive health inequities26,27.
ased” does not account for out-of-dataset generalizability and down- Spisak et al.8 worry that “[r]equiring sample sizes that are larger
ward bias. In principle, if unintended overfitting and publication bias than necessary for the discovery of new effects could stifle innova-
could be fully eliminated, meta-analyses of small-sample univariate tion”. We appreciate the concern that rarer populations may never
BWAS would return the correct association strengths (Fig. 2f (left)). be investigated with BWAS. Yet, there are many non-BWAS brain–
However, meta-analyses of small multivariate BWAS would always behaviour study designs (fMRI ≠ BWAS) focused on within-patient
be downwardly biased (Fig. 2f (right)). If we are interested in maxi- effects, repeated-sampling and signal-to-noise-ratio improvements
mizing prediction accuracy, essential for clinical implementation of that have proven fruitful down to n = 1 (ref. 28). By contrast, the strength
BWAS22, large samples and advancements in imaging and phenotypic of multivariate BWAS lies in leveraging large cross-sectional samples
measurements1 are necessary. to investigate population-level questions. Sample size requirements
Repeatedly subsampling the same dataset, as Spisak et al.8 and we should be based on expected effect sizes and real-world impact,
have done, overestimates reproducibility compared with testing on a and not resource availability. Through large-scale collaboration and
truly new, diverse dataset. Just as in genomics23, BWAS generalization clear standards on data sharing, GWAS has reached sample sizes in the
failures have been highlighted5,24. For example, BWAS models trained on millions29–31, pushing genomics towards new horizons. Similarly, BWAS
Open access
Brain-wide association studies (BWAS)—which correlate individual and comparing the in-sample effect sizes (prediction–outcome corre
differences in phenotypic traits with measures of brain structure and lation, r) estimated from the training sample to the performance in
function—have become a dominant method for linking mind and brain an independent replication sample. On the basis of a bootstrap analy-
over the past 30 years. Univariate BWAS typically test tens to hundreds sis, with variously sized pairs of samples drawn randomly from the
of thousands of brain voxels individually, whereas multivariate BWAS Adolescent Brain Cognitive Development study, the authors report a
integrate signals across brain regions into a predictive model. Numerous severe effect-size inflation of Δr = −0.29 (average difference between
problems have been raised with univariate BWAS, including a lack the in-sample effect sizes in the discovery sample and the out-of-sample
of power and reliability and an inability to account for pattern-level effect sizes in the replication sample) and conclude that “[e]ven at the
information embedded in distributed neural circuits1–4. Multivariate largest sample sizes (n ≈ 2,000), multivariate in-sample associations
predictive models address many of these concerns, and offer substan- remained inflated on average”.
tial promise for delivering brain-based measures of behavioural and The issue with claims of inflation is that the in-sample effect size
clinical states and traits2,3. estimates of Marek et al.4 were based on training multivariate mod-
In their recent paper4, Marek et al. evaluated the effects of sample size els on the entire discovery sample, without cross-validation or other
on univariate and multivariate BWAS in three large-scale neuroimaging internal validation (as confirmed by inspection of the code and dis-
datasets and came to the general conclusion that “BWAS reproducibil- cussion with the authors). Such in-sample correlations are not valid
ity requires samples with thousands of individuals”. We applaud their effect-size estimates, as they produce a well-known overfitting bias
comprehensive analysis, and we agree that (1) large samples are needed that increases with model complexity5. Standard practice in machine
when conducting univariate BWAS and (2) multivariate BWAS reveal learning is to evaluate model accuracy (and other performance metrics)
substantially larger effects and are therefore more highly powered. on data independent of those used for training. In line with current
Marek et al.4 find that multivariate BWAS provide inflated in-sample recommendations for multivariate brain–behaviour analyses6,7, this
associations that often cannot be replicated (that is, are underpow- is typically performed using internal cross-validation (for example,
ered) unless thousands of participants are included. This implies that k-fold) to estimate unbiased effect sizes in a discovery sample, and
effect-size estimates from the discovery sample are necessarily inflated. (less commonly) further validating significant cross-validated effects
However, we distinguish between the effect-size estimation method in held-out or subsequently acquired replication samples2,5.
(in-sample versus cross-validated) and the sample (discovery versus Using cross-validation to estimate discovery-sample effects impacts
replication), and show that, with appropriate cross-validation, the the pool of studies selected for replication attempts, the degree of
in-sample inflation that Marek et al.4 report in the discovery sample can effect-size attenuation in replication samples, and the sample size
be entirely eliminated. With additional analyses, we demonstrate that needed for effective replication and mitigation of publication bias.
multivariate BWAS effects in high-quality datasets can be replicable To demonstrate this and provide quantitative estimates of sample size
with substantially smaller sample sizes in some cases. Specifically, requirements in multivariate BWAS, we analysed functional connec-
applying a standard multivariate prediction algorithm to functional tivity data from the Human Connectome Project8 (one of the datasets
connectivity in the Human Connectome Project yielded replicable in Marek et al.4) using cross-validation to estimate discovery-sample
effects with sample sizes of 75–500 for 5 of 6 phenotypes tested (Fig. 1). effect sizes. As shown in Fig. 1a–d, cross-validated discovery effect-
These analyses are limited to a selected number of phenotypes in a size estimates are unbiased (that is, not inflated on average), irrespec-
relatively high-quality dataset (measured in a young adult population tive of the sample size and the magnitude of the effect. As expected,
with a single scanner) and should not be overgeneralized. However, even with cross-validation, smaller sample sizes resulted in lower power
they highlight that the key determinant of sample size requirements (Fig. 1e) and increased variability in effect-size estimates across sam-
is the true effect size of the brain–phenotype relationship and that, ples (Fig. 1c). Such variability is undesirable because it reduces the
with proper internal validation, appropriate effect-size estimates and probability of independent replication (Fig. 1f). Moreover, selection
sufficiently large effects for moderately sized studies are possible. biases—most notably, publication bias—can capitalize on such variabil-
Marek et al.4 evaluate in-sample effect-size inflation in multivariate ity to inflate effect sizes in the literature (Fig. 1g). Although these effects
BWAS by training various multivariate models in a ‘discovery sample’ of using small sample sizes are undesirable, they do not invalidate
Institute of Diagnostic and Interventional Radiology and Neuroradiology, University Medicine Essen, Essen, Germany. 2Center for Translational Neuro- and Behavioral Sciences, Department of
1
Neurology, University Medicine Essen, Essen, Germany. 3Department of Psychological and Brain Sciences, Dartmouth College, Hanover, NH, USA. ✉e-mail: tamas.spisak@uk-essen.de
a b c
0.8
Inflation (Δr)
Overestimated
0.6 0.5
Discovery sample r
0.4 0
0.2 Underestimated
0 Without CV With CV
–0.2 d
–0.4
In-sample r
0.5
–0.6
–0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 0
Replication sample r Replication sample r 0 200 400
Sample size: 50 100 200 300 495 Sample size
With cross-validation
Power Replication Publication bias
e Number in Number in f Number in Number in g
Δr( )
100 1
PC + Ridge PCA + SVR
100
PC + Ridge PCA + SVR
Inflation
375 350 400
Power
400
Prep
325 375
0 0 0
100 100 100 75 1 100
125 75 75
Inflation
Power
Fig. 1 | Examples of multivariate BWAS providing unbiased effect sizes and (coloured bars) using the prediction algorithm of Marek et al.4 (e and f (top),
high replicability with low to moderate sample sizes. a, Discovery sample the sample size required for 80% power or Prep is shown). The remaining three
effects in multivariate BWAS are inflated only if estimates are obtained without phenotypes require sample sizes of >500 (bars with arrows). Power and Prep can
cross-validation (CV). b, Cross-validation fully eliminates in-sample effect-size be substantially improved with a ridge regression-based model recommended
inflation and, as a consequence, provides higher replicability. Data are from in some comparison studies10,11 (e and f (bottom), with 80% power and Prep with
the Human Connectome Project (HCP1200, PTN release, n = 1,003). Each point sample sizes as low as n = 100 and n = 75, respectively, when predicting cognitive
in a and b corresponds to one bootstrap subsample, as in figure 4b of Marek ability, and sample sizes between 75 and 375 for other investigated variables
et al.4. The dotted lines denote the threshold for P = 0.05 with n = 495. Mean (fluid intelligence, episodic memory and cognitive flexibility), except inhibition
multivariate brain–behavioural phenotype associations across 100 bootstrap assessed with the flanker task, which replicated with n = 375 but did not reach
samples at n = 200 and for the full sample are denoted by red and purple dots. 80% power with n = 500. g, We estimated interactions between sample size and
c, The inflation of in-sample effect size obtained without cross-validation (red) publication bias by computing effect size inflation (rdiscovery − rreplication) only for
is reduced, but does not disappear, at higher sample sizes. Conversely, cross- those bootstrap cases in which prediction performance was significant (P > 0.05)
validated estimates (blue) are slightly pessimistic with low sample sizes in the replication sample. Our analysis shows that the effect-size inflation due
and become quickly unbiased as sample size is increased. d, Without cross- to publication bias is modest (<10%) with fewer than 500 participants for half of
validation, in-sample effect-size estimates are non-zero (r ≈ 0.5, red), even when the phenotypes using the model from Marek et al.4 and all phenotypes but the
predicting permuted outcome data. Cross-validation eliminates systematic bias flanker using the ridge model. The blue squares show conditional relationships
across all sample sizes (blue). The dashed lines in c and d denote 95% parametric assessed to derive metrics in e,f and g with reference to b. The top and bottom
confidence intervals, and the shaded areas denote bootstrap- and permutation- squares indicate positive and negative results in the discovery sample,
based confidence intervals. e,f, Cross-validated analysis reveals that sufficient respectively. The left and right squares indicate negative and positive results in
in-sample power (e) and out-of-sample replication probability (Prep) (f) can be the replication sample. The blue squares indicate how these conditions were
achieved for a variety of phenotypes at low or moderate sample sizes. applied to derive the metrics.
80% power and Prep are achievable in <500 participants for 3 out of 6 phenotypes
the use of multivariate BWAS in small samples, and publication biases size of the effects linking them, the algorithm and model-selection steps
can be mitigated by practices that, like internal cross-validation, are used and the use cases for the resulting brain measures. For example,
quickly becoming standards in the field2,5. These include preregistra- multivariate models trained on as few as 20 participants9 can have high
tion, registered reports, reporting confidence intervals and the use reliability (ICC = 0.84)10, broad external validity and large effect sizes
of hold-out samples tested only once on a single, optimized model to (Hedges g = 2.3)11 in independent samples (for example, more than 600
avoid overfitting. participants from 20 independent studies in ref. 11) when predicting
Given these considerations, we wondered how many participants are behavioural states within-person rather than traits. In this case, the
generally required for multivariate BWAS. The answer to this question benefit of large samples is primarily in accurately estimating local brain
depends on the reliability of both phenotypic and brain measures, the weights (model parameters)12 rather than increasing out-of-sample
Competing interests The authors declare no competing interests. © The Author(s) 2023
In our previous study1, we documented the effect of sample size on the false-negative rate), therefore restricting BWAS scope, and (2) inflation
reproducibility of brain-wide association studies (BWAS) that aim to of reported effects3,10–12. Thus, regardless of the method, associations
cross-sectionally relate individual differences in human brain structure based on small samples can remain distorted and lack generalizability
(cortical thickness) or function (resting-state functional connectivity until confirmed in large, diverse, independent samples.
(RSFC)) to cognitive or mental health phenotypes. Applying univariate We always test for BWAS replication with null models (using permu-
and multivariate methods (for example, support vector regression tation tests) of out-of-sample estimates to ensure that our reported
(SVR)) to three large-scale neuroimaging datasets (total n ≈ 50,000), reproducibility is unaffected by in-sample overfitting. Nonetheless,
we found that overall BWAS reproducibility was low for n < 1,000, due Spisak et al.8 argue against plotting inflated in-sample estimates1,10
to smaller than expected effect sizes. When samples and true effects are on the y axis, and out-of-sample values on the x axis, as we did
small, sampling variability, and/or overfitting can generate ‘statistically (Fig. 1a). Instead, they propose plotting cross-validated associations
significant’ associations that are likely to be reported due to publication from an initial, discovery sample (Fig. 1b ( y axis)) against split-half
bias, but are not reproducible2–5, and we therefore suggested that BWAS out-of-sample associations (x axis). However, cross-validation—just
should build on recent precedents6,7 and continue to aim for samples like split-half validation—estimates out-of-sample, and not in-sample,
in the thousands. In the accompanying Comment, Spisak et al.8 agree effect sizes13. The in-sample associations1,10 for the method of Spisak
that larger BWAS are better5,9, but argue that “multivariate BWAS effects et al.8 (Fig. 1b), that is, from data in the sample used to develop the
in high-quality datasets can be replicable with substantially smaller model, show the same degree of overfitting (Fig. 1a versus Fig. 1b). The
sample sizes in some cases” (n = 75–500); this suggestion is made on plot of Spisak et al.8 (Fig. 1c) simply adds an additional out-of-sample
the basis of analyses of a selected subset of multivariate cognition/RSFC test (cross-validation before split half), and therefore demonstrates
associations with larger effect sizes, using their preferred method (ridge the close correspondence between two different methods for
regression with partial correlations) in a demographically more homo- out-of-sample effect estimation14. Analogously, we can replace the
geneous, single-site/scanner sample (Human Connectome Project cross-validation step in the code of Spisak et al.8 with split-half valida-
(HCP), n = 1,200, aged 22–35 years). tion (our original out-of-sample test), obtaining split-half effects in
There is no disagreement that a minority of BWAS effects can the first half of the sample, and then comparing them to the split-half
replicate in smaller samples, as shown with our original methods1). estimates from the full sample (Fig. 1d). The strong correspondences
Using the exact methodology (including cross-validation) and code between cross-validation followed by split-half (Spisak et al. method8;
of Spisak et al.8 to repeat 64 multivariate BWAS in the 21-site, larger Fig. 1c) and repeated split-half validation (Fig. 1d) are guaranteed by
and more diverse Adolescent Brain Cognitive Development Study plotting out-of-sample estimates (from the same dataset) against one
(ABCD, n = 11,874, aged 9–11 years), we found that 31% replicated at another. Here, plotting cross-validated discovery sample estimates on
n = 1,000, dropping to 14% at n = 500 and none at n = 75. Contrary to the y axis (Fig. 1c,d) provides no additional information beyond the x
the claims of Spisak et al.8, replication failure was the outcome in most axis out-of-sample values. The critically important out-of-sample pre-
cases when applied to this larger, more diverse dataset. Basing general dictions, required for reporting multivariate results1, generated using
BWAS sample size recommendations on the largest effects has at least the method of Spisak et al.8 and our method are nearly identical (Fig. 1e).
two fundamental flaws: (1) failing to detect other true effects (for exam- As Spisak et al.8 highlight, cross-validation of some type is considered
ple, reducing the sample size from n = 1,000 to n = 500 leads to a 55% to be standard practice10, and yet the distribution of out-of-sample
1
Department of Psychiatry, Massachusetts General Hospital, Harvard Medical School, Boston, MA, USA. 2Department of Radiology, Washington University School of Medicine, St Louis, MO,
USA. 3Department of Psychiatry, Washington University School of Medicine, St Louis, MO, USA. 4Department of Neurology, Washington University School of Medicine, St Louis, MO, USA.
5
Department of Biomedical Engineering, Washington University in St Louis, St Louis, MO, USA. 6Division of Biostatistics, University of California San Diego, La Jolla, CA, USA. 7Oxford Big Data
Institute, Li Ka Shing Centre for Health Information and Discovery, Nuffield Department of Population Health, University of Oxford, Oxford, UK. 8Department of Electrical and Computer
Engineering, National University of Singapore, Singapore, Singapore. 9Centre for Sleep and Cognition, National University of Singapore, Singapore, Singapore. 10Centre for Translational MR
Research, National University of Singapore, Singapore, Singapore. 11N.1 Institute for Health, Institute for Digital Medicine, National University of Singapore, Singapore, Singapore. 12Integrative
Sciences and Engineering Programme, National University of Singapore, Singapore, Singapore. 13Martinos Center for Biomedical Imaging, Massachusetts General Hospital, Charlestown, MA,
USA. 14Department of Psychological and Brain Sciences, Washington University in St Louis, St Louis, MO, USA. 15Department of Psychology, University of Pittsburgh, Pittsburgh, PA, USA.
16
Department of Psychiatry, University of Pittsburgh, Pittsburgh, PA, USA. 17Masonic Institute for the Developing Brain, University of Minnesota Medical School, Minneapolis, MN, USA.
18
Department of Pediatrics, University of Minnesota Medical School, Minneapolis, MN, USA. 19Institute of Child Development, University of Minnesota Medical School, Minneapolis, MN, USA.
20
Program in Occupational Therapy, Washington University School of Medicine, St Louis, MO, USA. 21Department of Pediatrics, Washington University School of Medicine, St Louis, MO, USA.
22
These authors contributed equally: Brenden Tervo-Clemmens, Scott Marek. 23These authors jointly supervised this work: Damien A. Fair, Nico U. F. Dosenbach. ✉e-mail: btervo-clemmens@
mgh.harvard.edu; smarek@wustl.edu; faird@umn.edu; ndosenbach@wustl.edu
Out-of-sample r (cross-validation)
0.8 0.8 0.8 0.8
Out-of-sample r (split-half)
0.6 0.6 0.6 0.6
0.4 0.4 0.4 0.4
In-sample r
In-sample r
0.2 0.2 0.2 0.2
0 0 0 0
–0.2 Sample size –0.2 –0.2 –0.2
–0.4 50 495 –0.4 –0.4 –0.4
-0.6 –0.6 –0.6 –0.6
–0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25 –0.50 –0.25 0 0.25
Out-of-sample r Out-of-sample r Out-of-sample r Out-of-sample r
Multivariate r
Multivariate r
Multivariate r
0.2
0.6 0.6 0.6
0
0.4 0.4 0.4
–0.2
0.2 0.2 0.2
–0.4
–0.6 0 0 0
–0.6 –0.4 –0.2 0 0.2 0.4 0.6 30 100 300 1,000 30 100 300 1,000 30 100 300 1,000
Cross-validation Sample size Sample size Sample size
out-of-sample r
Fig. 1 | In-sample versus out-of-sample effect estimates in multivariate validation provides a different (compared with c) out-of-sample association
BWAS. a–e, Methods comparison between our previous study1 (split-half) and of the first half of the total data (that is, each of the first stage split halves is
Spisak et al.8 (cross-validation followed by split-half). ‘Marek, Tervo-Clemmens’ one-quarter of the total data; y axis). The appropriate and direct comparison
and ‘Spisak’ refer to the methodolgies described in ref. 1 and ref. 8, respectively. of in-sample associations between Spisak et al.8 and our previous study1 is
For a–e, HCP 1200 Release (full correlation) data were used to predict age- comparing b to a, rather than c to a. The Spisak et al. method8 (cross-validation
adjusted total cognitive ability. Analysis code and visualizations (x,y scaling; followed by split-half validation) does not reduce in-sample overfitting (b) but,
colours) are the same as in Spisak et al.8. The x axes in a–e always display the instead, adds an additional out-of-sample evaluation (c), which is nearly
split-half out-of-sample effect estimates from the second (replication) half of identical to split-half validation twice in a row (d), and makes it clear why the
the data (correlation between true scores and predicted scores; as in Spisak out-of-sample performance of these two methods is likewise nearly identical.
et al.8 and in our previous study1; Supplementary Methods). a, In-sample e, Correspondence between out-of-sample associations (to the left-out half)
(training correlation; y axis) as a function of out-of-sample associations from the additional cross-validation step proposed by Spisak et al.8 (mean
(plot convention in our previous study1). b, Matched comparison of the true across folds; y axis) and the original split-half validation from our previous
in-sample association (training correlations, mean across folds; y axis) in the study1 (x axis). The identity line is shown in black. f, In-sample (r; light blue) and
method proposed by Spisak et al.8. c, The proposed correction by Spisak et al.8 out-of-sample (r; dark blue) associations as a function of sample size. Data are
that inserts an additional cross-validation step to evaluate the first half from figure 4a–d of ref. 1. g, Published literature review of multivariate r (y axis)
of data, which by definition makes this an out-of-sample association (y axis). as a function of sample size (data from ref. 15) displayed with permission.
d, Replacing the cross-validation step from Spisak et al.8 with a split-half For f and g, best fit lines are displayed in log10 space. h, Overlap of f and g.
associations (Fig. 1f (dark blue)) does not match published multivariate r = 0.37; compare with the correlation strength for height versus weight
BWAS results (Fig. 1g), which have largely ranged from r = 0.25 to 0.9, r = 0.44)20 and age (not a complex behavioural phenotype), unrepresent-
decreasing with increasing sample size10,15,16. Instead, published effects ative of BWAS as a whole (Fig. 2b (colour versus grey lines)). As the HCP is
more closely follow the distribution of in-sample associations (Fig. 1h). the relatively smallest and most homogeneous dataset, we applied the
This observation suggests that, in addition to small samples, struc- exact method and code of Spisak et al.8 to the ABCD data (Fig. 2c and Sup-
tural problems in academic research (for example, non-representative plementary Table 2). At n = 1,000 (training; n = 2,000 total), only 31% of
samples, publication bias, misuse of cross-validation and unintended BWAS (44% RSFC, 19% cortical thickness) were replicable (Fig. 2d; defined
overfitting) have contributed to the publication of inflated effects12,17,18. as in Spisak et al.8; Supplementary Information). Expanding BWAS scope
A recent biomarker challenge5 showed that cross-validation results beyond broad cognitive abilities towards complex mental health out-
continued to improve with the amount of time researchers spent with comes therefore requires n > 1,000 (Fig. 2b–d). The absolute largest
the data, and the models with the best cross-validation results per- BWAS (cognitive ability: RSFC, green) reached replicability only using
formed worse on never-seen held-back data. Thus, cross-validation n = 400 (n = 200 train; n = 200 test) with an approximate 40% decrease in
alone has proven to be insufficient and must be combined with the out-of-sample prediction accuracies from HCP to ABCD (Fig. 2e (lighter
increased generalizability of large, diverse datasets and independent green, left versus right)). The methods of Spisak et al.8 and our previ-
out-of-sample evaluation in new, never before seen data5,10. ous study1 returned equivalent out-of-sample reproducibility for this
The use of additional cross-validation in the discovery sample by BWAS (cognitive ability: RSFC) in the larger, more diverse ABCD data
Spisak et al.8 does not affect out-of-sample prediction accuracies (Fig. 1e). (Fig. 2e (right, dark versus light green)). Thus, the smaller sample sizes
However, by using partial correlations and ridge regression on HCP data, (Fig. 2b,c) that are required for out-of-sample reproducibility (Fig. 2e)
they were able to generate higher out-of-sample prediction accuracies reported by Spisak et al.8 in the HCP data did not generalize to the larger
than our original results in ABCD (Fig. 2a). The five variables they selected ABCD dataset. See also our previous study1 for a broader discussion of
are strongly correlated19 cognitive measures from the NIH Toolbox (mean convergent evidence across HCP and ABCD datasets.
Out-of-sample r
Out-of-sample r
intelligence
Cognitive
0.3 0.3 flexibility 0.3
Episodic
0.2 0.2 memory 0.2
Inhibition
0.1 0.1 (flanker) 0.1
Additional
0 0 BWAS 0
Bivariate correlation r
75
Out-of-sample r 0.4 0.50 0.50
Out-of-sample r
ABCD
0.3
0.25 0.25
50
0.2
0 0
25 0.1
SVR –0.25 –0.25
0 Ridge
0 –0.50 –0.50
30 100 300 1,000 50 200 1,000 50 200 1,000
HCP ABCD
Training sample size Total sample size
Fig. 2 | BWAS reproducibility, scope and prediction accuracy using the of our original method in our previous study1 and the method proposed by
method of Spisak et al. a, Example bootstrapped BWAS of total cognitive Spisak et al.8 at the full split-half sample size of HCP (left) and ABCD (right).
ability (green) and null distribution (black) (y axis), as a function of sample size Out-of-sample correlations (RSFC with total cognitive ability, y axis) for the
(x axis) from the suggested method of Spisak et al.8 (RSFC by partial correlation; method used in our previous study1 (dark green; RSFC by correlation, PCA, SVR)
prediction by ridge regression) in the HCP dataset (n = 1,200, 1 site, 1 scanner, and by Spisak et al.8 (light green; RSFC by partial correlation, ridge regression).
60 min RSFC/participant, 76% white). Sample sizes were log10 -transformed for Repeating the method proposed by Spisak et al.8 in ABCD (right) and comparing
visualization. b, Out-of-sample correlation (between true scores and predicted this to the method used in our previous study1 results in a very similar out-of-
scores) from ridge regression (y axis; code from Spisak et al.8) as a function of sample r. f, Simulated individual studies (light green circles; n = 1,000 per
training sample size (x axis, log10 scaling) for 33 cognitive and mental health sample size) and meta-analytic estimates (black dot, ±1 s.d.) using the method
phenotypes (Supplementary Information) in the HCP dataset. Each line displays of Spisak et al.8 (partial correlations in the HCP dataset) for the largest univariate
a smoothed fit estimate (through penalized splines in general additive models) association (left; y axis, bivariate correlation) and multivariate association
for a brain (RSFC (partial correlations, as proposed by Spisak et al.8), cortical (right; y axis, out-of-sample correlation) for total cognitive ability versus RSFC,
thickness) phenotype pair (66 total) that has 100 bootstrapped iterations as a function of total sample size (x axis; bivariate correlation for sample sizes
from sample sizes of 25 to 500 (inclusive) in increments of 25 (20 total bins). of 50, 200 and 1,000, and multivariate sum of train and test samples, each 25,
Sample sizes were log10 -transformed (for visualization) before general additive 100 and 500). For univariate approaches, studies of any sample size, when
model fitting. c, The same as in b, but in the ABCD dataset (n = 11,874, 21 sites, appropriately aggregated to a large total sample size, can correctly estimate
3 scanner manufacturers, 20 min RSFC/participant, 56% white) using 32 the true effect size. However, for multivariate approaches, even when
cognitive and mental health phenotypes at sample sizes of 25, 50, 75 and from aggregating across 1,000 independent studies, studies with a small sample
100 to 1,900 (inclusive) in increments of 100 (22 total bins). d, The percentage size produce prediction accuracies that are downwardly biased relative to
of brain–phenotype pairs (BWAS) from b and c with significant replication on the large sample studies, highlighting the need for large samples in multivariate
basis of the method of Spisak et al.8 (Supplementary Information). e, Comparison analyses.
Notably, the objections of Spisak et al.8 raise additional reasons to white Americans transferred poorly to African Americans and vice versa
stop the use of smaller samples in BWAS that were not highlighted in (within dataset)24. Historically, BWAS samples have lacked diversity,
our original article. Multivariate BWAS prediction accuracies—absent neglecting marginalized and under-represented minorities25. Large
overfitting—are systematically suppressed in smaller samples5,9,21, as studies with more diverse samples and data aggregation efforts can
prediction accuracy scales with increasing sample size1,9. Thus, the improve BWAS generalizability and reduce scientific biases contribut-
claim that “cross-validated discovery effect-size estimates are unbi- ing to massive health inequities26,27.
ased” does not account for out-of-dataset generalizability and down- Spisak et al.8 worry that “[r]equiring sample sizes that are larger
ward bias. In principle, if unintended overfitting and publication bias than necessary for the discovery of new effects could stifle innova-
could be fully eliminated, meta-analyses of small-sample univariate tion”. We appreciate the concern that rarer populations may never
BWAS would return the correct association strengths (Fig. 2f (left)). be investigated with BWAS. Yet, there are many non-BWAS brain–
However, meta-analyses of small multivariate BWAS would always behaviour study designs (fMRI ≠ BWAS) focused on within-patient
be downwardly biased (Fig. 2f (right)). If we are interested in maxi- effects, repeated-sampling and signal-to-noise-ratio improvements
mizing prediction accuracy, essential for clinical implementation of that have proven fruitful down to n = 1 (ref. 28). By contrast, the strength
BWAS22, large samples and advancements in imaging and phenotypic of multivariate BWAS lies in leveraging large cross-sectional samples
measurements1 are necessary. to investigate population-level questions. Sample size requirements
Repeatedly subsampling the same dataset, as Spisak et al.8 and we should be based on expected effect sizes and real-world impact,
have done, overestimates reproducibility compared with testing on a and not resource availability. Through large-scale collaboration and
truly new, diverse dataset. Just as in genomics23, BWAS generalization clear standards on data sharing, GWAS has reached sample sizes in the
failures have been highlighted5,24. For example, BWAS models trained on millions29–31, pushing genomics towards new horizons. Similarly, BWAS